F461235

General Info

Members Datasets Scaffolds Average Seq Length
540 223 539 291

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10027816|Ga0213872_100278162
Length 324
Sequence MSGVQRVPGGQPCYDGGNGCSPSQPTEVSLMSPFSRREFIKGSLAAGTLAGIGTLPLQAKARTATDTVTLGKSGMQVTRLAFGTGSNGGEVQAALGQKEFSRLVAYAYDHGLRFFETAEAYQTPAMLGEALKPYPRDSYKLMSKITTFHEGDPLTRLYEQRRISQTEYFDIMLLHWQHTPDWTTTTARWQDAILEAQAKKTILTRGASVHGLPALRQMPGNQWLQIAMIRMNHNGTRMDGPTYEDNNNPDHVTEVVEHVKQVHSQGMGVISMKLCGNGNFTKREDRQAAMRFAFNHAGVDCVTVGFKNTGEIDEAIENVNLALA

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.7
Metatranscriptomes 6.11
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.33
Rhizosphere 95.19
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10068752 3300003320 Bacteria 15287
2 Ga0070658_10013171 3300005327 Bacteria 6634
3 Ga0070658_10161377 3300005327 Bacteria 1880
4 Ga0070658_10248661 3300005327 Bacteria 1508
5 Ga0070676_10095799 3300005328 Unclassified 1825
6 Ga0070683_100000006 3300005329 Bacteria 361071
7 Ga0070683_100000090 3300005329 Bacteria 59739
8 Ga0070683_100068633 3300005329 Bacteria 3303
9 Ga0070683_100231412 3300005329 Unclassified 1757
10 Ga0070683_100485320 3300005329 Bacteria 1180
11 Ga0070670_100000411 3300005331 Bacteria 35280
12 Ga0070670_100029502 3300005331 Bacteria 4723
13 Ga0068869_100000036 3300005334 Bacteria 55466
14 Ga0068869_100285365 3300005334 Unclassified 1329
15 Ga0070682_100043629 3300005337 Unclassified 2774
16 Ga0068868_100000152 3300005338 Bacteria 44788
17 Ga0068868_100518788 3300005338 Unclassified 1046
18 Ga0070660_100235790 3300005339 Bacteria 1489
19 Ga0070661_100039486 3300005344 Bacteria 3439
20 Ga0070661_100055122 3300005344 Bacteria 2911
21 Ga0070661_100205721 3300005344 Bacteria 1505
22 Ga0070668_100077867 3300005347 Unclassified 2592
23 Ga0070671_100036061 3300005355 Bacteria 4100
24 Ga0070667_100000709 3300005367 Bacteria 32126
25 Ga0070709_10000498 3300005434 Bacteria 23165
26 Ga0070714_100036624 3300005435 Bacteria 4116
27 Ga0070714_100117216 3300005435 Bacteria 2365
28 Ga0070714_100303590 3300005435 Unclassified 1489
29 Ga0070713_100000322 3300005436 Bacteria 31317
30 Ga0070713_100016467 3300005436 Bacteria 5559
31 Ga0070713_100048771 3300005436 Unclassified 3489
32 Ga0070713_100076649 3300005436 Unclassified 2841
33 Ga0070713_100211257 3300005436 Bacteria 1757
34 Ga0070710_10011092 3300005437 Unclassified 4443
35 Ga0070710_10079315 3300005437 Unclassified 1913
36 Ga0070711_100065877 3300005439 Bacteria 2535
37 Ga0070711_100147501 3300005439 Unclassified 1771
38 Ga0070663_100010906 3300005455 Bacteria 5678
39 Ga0070663_100077401 3300005455 Bacteria 2435
40 Ga0070678_100198742 3300005456 Bacteria 1653
41 Ga0070662_100095633 3300005457 Unclassified 2239
42 Ga0070681_10006466 3300005458 Bacteria 11407
43 Ga0070681_10008726 3300005458 Bacteria 9945
44 Ga0070685_10365560 3300005466 Bacteria 990
45 Ga0070679_100195637 3300005530 Bacteria 1989
46 Ga0070684_100000889 3300005535 Bacteria 21143
47 Ga0070684_100009388 3300005535 Bacteria 7702
48 Ga0070684_100024793 3300005535 Bacteria 5034
49 Ga0070684_100035098 3300005535 Unclassified 4290
50 Ga0070684_100064002 3300005535 Bacteria 3226
51 Ga0070684_100513117 3300005535 Unclassified 1111
52 Ga0070697_100266776 3300005536 Bacteria 1467
53 Ga0068853_100000203 3300005539 Bacteria 41915
54 Ga0068853_100061472 3300005539 Bacteria 3249
55 Ga0068853_100073407 3300005539 Bacteria 2983
56 Ga0070672_100063539 3300005543 Bacteria 2915
57 Ga0070665_100002484 3300005548 Bacteria 20306
58 Ga0070665_100037955 3300005548 Bacteria 4843
59 Ga0070665_100042539 3300005548 Bacteria 4567
60 Ga0070665_100131364 3300005548 Bacteria 2506
61 Ga0070665_100358362 3300005548 Bacteria 1464
62 Ga0068855_100002968 3300005563 Bacteria 20742
63 Ga0068855_100013422 3300005563 Bacteria 9879
64 Ga0068855_100039278 3300005563 Bacteria 5618
65 Ga0068855_100152839 3300005563 Bacteria 2624
66 Ga0070664_100089095 3300005564 Bacteria 2669
67 Ga0068857_100001869 3300005577 Bacteria 16949
68 Ga0068857_100002976 3300005577 Bacteria 13962
69 Ga0068856_100000187 3300005614 Bacteria 64851
70 Ga0068856_100019986 3300005614 Bacteria 6501
71 Ga0068856_100033425 3300005614 Bacteria 5035
72 Ga0068856_100059384 3300005614 Bacteria 3778
73 Ga0068856_100090377 3300005614 Bacteria 3046
74 Ga0068856_100108662 3300005614 Bacteria 2770
75 Ga0068856_100186551 3300005614 Bacteria 2088
76 Ga0068852_100000008 3300005616 Bacteria 154351
77 Ga0068852_100000082 3300005616 Bacteria 67016
78 Ga0068852_100044163 3300005616 Bacteria 3783
79 Ga0068852_100062164 3300005616 Bacteria 3247
80 Ga0068852_100070598 3300005616 Unclassified 3065
81 Ga0068852_100080148 3300005616 Bacteria 2894
82 Ga0068852_100192719 3300005616 Bacteria 1924
83 Ga0068852_100432265 3300005616 Bacteria 1300
84 Ga0068859_100009321 3300005617 Bacteria 9909
85 Ga0068859_100343015 3300005617 Bacteria 1588
86 Ga0068864_100003925 3300005618 Bacteria 12252
87 Ga0068851_10001200 3300005834 Bacteria 11246
88 Ga0068851_10008990 3300005834 Unclassified 4635
89 Ga0068851_10020267 3300005834 Bacteria 3218
90 Ga0068863_100000811 3300005841 Bacteria 31348
91 Ga0068863_100043253 3300005841 Bacteria 4276
92 Ga0068863_100082041 3300005841 Bacteria 3055
93 Ga0068858_100000955 3300005842 Bacteria 29910
94 Ga0068858_100082987 3300005842 Bacteria 2980
95 Ga0068858_100379438 3300005842 Unclassified 1356
96 Ga0068858_100521534 3300005842 Unclassified 1149
97 Ga0068860_100000854 3300005843 Bacteria 33984
98 Ga0068860_100588020 3300005843 Bacteria 1118
99 Ga0068862_100061153 3300005844 Bacteria 3237
100 Ga0081540_1036279 3300005983 Bacteria 2631
101 Ga0081540_1058906 3300005983 Bacteria 1847
102 Ga0081539_10022163 3300005985 Bacteria 4212
103 Ga0070717_10001169 3300006028 Bacteria 17721
104 Ga0070717_10023076 3300006028 Unclassified 4924
105 Ga0070717_10047743 3300006028 Bacteria 3509
106 Ga0070715_10025728 3300006163 Unclassified 2335
107 Ga0070716_100007168 3300006173 Bacteria 5480
108 Ga0070716_100023022 3300006173 Unclassified 3299
109 Ga0070716_100074688 3300006173 Unclassified 2004
110 Ga0070712_100000456 3300006175 Bacteria 23452
111 Ga0070712_100056055 3300006175 Unclassified 2763
112 Ga0070712_100064368 3300006175 Unclassified 2600
113 Ga0070712_100225162 3300006175 Unclassified 1487
114 Ga0097621_100000450 3300006237 Bacteria 28799
115 Ga0097621_100003099 3300006237 Bacteria 11403
116 Ga0097621_100018742 3300006237 Bacteria 5295
117 Ga0097621_100073459 3300006237 Unclassified 2831
118 Ga0068871_100000380 3300006358 Bacteria 31116
119 Ga0068871_100013157 3300006358 Bacteria 6136
120 Ga0068871_100017473 3300006358 Bacteria 5429
121 Ga0068871_100032506 3300006358 Bacteria 4123
122 Ga0068871_100206843 3300006358 Unclassified 1696
123 Ga0068865_100015780 3300006881 Unclassified 4819
124 Ga0097620_100009321 3300006931 Bacteria 9909
125 Ga0097620_100343013 3300006931 Bacteria 1588
126 Ga0105240_10000038 3300009093 Bacteria 270341
127 Ga0105240_10000360 3300009093 Bacteria 85690
128 Ga0105240_10000983 3300009093 Bacteria 50850
129 Ga0105240_10006147 3300009093 Bacteria 17705
130 Ga0105240_10008566 3300009093 Bacteria 14616
131 Ga0105240_10016990 3300009093 Bacteria 9829
132 Ga0105240_10019362 3300009093 Bacteria 9096
133 Ga0105240_10693748 3300009093 Unclassified 1112
134 Ga0111539_10296306 3300009094 Unclassified 1882
135 Ga0105245_10000372 3300009098 Bacteria 41796
136 Ga0105245_10002893 3300009098 Bacteria 15415
137 Ga0105245_10179958 3300009098 Bacteria 2019
138 Ga0105247_10001579 3300009101 Bacteria 16180
139 Ga0105247_10264026 3300009101 Bacteria 1181
140 Ga0105241_10000026 3300009174 Bacteria 132695
141 Ga0105241_10000429 3300009174 Bacteria 31800
142 Ga0105241_10000588 3300009174 Bacteria 27439
143 Ga0105241_10010226 3300009174 Bacteria 6892
144 Ga0105241_10059926 3300009174 Unclassified 2928
145 Ga0105241_10130233 3300009174 Bacteria 2036
146 Ga0105242_10376502 3300009176 Unclassified 1318
147 Ga0105242_10723228 3300009176 Bacteria 977
148 Ga0105248_10000004 3300009177 Bacteria 695244
149 Ga0105248_10018823 3300009177 Bacteria 7637
150 Ga0105248_10034837 3300009177 Bacteria 5633
151 Ga0105248_10366351 3300009177 Bacteria 1622
152 Ga0105248_10437391 3300009177 Bacteria 1473
153 Ga0105248_10492852 3300009177 Unclassified 1381
154 Ga0105248_10609952 3300009177 Bacteria 1231
155 Ga0105248_10661262 3300009177 Unclassified 1179
156 Ga0105237_10001153 3300009545 Bacteria 35396
157 Ga0105237_10012752 3300009545 Bacteria 8840
158 Ga0105237_10025910 3300009545 Bacteria 5995
159 Ga0105237_10031781 3300009545 Bacteria 5347
160 Ga0105237_10032425 3300009545 Bacteria 5290
161 Ga0105237_10051003 3300009545 Bacteria 4158
162 Ga0105237_10059732 3300009545 Bacteria 3814
163 Ga0105237_10250859 3300009545 Bacteria 1772
164 Ga0105237_10358887 3300009545 Unclassified 1462
165 Ga0105237_10369560 3300009545 Unclassified 1439
166 Ga0105238_10000137 3300009551 Bacteria 80931
167 Ga0105238_10000218 3300009551 Bacteria 63093
168 Ga0105238_10001537 3300009551 Bacteria 23148
169 Ga0105238_10009372 3300009551 Bacteria 9798
170 Ga0105238_10016086 3300009551 Bacteria 7565
171 Ga0105238_10033638 3300009551 Bacteria 5216
172 Ga0105238_10047816 3300009551 Unclassified 4312
173 Ga0105238_10080962 3300009551 Bacteria 3236
174 Ga0105238_10148750 3300009551 Bacteria 2318
175 Ga0105249_10037792 3300009553 Bacteria 4381
176 Ga0105249_10120269 3300009553 Bacteria 2495
177 Ga0105249_10873964 3300009553 Unclassified 965
178 Ga0105239_10001628 3300010375 Bacteria 29653
179 Ga0105239_10003331 3300010375 Bacteria 19772
180 Ga0105239_10004953 3300010375 Bacteria 15722
181 Ga0105239_10251760 3300010375 Bacteria 1984
182 Ga0105239_10494148 3300010375 Unclassified 1391
183 Ga0105246_10000487 3300011119 Bacteria 21462
184 Ga0157373_10035248 3300013100 Unclassified 3593
185 Ga0157373_10070506 3300013100 Bacteria 2470
186 Ga0157373_10378437 3300013100 Bacteria 1012
187 Ga0157371_10027364 3300013102 Bacteria 4136
188 Ga0157370_10000130 3300013104 Bacteria 89817
189 Ga0157370_10137395 3300013104 Bacteria 2278
190 Ga0157370_10446995 3300013104 Unclassified 1188
191 Ga0157369_10000058 3300013105 Bacteria 154342
192 Ga0157369_10001028 3300013105 Bacteria 35223
193 Ga0157369_10002904 3300013105 Bacteria 20480
194 Ga0157369_10008970 3300013105 Bacteria 11455
195 Ga0157369_10019950 3300013105 Bacteria 7496
196 Ga0157369_10030039 3300013105 Bacteria 5997
197 Ga0157369_10056574 3300013105 Bacteria 4232
198 Ga0157369_10081547 3300013105 Plasmid 3462
199 Ga0157369_10090084 3300013105 Bacteria 3275
200 Ga0157369_10189082 3300013105 Bacteria 2164
201 Ga0157374_10000512 3300013296 Bacteria 34928
202 Ga0157374_10005667 3300013296 Bacteria 10525
203 Ga0157374_10005714 3300013296 Bacteria 10496
204 Ga0157374_10007314 3300013296 Bacteria 9413
205 Ga0157374_10007590 3300013296 Bacteria 9255
206 Ga0157374_10014675 3300013296 Bacteria 6857
207 Ga0157374_10017211 3300013296 Bacteria 6363
208 Ga0157374_10173514 3300013296 Bacteria 2104
209 Ga0157374_10197596 3300013296 Bacteria 1968
210 Ga0157378_10003221 3300013297 Bacteria 14517
211 Ga0157378_10005121 3300013297 Bacteria 11508
212 Ga0157378_10116562 3300013297 Unclassified 2456
213 Ga0163162_10001417 3300013306 Bacteria 22285
214 Ga0163162_10032285 3300013306 Bacteria 5199
215 Ga0163162_10115175 3300013306 Unclassified 2788
216 Ga0163162_10823413 3300013306 Unclassified 1045
217 Ga0157372_10000163 3300013307 Bacteria 73216
218 Ga0157372_10009471 3300013307 Bacteria 10358
219 Ga0157372_10009618 3300013307 Bacteria 10274
220 Ga0157372_10015810 3300013307 Bacteria 8096
221 Ga0157372_10018728 3300013307 Bacteria 7449
222 Ga0157372_10033478 3300013307 Bacteria 5645
223 Ga0157372_10045824 3300013307 Bacteria 4853
224 Ga0157372_10050697 3300013307 Bacteria 4616
225 Ga0157372_10054160 3300013307 Bacteria 4474
226 Ga0157372_10095186 3300013307 Bacteria 3392
227 Ga0157372_10106139 3300013307 Bacteria 3213
228 Ga0157375_10001295 3300013308 Bacteria 21530
229 Ga0157375_10017125 3300013308 Bacteria 6533
230 Ga0163163_10000826 3300014325 Bacteria 26368
231 Ga0163163_10048927 3300014325 Bacteria 4159
232 Ga0163163_10069858 3300014325 Bacteria 3497
233 Ga0163163_10178122 3300014325 Bacteria 2173
234 Ga0163163_10196400 3300014325 Unclassified 2066
235 Ga0157377_10039283 3300014745 Bacteria 2617
236 Ga0157379_10000147 3300014968 Bacteria 51402
237 Ga0157379_10186905 3300014968 Bacteria 1872
238 Ga0157376_10000447 3300014969 Bacteria 26609
239 Ga0157376_10167041 3300014969 Unclassified 2000
240 Ga0206352_10338750 3300020078 Bacteria 957
241 Ga0206352_10822384 3300020078 Bacteria 1041
242 Ga0213873_10041264 3300021358 Unclassified 1189
243 Ga0213872_10005995 3300021361 Bacteria 6161
244 Ga0213872_10011855 3300021361 Unclassified 4117
245 Ga0213872_10027816 3300021361 Bacteria 2594
246 Ga0213876_10046343 3300021384 Unclassified 2298
247 Ga0224712_10164438 3300022467 Bacteria 992
248 Ga0207656_10014445 3300025321 Bacteria 3042
249 Ga0207656_10024981 3300025321 Bacteria 2422
250 Ga0207656_10041312 3300025321 Bacteria 1959
251 Ga0207656_10054917 3300025321 Bacteria 1732
252 Ga0207692_10031833 3300025898 Unclassified 2529
253 Ga0207692_10036677 3300025898 Unclassified 2393
254 Ga0207710_10000251 3300025900 Bacteria 44887
255 Ga0207710_10056068 3300025900 Bacteria 1778
256 Ga0207685_10041010 3300025905 Unclassified 1729
257 Ga0207699_10002436 3300025906 Bacteria 8782
258 Ga0207699_10357006 3300025906 Unclassified 1033
259 Ga0207705_10181192 3300025909 Bacteria 1590
260 Ga0207705_10185675 3300025909 Unclassified 1571
261 Ga0207654_10000017 3300025911 Bacteria 201589
262 Ga0207654_10000099 3300025911 Bacteria 57684
263 Ga0207654_10000135 3300025911 Bacteria 47542
264 Ga0207654_10052669 3300025911 Unclassified 2347
265 Ga0207707_10003922 3300025912 Bacteria 13211
266 Ga0207707_10070977 3300025912 Bacteria 3035
267 Ga0207695_10000070 3300025913 Bacteria 318111
268 Ga0207695_10000080 3300025913 Bacteria 287868
269 Ga0207695_10000113 3300025913 Bacteria 247240
270 Ga0207695_10000561 3300025913 Bacteria 76257
271 Ga0207695_10005420 3300025913 Bacteria 16928
272 Ga0207695_10020454 3300025913 Bacteria 7579
273 Ga0207695_10028959 3300025913 Bacteria 6129
274 Ga0207695_10165623 3300025913 Unclassified 2139
275 Ga0207695_10497044 3300025913 Bacteria 1102
276 Ga0207671_10000065 3300025914 Bacteria 166743
277 Ga0207671_10000123 3300025914 Bacteria 119385
278 Ga0207671_10052764 3300025914 Bacteria 3013
279 Ga0207671_10101167 3300025914 Bacteria 2183
280 Ga0207671_10170636 3300025914 Bacteria 1689
281 Ga0207671_10248924 3300025914 Bacteria 1397
282 Ga0207693_10000055 3300025915 Bacteria 96481
283 Ga0207693_10032288 3300025915 Bacteria 4132
284 Ga0207693_10220696 3300025915 Unclassified 1489
285 Ga0207663_10097796 3300025916 Unclassified 1964
286 Ga0207663_10282251 3300025916 Bacteria 1234
287 Ga0207649_10023678 3300025920 Bacteria 3559
288 Ga0207649_10060761 3300025920 Bacteria 2376
289 Ga0207649_10087657 3300025920 Bacteria 2031
290 Ga0207649_10183162 3300025920 Bacteria 1467
291 Ga0207694_10000112 3300025924 Bacteria 85385
292 Ga0207694_10000215 3300025924 Bacteria 56422
293 Ga0207694_10000940 3300025924 Bacteria 25679
294 Ga0207694_10028751 3300025924 Bacteria 4240
295 Ga0207694_10056904 3300025924 Bacteria 3039
296 Ga0207694_10124201 3300025924 Bacteria 2063
297 Ga0207694_10143225 3300025924 Unclassified 1923
298 Ga0207694_10206964 3300025924 Bacteria 1598
299 Ga0207650_10003613 3300025925 Bacteria 10606
300 Ga0207659_10149008 3300025926 Unclassified 1825
301 Ga0207687_10009806 3300025927 Bacteria 6268
302 Ga0207687_10163393 3300025927 Bacteria 1711
303 Ga0207700_10000206 3300025928 Bacteria 35436
304 Ga0207700_10087796 3300025928 Unclassified 2446
305 Ga0207700_10251516 3300025928 Unclassified 1510
306 Ga0207664_10103355 3300025929 Unclassified 2358
307 Ga0207664_10210827 3300025929 Bacteria 1681
308 Ga0207664_10314785 3300025929 Unclassified 1380
309 Ga0207644_10003113 3300025931 Bacteria 10669
310 Ga0207644_10059855 3300025931 Bacteria 2755
311 Ga0207706_10010126 3300025933 Bacteria 8632
312 Ga0207665_10030737 3300025939 Unclassified 3551
313 Ga0207665_10032962 3300025939 Unclassified 3432
314 Ga0207665_10048659 3300025939 Bacteria 2847
315 Ga0207691_10079783 3300025940 Bacteria 2945
316 Ga0207711_10000008 3300025941 Bacteria 597686
317 Ga0207711_10000010 3300025941 Bacteria 557970
318 Ga0207711_10001485 3300025941 Bacteria 21833
319 Ga0207711_10033102 3300025941 Bacteria 4372
320 Ga0207711_10144138 3300025941 Unclassified 2145
321 Ga0207711_10428298 3300025941 Bacteria 1231
322 Ga0207689_10001390 3300025942 Bacteria 23168
323 Ga0207689_10376561 3300025942 Unclassified 1182
324 Ga0207661_10000357 3300025944 Bacteria 29408
325 Ga0207661_10199548 3300025944 Unclassified 1758
326 Ga0207661_10434829 3300025944 Bacteria 1193
327 Ga0207679_10047692 3300025945 Bacteria 3114
328 Ga0207667_10003542 3300025949 Bacteria 19311
329 Ga0207667_10015867 3300025949 Bacteria 8533
330 Ga0207667_10018059 3300025949 Bacteria 7921
331 Ga0207667_10056227 3300025949 Bacteria 4134
332 Ga0207667_10143946 3300025949 Bacteria 2454
333 Ga0207667_10195382 3300025949 Bacteria 2076
334 Ga0207667_10217909 3300025949 Unclassified 1956
335 Ga0207712_10150259 3300025961 Bacteria 1798
336 Ga0207668_10032491 3300025972 Unclassified 3449
337 Ga0207640_10009572 3300025981 Bacteria 5432
338 Ga0207640_10034352 3300025981 Bacteria 3165
339 Ga0207640_10160081 3300025981 Bacteria 1664
340 Ga0207658_10000546 3300025986 Bacteria 34065
341 Ga0207677_10000114 3300026023 Bacteria 65804
342 Ga0207677_10060729 3300026023 Bacteria 2614
343 Ga0207703_10001906 3300026035 Bacteria 18491
344 Ga0207703_10064635 3300026035 Bacteria 3004
345 Ga0207703_10616529 3300026035 Unclassified 1027
346 Ga0207639_10000233 3300026041 Bacteria 41490
347 Ga0207639_10092285 3300026041 Bacteria 2426
348 Ga0207639_10094845 3300026041 Bacteria 2396
349 Ga0207639_10115648 3300026041 Bacteria 2194
350 Ga0207639_10482253 3300026041 Bacteria 1130
351 Ga0207678_10034906 3300026067 Bacteria 4379
352 Ga0207678_10136564 3300026067 Bacteria 2092
353 Ga0207702_10000343 3300026078 Bacteria 53525
354 Ga0207702_10000611 3300026078 Bacteria 39477
355 Ga0207702_10001988 3300026078 Bacteria 19846
356 Ga0207702_10036564 3300026078 Bacteria 4108
357 Ga0207702_10142973 3300026078 Bacteria 2167
358 Ga0207702_10282767 3300026078 Bacteria 1569
359 Ga0207641_10000319 3300026088 Bacteria 59351
360 Ga0207641_10003282 3300026088 Bacteria 14396
361 Ga0207641_10062036 3300026088 Bacteria 3189
362 Ga0207641_10152510 3300026088 Bacteria 2094
363 Ga0207641_10160389 3300026088 Unclassified 2044
364 Ga0207641_10279120 3300026088 Unclassified 1571
365 Ga0207676_10007628 3300026095 Bacteria 7682
366 Ga0207674_10000479 3300026116 Bacteria 52694
367 Ga0207674_10001109 3300026116 Bacteria 34940
368 Ga0207674_10077429 3300026116 Unclassified 3331
369 Ga0207674_10447033 3300026116 Bacteria 1249
370 Ga0207683_10001725 3300026121 Bacteria 19490
371 Ga0207698_10000010 3300026142 Bacteria 270583
372 Ga0207698_10000066 3300026142 Bacteria 70450
373 Ga0207698_10055735 3300026142 Bacteria 3049
374 Ga0207698_10123151 3300026142 Bacteria 2199
375 Ga0207698_10130113 3300026142 Bacteria 2149
376 Ga0207698_10158989 3300026142 Bacteria 1973
377 Ga0268266_10017152 3300028379 Bacteria 6183
378 Ga0268266_10042517 3300028379 Bacteria 3882
379 Ga0268266_10093654 3300028379 Bacteria 2636
380 Ga0268266_10219847 3300028379 Bacteria 1746
381 Ga0268265_10175469 3300028380 Bacteria 1836
382 Ga0268264_10000718 3300028381 Bacteria 38048
383 Ga0268264_10265703 3300028381 Bacteria 1601
384 Ga0268264_10344482 3300028381 Bacteria 1417
385 Ga0268264_10621022 3300028381 Unclassified 1067
386 Ga0265338_10012853 3300028800 Bacteria 9514
387 Ga0265338_10176969 3300028800 Bacteria 1630
388 Ga0265760_10048201 3300031090 Bacteria 1280
389 Ga0265330_10000375 3300031235 Bacteria 31300
390 Ga0265330_10002693 3300031235 Bacteria 9595
391 Ga0265325_10000051 3300031241 Bacteria 78605
392 Ga0265325_10014063 3300031241 Bacteria 4537
393 Ga0265325_10073152 3300031241 Bacteria 1716
394 Ga0265325_10116547 3300031241 Bacteria 1292
395 Ga0265325_10126955 3300031241 Unclassified 1225
396 Ga0265340_10033458 3300031247 Bacteria 2559
397 Ga0265339_10002079 3300031249 Bacteria 14664
398 Ga0265339_10088598 3300031249 Unclassified 1625
399 Ga0265316_10000539 3300031344 Bacteria 42671
400 Ga0265316_10027073 3300031344 Bacteria 4756
401 Ga0265316_10079431 3300031344 Bacteria 2517
402 Ga0265316_10235439 3300031344 Bacteria 1347
403 Ga0265313_10002617 3300031595 Bacteria 15308
404 Ga0265313_10042380 3300031595 Bacteria 2236
405 Ga0265313_10065272 3300031595 Bacteria 1690
406 Ga0265314_10004981 3300031711 Bacteria 12109
407 Ga0265314_10084913 3300031711 Bacteria 2077
408 Ga0265314_10085513 3300031711 Unclassified 2067
409 Ga0265314_10162542 3300031711 Bacteria 1357
410 Ga0265314_10215320 3300031711 Bacteria 1125
411 Ga0265342_10000671 3300031712 Bacteria 35667
412 Ga0373926_0012571 3300035083 Unclassified 2863
413 Ga0373934_0094328 3300035086 Unclassified 1208
414 Ga0373936_0048750 3300035113 Unclassified 1710
415 Ga0373945_0012813 3300035116 Unclassified 2791
416 Ga0373957_0127025 3300035120 Bacteria 1036
417 Ga0373955_0097220 3300035172 Bacteria 1686
418 Ga0373955_0142863 3300035172 Unclassified 1404
419 Ga0373955_0247663 3300035172 Unclassified 1068
420 Ga0373924_0180927 3300035410 Bacteria 928
421 Ga0373931_0198066 3300035691 Unclassified 1198
422 Ga0373931_0215187 3300035691 Bacteria 1154
423 Ga0373935_0010978 3300035692 Bacteria 5441
424 Ga0373935_0035599 3300035692 Bacteria 3108
425 Ga0373935_0110941 3300035692 Unclassified 1821
426 Ga0373935_0296122 3300035692 Unclassified 1142
427 Ga0373927_0001395 3300035695 Bacteria 18205
428 Ga0373927_0003161 3300035695 Bacteria 11889
429 Ga0373947_0001412 3300035725 Bacteria 14801
430 Ga0373947_0072768 3300035725 Unclassified 2111
431 Ga0373947_0098598 3300035725 Unclassified 1833
432 Ga0373947_0111599 3300035725 Bacteria 1728
433 Ga0373937_0032125 3300036401 Unclassified 4760
434 Ga0373937_0098872 3300036401 Unclassified 2707
435 Ga0373937_0394501 3300036401 Bacteria 1313
436 Ga0373925_0000103 3300037068 Bacteria 92575
437 Ga0373925_0002912 3300037068 Bacteria 13499
438 Ga0373925_0038795 3300037068 Unclassified 3523
439 Ga0436364_0020384 3300037853 Unclassified 3397
440 Ga0436364_0334239 3300037853 Bacteria 90865
441 Ga0436364_0903129 3300037853 Unclassified 3857
442 Ga0436365_1573905 3300039437 Unclassified 2084
443 Ga0436361_0089440 3300039447 Bacteria 1217
444 Ga0436361_1098452 3300039447 Bacteria 8208
445 Ga0436363_1486660 3300039450 Bacteria 8926
446 Ga0436362_0596821 3300039453 Bacteria 9267
447 Ga0466961_0071478 3300044693 Bacteria 2202
448 Ga0466961_0227731 3300044693 Bacteria 1148
449 Ga0466963_0012081 3300044694 Bacteria 5277
450 Ga0466963_0091807 3300044694 Unclassified 2069
451 Ga0453684_0202660 3300044712 Bacteria 2312
452 Ga0451576_0131700 3300045051 Bacteria 2607
453 Ga0451576_0185680 3300045051 Bacteria 2171
454 Ga0451576_0200622 3300045051 Bacteria 2084
455 Ga0466967_0004075 3300045976 Bacteria 9753
456 Ga0466967_0059643 3300045976 Bacteria 3379
457 Ga0466967_0187282 3300045976 Unclassified 1955
458 Ga0495629_0053351 3300046459 Unclassified 2829
459 Ga0495629_0064782 3300046459 Bacteria 2551
460 Ga0495651_0265279 3300046462 Bacteria 1167
461 Ga0495580_0062903 3300046472 Unclassified 2603
462 Ga0495580_0224514 3300046472 Unclassified 1290
463 Ga0495580_0257663 3300046472 Unclassified 1193
464 Ga0495582_0004662 3300046473 Bacteria 7711
465 Ga0495582_0061804 3300046473 Bacteria 2069
466 Ga0495664_0058845 3300046477 Unclassified 2287
467 Ga0495664_0255623 3300046477 Unclassified 1059
468 Ga0495630_0053887 3300046517 Unclassified 3013
469 Ga0495652_0249500 3300046529 Bacteria 1316
470 Ga0495665_0161181 3300046531 Unclassified 1169
471 Ga0495587_0099971 3300046536 Bacteria 1672
472 Ga0495667_0047233 3300046559 Unclassified 2845
473 Ga0495634_0114037 3300046642 Bacteria 1736
474 Ga0495657_0217418 3300046675 Unclassified 1160
475 Ga0495623_0261225 3300046679 Bacteria 970
476 Ga0495669_0017386 3300046684 Bacteria 3087
477 Ga0495669_0090167 3300046684 Unclassified 1415
478 Ga0495624_0033121 3300046690 Unclassified 3348
479 Ga0495674_0045075 3300047319 Unclassified 3917
480 Ga0495674_0141562 3300047319 Unclassified 2021
481 Ga0495676_0218186 3300047321 Bacteria 1316
482 Ga0495675_0104987 3300047444 Bacteria 1766
483 Ga0495684_0016913 3300047471 Bacteria 5619
484 Ga0495684_0418681 3300047471 Unclassified 937
485 Ga0496101_0217129 3300048904 Unclassified 1483
486 Ga0496102_0444796 3300048905 Unclassified 1216
487 Ga0496104_0128665 3300048907 Unclassified 2432
488 Ga0496104_0215642 3300048907 Bacteria 1831
489 Ga0496104_0300558 3300048907 Bacteria 1517
490 Ga0496104_0346138 3300048907 Bacteria 1399
491 Ga0496104_0388081 3300048907 Unclassified 1309
492 Ga0496105_0123954 3300048908 Bacteria 2130
493 Ga0496105_0290208 3300048908 Bacteria 1317
494 Ga0496106_0239391 3300048909 Unclassified 1450
495 Ga0496107_0389361 3300048910 Unclassified 1037
496 Ga0496110_0109429 3300048913 Bacteria 2482
497 Ga0496114_0085295 3300048917 Unclassified 2675
498 Ga0496114_0184147 3300048917 Unclassified 1825
499 Ga0496114_0253188 3300048917 Bacteria 1550
500 Ga0496115_0033436 3300048918 Unclassified 4060
501 Ga0496115_0241265 3300048918 Bacteria 1489
502 Ga0496115_0401303 3300048918 Bacteria 1112
503 Ga0496126_0081625 3300048929 Bacteria 2858
504 Ga0501037_0288966 3300049573 Bacteria 1141
505 Ga0501047_0345829 3300049581 Bacteria 1324
506 Ga0501044_0003939 3300049823 Bacteria 16637
507 Ga0501044_0100336 3300049823 Bacteria 2913
508 Ga0501044_0399755 3300049823 Unclassified 1287
509 Ga0495601_0077985 3300053077 Unclassified 2122
510 Ga0495619_0300820 3300053085 Unclassified 1111
511 Ga0587084_019654 3300059477 Unclassified 997
512 Ga0587066_030966 3300059490 Unclassified 953
513 Ga0587070_034064 3300059491 Unclassified 940
514 Ga0587073_0052568 3300059492 Bacteria 929
515 Ga0587077_032200 3300059493 Unclassified 1006
516 Ga0587082_028036 3300059504 Unclassified 964
517 Ga0587083_0036304 3300059505 Unclassified 1009
518 Ga0587085_024332 3300059506 Unclassified 948
519 Ga0587086_012254 3300059507 Unclassified 1063
520 Ga0587088_032262 3300059508 Unclassified 943
521 Ga0587089_015614 3300059509 Unclassified 1004
522 Ga0587090_020956 3300059510 Unclassified 1021
523 Ga0587091_036423 3300059511 Unclassified 950
524 Ga0587092_025815 3300059512 Bacteria 940
525 Ga0587094_021209 3300059513 Unclassified 945
526 Ga0587095_005233 3300059514 Unclassified 975
527 Ga0587101_015909 3300059623 Unclassified 1024
528 Ga0587109_036950 3300059624 Unclassified 953
529 Ga0587115_018632 3300059626 Unclassified 947
530 Ga0587117_015396 3300059627 Unclassified 1005
531 Ga0587128_019984 3300059630 Unclassified 1019
532 Ga0587067_035435 3300059640 Unclassified 944
533 Ga0587076_030918 3300059645 Unclassified 948
534 Ga0587078_014119 3300059646 Unclassified 953
535 Ga0587079_030614 3300059647 Unclassified 1032
536 Ga0587107_017840 3300059652 Unclassified 954
537 Ga0587119_010944 3300059658 Unclassified 1037
538 Ga0587071_039023 3300060344 Unclassified 945
539 Ga0587111_0043274 3300060346 Unclassified 968

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10437391 Ga0105248_104373911 224
2 3300025900 Ga0207710_10056068 Ga0207710_100560682 229
3 3300035691 Ga0373931_0215187 Ga0373931_0215187_341_1114 233
4 3300047471 Ga0495684_0016913 Ga0495684_0016913_109_882 233
5 3300009093 Ga0105240_10016990 Ga0105240_100169905 234
6 3300048907 Ga0496104_0300558 Ga0496104_0300558_184_957 234
7 3300048908 Ga0496105_0123954 Ga0496105_0123954_530_1303 234
8 3300035725 Ga0373947_0072768 Ga0373947_0072768_536_1357 250
9 3300009545 Ga0105237_10369560 Ga0105237_103695601 253
10 3300010375 Ga0105239_10251760 Ga0105239_102517602 253
11 3300005327 Ga0070658_10248661 Ga0070658_102486612 254
12 3300005329 Ga0070683_100231412 Ga0070683_1002314122 254
13 3300005338 Ga0068868_100000152 Ga0068868_10000015220 254
14 3300005548 Ga0070665_100358362 Ga0070665_1003583622 254
15 3300005564 Ga0070664_100089095 Ga0070664_1000890952 254
16 3300009093 Ga0105240_10000360 Ga0105240_1000036025 254
17 3300009093 Ga0105240_10008566 Ga0105240_1000856612 254
18 3300009098 Ga0105245_10000372 Ga0105245_1000037216 254
19 3300009101 Ga0105247_10001579 Ga0105247_1000157912 254
20 3300009174 Ga0105241_10000026 Ga0105241_1000002683 254
21 3300009174 Ga0105241_10000429 Ga0105241_1000042911 254
22 3300009174 Ga0105241_10130233 Ga0105241_101302332 254
23 3300009177 Ga0105248_10018823 Ga0105248_100188235 254
24 3300009545 Ga0105237_10001153 Ga0105237_100011534 254
25 3300009545 Ga0105237_10012752 Ga0105237_100127523 254
26 3300009545 Ga0105237_10250859 Ga0105237_102508592 254
27 3300009551 Ga0105238_10000137 Ga0105238_1000013742 254
28 3300009551 Ga0105238_10000218 Ga0105238_1000021828 254
29 3300009551 Ga0105238_10080962 Ga0105238_100809622 254
30 3300009553 Ga0105249_10120269 Ga0105249_101202692 254
31 3300010375 Ga0105239_10001628 Ga0105239_1000162815 254
32 3300010375 Ga0105239_10003331 Ga0105239_1000333115 254
33 3300011119 Ga0105246_10000487 Ga0105246_100004874 254
34 3300013100 Ga0157373_10035248 Ga0157373_100352482 254
35 3300013102 Ga0157371_10027364 Ga0157371_100273642 254
36 3300013105 Ga0157369_10001028 Ga0157369_1000102819 254
37 3300013105 Ga0157369_10030039 Ga0157369_100300393 254
38 3300013105 Ga0157369_10081547 Ga0157369_100815472 254
39 3300013296 Ga0157374_10000512 Ga0157374_100005126 254
40 3300013296 Ga0157374_10007314 Ga0157374_100073147 254
41 3300013296 Ga0157374_10197596 Ga0157374_101975961 254
42 3300013297 Ga0157378_10003221 Ga0157378_1000322111 254
43 3300013307 Ga0157372_10015810 Ga0157372_100158103 254
44 3300013307 Ga0157372_10033478 Ga0157372_100334783 254
45 3300013307 Ga0157372_10095186 Ga0157372_100951862 254
46 3300013308 Ga0157375_10001295 Ga0157375_100012954 254
47 3300014325 Ga0163163_10000826 Ga0163163_1000082612 254
48 3300014745 Ga0157377_10039283 Ga0157377_100392832 254
49 3300014968 Ga0157379_10000147 Ga0157379_100001476 254
50 3300014969 Ga0157376_10000447 Ga0157376_1000044712 254
51 3300025321 Ga0207656_10041312 Ga0207656_100413122 254
52 3300025909 Ga0207705_10181192 Ga0207705_101811922 254
53 3300025914 Ga0207671_10052764 Ga0207671_100527642 254
54 3300025920 Ga0207649_10060761 Ga0207649_100607611 254
55 3300026041 Ga0207639_10092285 Ga0207639_100922853 254
56 3300026078 Ga0207702_10142973 Ga0207702_101429732 254
57 3300031595 Ga0265313_10042380 Ga0265313_100423801 254
58 3300059477 Ga0587084_019654 Ga0587084_019654_85_918 254
59 3300059490 Ga0587066_030966 Ga0587066_030966_36_869 254
60 3300059492 Ga0587073_0052568 Ga0587073_0052568_12_845 254
61 3300059493 Ga0587077_032200 Ga0587077_032200_77_910 254
62 3300059504 Ga0587082_028036 Ga0587082_028036_85_918 254
63 3300059505 Ga0587083_0036304 Ga0587083_0036304_79_912 254
64 3300059506 Ga0587085_024332 Ga0587085_024332_79_912 254
65 3300059508 Ga0587088_032262 Ga0587088_032262_79_912 254
66 3300059510 Ga0587090_020956 Ga0587090_020956_110_943 254
67 3300059511 Ga0587091_036423 Ga0587091_036423_79_912 254
68 3300059623 Ga0587101_015909 Ga0587101_015909_85_918 254
69 3300059624 Ga0587109_036950 Ga0587109_036950_36_869 254
70 3300059626 Ga0587115_018632 Ga0587115_018632_79_912 254
71 3300059627 Ga0587117_015396 Ga0587117_015396_78_911 254
72 3300059630 Ga0587128_019984 Ga0587128_019984_79_912 254
73 3300059645 Ga0587076_030918 Ga0587076_030918_79_912 254
74 3300059646 Ga0587078_014119 Ga0587078_014119_36_869 254
75 3300059647 Ga0587079_030614 Ga0587079_030614_115_948 254
76 3300059652 Ga0587107_017840 Ga0587107_017840_85_918 254
77 3300059658 Ga0587119_010944 Ga0587119_010944_79_912 254
78 3300005436 Ga0070713_100048771 Ga0070713_1000487713 255
79 3300005437 Ga0070710_10011092 Ga0070710_100110923 255
80 3300006237 Ga0097621_100073459 Ga0097621_1000734594 255
81 3300006358 Ga0068871_100013157 Ga0068871_1000131574 255
82 3300009093 Ga0105240_10019362 Ga0105240_100193628 255
83 3300009177 Ga0105248_10492852 Ga0105248_104928522 255
84 3300009545 Ga0105237_10358887 Ga0105237_103588872 255
85 3300009551 Ga0105238_10009372 Ga0105238_100093722 255
86 3300009553 Ga0105249_10873964 Ga0105249_108739641 255
87 3300013297 Ga0157378_10116562 Ga0157378_101165622 255
88 3300013307 Ga0157372_10045824 Ga0157372_100458243 255
89 3300025898 Ga0207692_10036677 Ga0207692_100366773 255
90 3300025916 Ga0207663_10097796 Ga0207663_100977962 255
91 3300025939 Ga0207665_10030737 Ga0207665_100307373 255
92 3300031249 Ga0265339_10088598 Ga0265339_100885982 255
93 3300035113 Ga0373936_0048750 Ga0373936_0048750_852_1688 255
94 3300035172 Ga0373955_0142863 Ga0373955_0142863_226_1062 255
95 3300035691 Ga0373931_0198066 Ga0373931_0198066_26_862 255
96 3300035692 Ga0373935_0110941 Ga0373935_0110941_392_1228 255
97 3300037068 Ga0373925_0002912 Ga0373925_0002912_4681_5517 255
98 3300037068 Ga0373925_0038795 Ga0373925_0038795_1215_2051 255
99 3300039437 Ga0436365_1573905 Ga0436365_1573905_461_1297 255
100 3300039453 Ga0436362_0596821 Ga0436362_0596821_2819_3655 255
101 3300046462 Ga0495651_0265279 Ga0495651_0265279_124_960 255
102 3300046477 Ga0495664_0255623 Ga0495664_0255623_196_1032 255
103 3300046684 Ga0495669_0090167 Ga0495669_0090167_552_1388 255
104 3300047319 Ga0495674_0045075 Ga0495674_0045075_1561_2397 255
105 3300047471 Ga0495684_0418681 Ga0495684_0418681_27_863 255
106 3300048904 Ga0496101_0217129 Ga0496101_0217129_338_1174 255
107 3300048909 Ga0496106_0239391 Ga0496106_0239391_198_1034 255
108 3300048917 Ga0496114_0085295 Ga0496114_0085295_952_1788 255
109 3300048917 Ga0496114_0184147 Ga0496114_0184147_710_1546 255
110 3300048918 Ga0496115_0033436 Ga0496115_0033436_693_1529 255
111 3300053077 Ga0495601_0077985 Ga0495601_0077985_1047_1883 255
112 3300031711 Ga0265314_10215320 Ga0265314_102153201 256
113 3300013296 Ga0157374_10173514 Ga0157374_101735141 260
114 3300014969 Ga0157376_10167041 Ga0157376_101670412 260
115 3300047321 Ga0495676_0218186 Ga0495676_0218186_442_1293 260
116 3300048907 Ga0496104_0388081 Ga0496104_0388081_147_998 260
117 3300053085 Ga0495619_0300820 Ga0495619_0300820_29_880 260
118 3300035695 Ga0373927_0001395 Ga0373927_0001395_16310_17167 261
119 3300009093 Ga0105240_10000983 Ga0105240_1000098334 263
120 3300025929 Ga0207664_10103355 Ga0207664_101033552 263
121 3300037853 Ga0436364_0020384 Ga0436364_0020384_2294_3178 264
122 3300037853 Ga0436364_0903129 Ga0436364_0903129_52_936 264
123 3300044694 Ga0466963_0091807 Ga0466963_0091807_1123_2013 264
124 3300049573 Ga0501037_0288966 Ga0501037_0288966_130_1017 264
125 3300049581 Ga0501047_0345829 Ga0501047_0345829_149_1033 264
126 3300049823 Ga0501044_0003939 Ga0501044_0003939_2439_3323 264
127 3300049823 Ga0501044_0100336 Ga0501044_0100336_1914_2801 264
128 3300049823 Ga0501044_0399755 Ga0501044_0399755_215_1093 264
129 3300005327 Ga0070658_10013171 Ga0070658_100131712 265
130 3300005455 Ga0070663_100077401 Ga0070663_1000774012 265
131 3300005535 Ga0070684_100024793 Ga0070684_1000247931 265
132 3300005834 Ga0068851_10008990 Ga0068851_100089902 265
133 3300025321 Ga0207656_10014445 Ga0207656_100144452 265
134 3300025924 Ga0207694_10143225 Ga0207694_101432251 265
135 3300025981 Ga0207640_10160081 Ga0207640_101600812 265
136 3300026041 Ga0207639_10094845 Ga0207639_100948452 265
137 3300026116 Ga0207674_10447033 Ga0207674_104470331 265
138 3300037853 Ga0436364_0334239 Ga0436364_0334239_81987_82859 267
139 iso_pu_bacteria 2884215851 2884217092 267
140 3300005616 Ga0068852_100192719 Ga0068852_1001927191 268
141 3300005329 Ga0070683_100000006 Ga0070683_100000006165 269
142 3300009094 Ga0111539_10296306 Ga0111539_102963061 269
143 3300014968 Ga0157379_10186905 Ga0157379_101869052 269
144 3300031235 Ga0265330_10000375 Ga0265330_1000037514 269
145 3300031241 Ga0265325_10000051 Ga0265325_1000005128 269
146 3300031241 Ga0265325_10073152 Ga0265325_100731522 269
147 3300031247 Ga0265340_10033458 Ga0265340_100334583 269
148 3300031249 Ga0265339_10002079 Ga0265339_1000207912 269
149 3300031344 Ga0265316_10000539 Ga0265316_1000053925 269
150 3300031344 Ga0265316_10235439 Ga0265316_102354393 269
151 3300031595 Ga0265313_10002617 Ga0265313_100026178 269
152 3300031711 Ga0265314_10085513 Ga0265314_100855132 269
153 3300031712 Ga0265342_10000671 Ga0265342_1000067111 269
154 3300035410 Ga0373924_0180927 Ga0373924_0180927_16_897 269
155 3300044693 Ga0466961_0071478 Ga0466961_0071478_1128_2006 269
156 3300005329 Ga0070683_100485320 Ga0070683_1004853202 270
157 3300005436 Ga0070713_100016467 Ga0070713_1000164674 270
158 3300005458 Ga0070681_10008726 Ga0070681_100087267 270
159 3300005466 Ga0070685_10365560 Ga0070685_103655601 270
160 3300005530 Ga0070679_100195637 Ga0070679_1001956372 270
161 3300005535 Ga0070684_100009388 Ga0070684_1000093884 270
162 3300005536 Ga0070697_100266776 Ga0070697_1002667761 270
163 3300005548 Ga0070665_100042539 Ga0070665_1000425394 270
164 3300005834 Ga0068851_10020267 Ga0068851_100202674 270
165 3300005841 Ga0068863_100043253 Ga0068863_1000432533 270
166 3300005842 Ga0068858_100082987 Ga0068858_1000829873 270
167 3300005842 Ga0068858_100521534 Ga0068858_1005215341 270
168 3300005843 Ga0068860_100588020 Ga0068860_1005880202 270
169 3300005985 Ga0081539_10022163 Ga0081539_100221633 270
170 3300006028 Ga0070717_10047743 Ga0070717_100477434 270
171 3300009176 Ga0105242_10723228 Ga0105242_107232281 270
172 3300009177 Ga0105248_10366351 Ga0105248_103663511 270
173 3300009545 Ga0105237_10031781 Ga0105237_100317812 270
174 3300009545 Ga0105237_10059732 Ga0105237_100597324 270
175 3300009551 Ga0105238_10148750 Ga0105238_101487502 270
176 3300009553 Ga0105249_10037792 Ga0105249_100377923 270
177 3300013104 Ga0157370_10137395 Ga0157370_101373952 270
178 3300013105 Ga0157369_10019950 Ga0157369_100199502 270
179 3300013105 Ga0157369_10189082 Ga0157369_101890822 270
180 3300013306 Ga0163162_10823413 Ga0163162_108234131 270
181 3300013307 Ga0157372_10018728 Ga0157372_100187285 270
182 3300013308 Ga0157375_10017125 Ga0157375_100171254 270
183 3300014325 Ga0163163_10178122 Ga0163163_101781222 270
184 3300014325 Ga0163163_10196400 Ga0163163_101964002 270
185 3300020078 Ga0206352_10338750 Ga0206352_103387501 270
186 3300020078 Ga0206352_10822384 Ga0206352_108223841 270
187 3300022467 Ga0224712_10164438 Ga0224712_101644381 270
188 3300025321 Ga0207656_10054917 Ga0207656_100549172 270
189 3300025912 Ga0207707_10003922 Ga0207707_1000392212 270
190 3300025914 Ga0207671_10170636 Ga0207671_101706362 270
191 3300025914 Ga0207671_10248924 Ga0207671_102489242 270
192 3300025920 Ga0207649_10183162 Ga0207649_101831622 270
193 3300025924 Ga0207694_10124201 Ga0207694_101242012 270
194 3300025927 Ga0207687_10163393 Ga0207687_101633931 270
195 3300025944 Ga0207661_10434829 Ga0207661_104348292 270
196 3300025949 Ga0207667_10143946 Ga0207667_101439463 270
197 3300025961 Ga0207712_10150259 Ga0207712_101502592 270
198 3300026035 Ga0207703_10064635 Ga0207703_100646353 270
199 3300026088 Ga0207641_10152510 Ga0207641_101525102 270
200 3300026088 Ga0207641_10160389 Ga0207641_101603892 270
201 3300026088 Ga0207641_10279120 Ga0207641_102791202 270
202 3300028381 Ga0268264_10265703 Ga0268264_102657032 270
203 3300031344 Ga0265316_10079431 Ga0265316_100794312 270
204 3300031711 Ga0265314_10084913 Ga0265314_100849131 270
205 3300035083 Ga0373926_0012571 Ga0373926_0012571_903_1787 270
206 3300035116 Ga0373945_0012813 Ga0373945_0012813_1440_2324 270
207 3300035120 Ga0373957_0127025 Ga0373957_0127025_59_943 270
208 3300035172 Ga0373955_0097220 Ga0373955_0097220_398_1282 270
209 3300035692 Ga0373935_0010978 Ga0373935_0010978_1049_1933 270
210 3300035692 Ga0373935_0035599 Ga0373935_0035599_1252_2136 270
211 3300035695 Ga0373927_0003161 Ga0373927_0003161_3231_4115 270
212 3300035725 Ga0373947_0001412 Ga0373947_0001412_2076_2960 270
213 3300035725 Ga0373947_0111599 Ga0373947_0111599_799_1683 270
214 3300036401 Ga0373937_0032125 Ga0373937_0032125_3436_4320 270
215 3300036401 Ga0373937_0098872 Ga0373937_0098872_308_1192 270
216 3300036401 Ga0373937_0394501 Ga0373937_0394501_334_1218 270
217 3300037068 Ga0373925_0000103 Ga0373925_0000103_87549_88433 270
218 3300044693 Ga0466961_0227731 Ga0466961_0227731_37_918 270
219 3300044712 Ga0453684_0202660 Ga0453684_0202660_801_1697 270
220 3300045051 Ga0451576_0131700 Ga0451576_0131700_950_1846 270
221 3300045051 Ga0451576_0185680 Ga0451576_0185680_1061_1948 270
222 3300045051 Ga0451576_0200622 Ga0451576_0200622_73_957 270
223 3300046472 Ga0495580_0224514 Ga0495580_0224514_49_933 270
224 3300046472 Ga0495580_0257663 Ga0495580_0257663_284_1168 270
225 3300046473 Ga0495582_0061804 Ga0495582_0061804_1157_2041 270
226 3300046477 Ga0495664_0058845 Ga0495664_0058845_797_1681 270
227 3300046517 Ga0495630_0053887 Ga0495630_0053887_1156_2040 270
228 3300046559 Ga0495667_0047233 Ga0495667_0047233_1508_2392 270
229 3300046679 Ga0495623_0261225 Ga0495623_0261225_70_954 270
230 3300046690 Ga0495624_0033121 Ga0495624_0033121_1860_2744 270
231 3300047319 Ga0495674_0141562 Ga0495674_0141562_253_1137 270
232 3300047444 Ga0495675_0104987 Ga0495675_0104987_845_1729 270
233 3300005435 Ga0070714_100036624 Ga0070714_1000366243 271
234 3300005563 Ga0068855_100039278 Ga0068855_1000392782 271
235 3300005983 Ga0081540_1036279 Ga0081540_10362792 271
236 3300009551 Ga0105238_10047816 Ga0105238_100478162 271
237 3300013100 Ga0157373_10378437 Ga0157373_103784371 271
238 3300013105 Ga0157369_10002904 Ga0157369_100029042 271
239 3300013307 Ga0157372_10009618 Ga0157372_100096188 271
240 3300021361 Ga0213872_10005995 Ga0213872_100059953 271
241 3300021361 Ga0213872_10011855 Ga0213872_100118553 271
242 3300021361 Ga0213872_10027816 Ga0213872_100278162 271
243 3300025929 Ga0207664_10210827 Ga0207664_102108272 271
244 3300025949 Ga0207667_10018059 Ga0207667_100180594 271
245 3300026078 Ga0207702_10282767 Ga0207702_102827671 271
246 3300028381 Ga0268264_10344482 Ga0268264_103444822 271
247 3300028800 Ga0265338_10012853 Ga0265338_100128531 271
248 3300031235 Ga0265330_10002693 Ga0265330_100026931 271
249 3300031241 Ga0265325_10014063 Ga0265325_100140634 271
250 3300031595 Ga0265313_10065272 Ga0265313_100652722 271
251 3300031711 Ga0265314_10004981 Ga0265314_100049812 271
252 3300039447 Ga0436361_0089440 Ga0436361_0089440_237_1121 271
253 3300039447 Ga0436361_1098452 Ga0436361_1098452_2699_3583 271
254 3300005329 Ga0070683_100000090 Ga0070683_10000009017 272
255 3300005331 Ga0070670_100000411 Ga0070670_10000041117 272
256 3300005334 Ga0068869_100000036 Ga0068869_10000003616 272
257 3300005337 Ga0070682_100043629 Ga0070682_1000436293 272
258 3300005339 Ga0070660_100235790 Ga0070660_1002357901 272
259 3300005344 Ga0070661_100039486 Ga0070661_1000394862 272
260 3300005344 Ga0070661_100205721 Ga0070661_1002057212 272
261 3300005355 Ga0070671_100036061 Ga0070671_1000360612 272
262 3300005367 Ga0070667_100000709 Ga0070667_10000070912 272
263 3300005435 Ga0070714_100117216 Ga0070714_1001172162 272
264 3300005436 Ga0070713_100076649 Ga0070713_1000766492 272
265 3300005455 Ga0070663_100010906 Ga0070663_1000109065 272
266 3300005535 Ga0070684_100000889 Ga0070684_10000088918 272
267 3300005535 Ga0070684_100035098 Ga0070684_1000350982 272
268 3300005539 Ga0068853_100000203 Ga0068853_10000020312 272
269 3300005539 Ga0068853_100073407 Ga0068853_1000734071 272
270 3300005548 Ga0070665_100002484 Ga0070665_10000248411 272
271 3300005563 Ga0068855_100152839 Ga0068855_1001528392 272
272 3300005577 Ga0068857_100001869 Ga0068857_1000018692 272
273 3300005577 Ga0068857_100002976 Ga0068857_1000029762 272
274 3300005614 Ga0068856_100000187 Ga0068856_10000018716 272
275 3300005614 Ga0068856_100019986 Ga0068856_1000199862 272
276 3300005614 Ga0068856_100033425 Ga0068856_1000334252 272
277 3300005614 Ga0068856_100090377 Ga0068856_1000903772 272
278 3300005616 Ga0068852_100000082 Ga0068852_10000008229 272
279 3300005616 Ga0068852_100044163 Ga0068852_1000441632 272
280 3300005616 Ga0068852_100062164 Ga0068852_1000621643 272
281 3300005616 Ga0068852_100070598 Ga0068852_1000705981 272
282 3300005616 Ga0068852_100080148 Ga0068852_1000801482 272
283 3300005616 Ga0068852_100432265 Ga0068852_1004322652 272
284 3300005617 Ga0068859_100009321 Ga0068859_10000932111 272
285 3300005617 Ga0068859_100343015 Ga0068859_1003430152 272
286 3300005618 Ga0068864_100003925 Ga0068864_1000039254 272
287 3300005834 Ga0068851_10001200 Ga0068851_100012002 272
288 3300005841 Ga0068863_100000811 Ga0068863_10000081111 272
289 3300005842 Ga0068858_100000955 Ga0068858_10000095517 272
290 3300005843 Ga0068860_100000854 Ga0068860_1000008542 272
291 3300005844 Ga0068862_100061153 Ga0068862_1000611531 272
292 3300006028 Ga0070717_10023076 Ga0070717_100230761 272
293 3300006237 Ga0097621_100000450 Ga0097621_10000045010 272
294 3300006237 Ga0097621_100003099 Ga0097621_1000030992 272
295 3300006358 Ga0068871_100000380 Ga0068871_10000038016 272
296 3300006358 Ga0068871_100017473 Ga0068871_1000174732 272
297 3300006931 Ga0097620_100009321 Ga0097620_10000932111 272
298 3300006931 Ga0097620_100343013 Ga0097620_1003430132 272
299 3300009093 Ga0105240_10006147 Ga0105240_100061472 272
300 3300009098 Ga0105245_10002893 Ga0105245_1000289315 272
301 3300009101 Ga0105247_10264026 Ga0105247_102640261 272
302 3300009174 Ga0105241_10059926 Ga0105241_100599261 272
303 3300009177 Ga0105248_10034837 Ga0105248_100348374 272
304 3300009551 Ga0105238_10001537 Ga0105238_100015378 272
305 3300009551 Ga0105238_10016086 Ga0105238_100160864 272
306 3300010375 Ga0105239_10004953 Ga0105239_100049535 272
307 3300013296 Ga0157374_10007590 Ga0157374_100075905 272
308 3300013297 Ga0157378_10005121 Ga0157378_100051213 272
309 3300013306 Ga0163162_10115175 Ga0163162_101151751 272
310 3300013307 Ga0157372_10009471 Ga0157372_100094714 272
311 3300013307 Ga0157372_10054160 Ga0157372_100541602 272
312 3300025900 Ga0207710_10000251 Ga0207710_1000025116 272
313 3300025906 Ga0207699_10357006 Ga0207699_103570061 272
314 3300025911 Ga0207654_10000099 Ga0207654_1000009938 272
315 3300025911 Ga0207654_10000135 Ga0207654_1000013511 272
316 3300025911 Ga0207654_10052669 Ga0207654_100526692 272
317 3300025913 Ga0207695_10000080 Ga0207695_10000080145 272
318 3300025913 Ga0207695_10000113 Ga0207695_10000113108 272
319 3300025913 Ga0207695_10000561 Ga0207695_1000056123 272
320 3300025913 Ga0207695_10005420 Ga0207695_100054204 272
321 3300025913 Ga0207695_10028959 Ga0207695_100289592 272
322 3300025913 Ga0207695_10497044 Ga0207695_104970442 272
323 3300025914 Ga0207671_10000065 Ga0207671_1000006524 272
324 3300025914 Ga0207671_10000123 Ga0207671_1000012329 272
325 3300025920 Ga0207649_10087657 Ga0207649_100876572 272
326 3300025924 Ga0207694_10000112 Ga0207694_1000011236 272
327 3300025924 Ga0207694_10000215 Ga0207694_1000021521 272
328 3300025924 Ga0207694_10000940 Ga0207694_1000094011 272
329 3300025924 Ga0207694_10206964 Ga0207694_102069642 272
330 3300025925 Ga0207650_10003613 Ga0207650_1000361310 272
331 3300025927 Ga0207687_10009806 Ga0207687_100098064 272
332 3300025928 Ga0207700_10251516 Ga0207700_102515162 272
333 3300025931 Ga0207644_10003113 Ga0207644_100031136 272
334 3300025931 Ga0207644_10059855 Ga0207644_100598554 272
335 3300025941 Ga0207711_10001485 Ga0207711_100014854 272
336 3300025941 Ga0207711_10033102 Ga0207711_100331022 272
337 3300025942 Ga0207689_10001390 Ga0207689_100013907 272
338 3300025944 Ga0207661_10000357 Ga0207661_100003573 272
339 3300025944 Ga0207661_10199548 Ga0207661_101995481 272
340 3300025945 Ga0207679_10047692 Ga0207679_100476924 272
341 3300025949 Ga0207667_10015867 Ga0207667_100158672 272
342 3300025949 Ga0207667_10195382 Ga0207667_101953822 272
343 3300025981 Ga0207640_10009572 Ga0207640_100095723 272
344 3300025986 Ga0207658_10000546 Ga0207658_1000054610 272
345 3300026023 Ga0207677_10000114 Ga0207677_1000011423 272
346 3300026023 Ga0207677_10060729 Ga0207677_100607292 272
347 3300026035 Ga0207703_10001906 Ga0207703_1000190615 272
348 3300026041 Ga0207639_10000233 Ga0207639_1000023310 272
349 3300026041 Ga0207639_10115648 Ga0207639_101156482 272
350 3300026067 Ga0207678_10034906 Ga0207678_100349062 272
351 3300026078 Ga0207702_10000343 Ga0207702_1000034316 272
352 3300026078 Ga0207702_10000611 Ga0207702_1000061126 272
353 3300026078 Ga0207702_10001988 Ga0207702_100019884 272
354 3300026088 Ga0207641_10000319 Ga0207641_1000031923 272
355 3300026095 Ga0207676_10007628 Ga0207676_100076281 272
356 3300026116 Ga0207674_10000479 Ga0207674_1000047925 272
357 3300026116 Ga0207674_10001109 Ga0207674_1000110927 272
358 3300026116 Ga0207674_10077429 Ga0207674_100774293 272
359 3300026142 Ga0207698_10000066 Ga0207698_1000006629 272
360 3300026142 Ga0207698_10055735 Ga0207698_100557354 272
361 3300026142 Ga0207698_10123151 Ga0207698_101231512 272
362 3300026142 Ga0207698_10130113 Ga0207698_101301132 272
363 3300028379 Ga0268266_10017152 Ga0268266_100171521 272
364 3300028379 Ga0268266_10219847 Ga0268266_102198472 272
365 3300028380 Ga0268265_10175469 Ga0268265_101754691 272
366 3300028381 Ga0268264_10000718 Ga0268264_1000071820 272
367 3300031241 Ga0265325_10116547 Ga0265325_101165471 272
368 3300031344 Ga0265316_10027073 Ga0265316_100270736 272
369 3300031711 Ga0265314_10162542 Ga0265314_101625422 272
370 3300059491 Ga0587070_034064 Ga0587070_034064_22_909 272
371 3300059507 Ga0587086_012254 Ga0587086_012254_155_1042 272
372 3300059509 Ga0587089_015614 Ga0587089_015614_21_908 272
373 3300059512 Ga0587092_025815 Ga0587092_025815_22_909 272
374 3300059513 Ga0587094_021209 Ga0587094_021209_37_924 272
375 3300059514 Ga0587095_005233 Ga0587095_005233_21_908 272
376 3300059640 Ga0587067_035435 Ga0587067_035435_37_924 272
377 3300060344 Ga0587071_039023 Ga0587071_039023_37_924 272
378 3300060346 Ga0587111_0043274 Ga0587111_0043274_22_909 272
379 3300003320 rootH2_10068752 rootH2_100687527 273
380 3300005327 Ga0070658_10161377 Ga0070658_101613772 273
381 3300005328 Ga0070676_10095799 Ga0070676_100957992 273
382 3300005329 Ga0070683_100068633 Ga0070683_1000686332 273
383 3300005331 Ga0070670_100029502 Ga0070670_1000295023 273
384 3300005334 Ga0068869_100285365 Ga0068869_1002853651 273
385 3300005338 Ga0068868_100518788 Ga0068868_1005187881 273
386 3300005344 Ga0070661_100055122 Ga0070661_1000551222 273
387 3300005347 Ga0070668_100077867 Ga0070668_1000778672 273
388 3300005434 Ga0070709_10000498 Ga0070709_1000049822 273
389 3300005435 Ga0070714_100303590 Ga0070714_1003035902 273
390 3300005436 Ga0070713_100000322 Ga0070713_10000032218 273
391 3300005436 Ga0070713_100211257 Ga0070713_1002112572 273
392 3300005437 Ga0070710_10079315 Ga0070710_100793152 273
393 3300005439 Ga0070711_100065877 Ga0070711_1000658772 273
394 3300005439 Ga0070711_100147501 Ga0070711_1001475011 273
395 3300005456 Ga0070678_100198742 Ga0070678_1001987421 273
396 3300005457 Ga0070662_100095633 Ga0070662_1000956332 273
397 3300005458 Ga0070681_10006466 Ga0070681_100064663 273
398 3300005535 Ga0070684_100064002 Ga0070684_1000640024 273
399 3300005535 Ga0070684_100513117 Ga0070684_1005131171 273
400 3300005539 Ga0068853_100061472 Ga0068853_1000614722 273
401 3300005543 Ga0070672_100063539 Ga0070672_1000635392 273
402 3300005548 Ga0070665_100037955 Ga0070665_1000379552 273
403 3300005548 Ga0070665_100131364 Ga0070665_1001313644 273
404 3300005563 Ga0068855_100002968 Ga0068855_1000029682 273
405 3300005563 Ga0068855_100013422 Ga0068855_1000134227 273
406 3300005614 Ga0068856_100059384 Ga0068856_1000593843 273
407 3300005614 Ga0068856_100108662 Ga0068856_1001086622 273
408 3300005614 Ga0068856_100186551 Ga0068856_1001865512 273
409 3300005616 Ga0068852_100000008 Ga0068852_100000008105 273
410 3300005841 Ga0068863_100082041 Ga0068863_1000820412 273
411 3300005842 Ga0068858_100379438 Ga0068858_1003794382 273
412 3300005983 Ga0081540_1058906 Ga0081540_10589062 273
413 3300006028 Ga0070717_10001169 Ga0070717_100011695 273
414 3300006163 Ga0070715_10025728 Ga0070715_100257282 273
415 3300006173 Ga0070716_100007168 Ga0070716_1000071682 273
416 3300006173 Ga0070716_100023022 Ga0070716_1000230223 273
417 3300006173 Ga0070716_100074688 Ga0070716_1000746882 273
418 3300006175 Ga0070712_100000456 Ga0070712_10000045620 273
419 3300006175 Ga0070712_100056055 Ga0070712_1000560553 273
420 3300006175 Ga0070712_100064368 Ga0070712_1000643682 273
421 3300006175 Ga0070712_100225162 Ga0070712_1002251622 273
422 3300006237 Ga0097621_100018742 Ga0097621_1000187422 273
423 3300006358 Ga0068871_100032506 Ga0068871_1000325062 273
424 3300006358 Ga0068871_100206843 Ga0068871_1002068432 273
425 3300006881 Ga0068865_100015780 Ga0068865_1000157801 273
426 3300009093 Ga0105240_10000038 Ga0105240_1000003830 273
427 3300009093 Ga0105240_10693748 Ga0105240_106937481 273
428 3300009098 Ga0105245_10179958 Ga0105245_101799581 273
429 3300009174 Ga0105241_10000588 Ga0105241_1000058817 273
430 3300009174 Ga0105241_10010226 Ga0105241_100102263 273
431 3300009176 Ga0105242_10376502 Ga0105242_103765021 273
432 3300009177 Ga0105248_10000004 Ga0105248_1000000411 273
433 3300009177 Ga0105248_10609952 Ga0105248_106099521 273
434 3300009177 Ga0105248_10661262 Ga0105248_106612621 273
435 3300009545 Ga0105237_10025910 Ga0105237_100259103 273
436 3300009545 Ga0105237_10032425 Ga0105237_100324255 273
437 3300009545 Ga0105237_10051003 Ga0105237_100510032 273
438 3300009551 Ga0105238_10033638 Ga0105238_100336383 273
439 3300010375 Ga0105239_10494148 Ga0105239_104941481 273
440 3300013100 Ga0157373_10070506 Ga0157373_100705063 273
441 3300013104 Ga0157370_10000130 Ga0157370_1000013046 273
442 3300013104 Ga0157370_10446995 Ga0157370_104469951 273
443 3300013105 Ga0157369_10000058 Ga0157369_10000058107 273
444 3300013105 Ga0157369_10008970 Ga0157369_100089703 273
445 3300013105 Ga0157369_10056574 Ga0157369_100565742 273
446 3300013105 Ga0157369_10090084 Ga0157369_100900843 273
447 3300013296 Ga0157374_10005667 Ga0157374_100056679 273
448 3300013296 Ga0157374_10005714 Ga0157374_1000571412 273
449 3300013296 Ga0157374_10014675 Ga0157374_100146753 273
450 3300013296 Ga0157374_10017211 Ga0157374_100172116 273
451 3300013306 Ga0163162_10001417 Ga0163162_1000141712 273
452 3300013306 Ga0163162_10032285 Ga0163162_100322856 273
453 3300013307 Ga0157372_10000163 Ga0157372_1000016325 273
454 3300013307 Ga0157372_10050697 Ga0157372_100506974 273
455 3300013307 Ga0157372_10106139 Ga0157372_101061391 273
456 3300014325 Ga0163163_10048927 Ga0163163_100489276 273
457 3300014325 Ga0163163_10069858 Ga0163163_100698583 273
458 3300021358 Ga0213873_10041264 Ga0213873_100412641 273
459 3300021384 Ga0213876_10046343 Ga0213876_100463431 273
460 3300025321 Ga0207656_10024981 Ga0207656_100249812 273
461 3300025898 Ga0207692_10031833 Ga0207692_100318332 273
462 3300025905 Ga0207685_10041010 Ga0207685_100410102 273
463 3300025906 Ga0207699_10002436 Ga0207699_100024362 273
464 3300025909 Ga0207705_10185675 Ga0207705_101856752 273
465 3300025911 Ga0207654_10000017 Ga0207654_10000017149 273
466 3300025912 Ga0207707_10070977 Ga0207707_100709773 273
467 3300025913 Ga0207695_10000070 Ga0207695_1000007033 273
468 3300025913 Ga0207695_10020454 Ga0207695_100204542 273
469 3300025913 Ga0207695_10165623 Ga0207695_101656232 273
470 3300025914 Ga0207671_10101167 Ga0207671_101011672 273
471 3300025915 Ga0207693_10000055 Ga0207693_1000005545 273
472 3300025915 Ga0207693_10032288 Ga0207693_100322882 273
473 3300025915 Ga0207693_10220696 Ga0207693_102206961 273
474 3300025916 Ga0207663_10282251 Ga0207663_102822511 273
475 3300025920 Ga0207649_10023678 Ga0207649_100236783 273
476 3300025924 Ga0207694_10028751 Ga0207694_100287513 273
477 3300025924 Ga0207694_10056904 Ga0207694_100569043 273
478 3300025926 Ga0207659_10149008 Ga0207659_101490082 273
479 3300025928 Ga0207700_10000206 Ga0207700_1000020616 273
480 3300025928 Ga0207700_10087796 Ga0207700_100877962 273
481 3300025929 Ga0207664_10314785 Ga0207664_103147851 273
482 3300025933 Ga0207706_10010126 Ga0207706_100101261 273
483 3300025939 Ga0207665_10032962 Ga0207665_100329624 273
484 3300025939 Ga0207665_10048659 Ga0207665_100486592 273
485 3300025940 Ga0207691_10079783 Ga0207691_100797832 273
486 3300025941 Ga0207711_10000008 Ga0207711_10000008104 273
487 3300025941 Ga0207711_10000010 Ga0207711_10000010373 273
488 3300025941 Ga0207711_10144138 Ga0207711_101441383 273
489 3300025941 Ga0207711_10428298 Ga0207711_104282981 273
490 3300025942 Ga0207689_10376561 Ga0207689_103765612 273
491 3300025949 Ga0207667_10003542 Ga0207667_100035422 273
492 3300025949 Ga0207667_10056227 Ga0207667_100562272 273
493 3300025949 Ga0207667_10217909 Ga0207667_102179092 273
494 3300025972 Ga0207668_10032491 Ga0207668_100324912 273
495 3300025981 Ga0207640_10034352 Ga0207640_100343522 273
496 3300026035 Ga0207703_10616529 Ga0207703_106165291 273
497 3300026041 Ga0207639_10482253 Ga0207639_104822531 273
498 3300026067 Ga0207678_10136564 Ga0207678_101365642 273
499 3300026078 Ga0207702_10036564 Ga0207702_100365642 273
500 3300026088 Ga0207641_10003282 Ga0207641_100032825 273
501 3300026088 Ga0207641_10062036 Ga0207641_100620362 273
502 3300026121 Ga0207683_10001725 Ga0207683_100017252 273
503 3300026142 Ga0207698_10000010 Ga0207698_1000001031 273
504 3300026142 Ga0207698_10158989 Ga0207698_101589893 273
505 3300028379 Ga0268266_10042517 Ga0268266_100425173 273
506 3300028379 Ga0268266_10093654 Ga0268266_100936541 273
507 3300028381 Ga0268264_10621022 Ga0268264_106210221 273
508 3300028800 Ga0265338_10176969 Ga0265338_101769691 273
509 3300031090 Ga0265760_10048201 Ga0265760_100482012 273
510 3300031241 Ga0265325_10126955 Ga0265325_101269551 273
511 3300035086 Ga0373934_0094328 Ga0373934_0094328_245_1135 273
512 3300035172 Ga0373955_0247663 Ga0373955_0247663_25_915 273
513 3300035692 Ga0373935_0296122 Ga0373935_0296122_208_1098 273
514 3300035725 Ga0373947_0098598 Ga0373947_0098598_733_1623 273
515 3300039450 Ga0436363_1486660 Ga0436363_1486660_2176_3066 273
516 3300044694 Ga0466963_0012081 Ga0466963_0012081_712_1602 273
517 3300045976 Ga0466967_0004075 Ga0466967_0004075_907_1797 273
518 3300045976 Ga0466967_0059643 Ga0466967_0059643_542_1432 273
519 3300045976 Ga0466967_0187282 Ga0466967_0187282_1042_1932 273
520 3300046459 Ga0495629_0053351 Ga0495629_0053351_1377_2267 273
521 3300046459 Ga0495629_0064782 Ga0495629_0064782_1137_2027 273
522 3300046472 Ga0495580_0062903 Ga0495580_0062903_573_1463 273
523 3300046473 Ga0495582_0004662 Ga0495582_0004662_4769_5659 273
524 3300046529 Ga0495652_0249500 Ga0495652_0249500_386_1276 273
525 3300046531 Ga0495665_0161181 Ga0495665_0161181_127_1017 273
526 3300046536 Ga0495587_0099971 Ga0495587_0099971_405_1295 273
527 3300046642 Ga0495634_0114037 Ga0495634_0114037_273_1163 273
528 3300046675 Ga0495657_0217418 Ga0495657_0217418_159_1049 273
529 3300046684 Ga0495669_0017386 Ga0495669_0017386_1900_2790 273
530 3300048905 Ga0496102_0444796 Ga0496102_0444796_85_1002 273
531 3300048907 Ga0496104_0128665 Ga0496104_0128665_150_1046 273
532 3300048907 Ga0496104_0215642 Ga0496104_0215642_867_1757 273
533 3300048907 Ga0496104_0346138 Ga0496104_0346138_205_1095 273
534 3300048908 Ga0496105_0290208 Ga0496105_0290208_334_1230 273
535 3300048910 Ga0496107_0389361 Ga0496107_0389361_115_1011 273
536 3300048913 Ga0496110_0109429 Ga0496110_0109429_765_1655 273
537 3300048917 Ga0496114_0253188 Ga0496114_0253188_258_1148 273
538 3300048918 Ga0496115_0241265 Ga0496115_0241265_284_1180 273
539 3300048918 Ga0496115_0401303 Ga0496115_0401303_52_942 273
540 3300048929 Ga0496126_0081625 Ga0496126_0081625_1203_2093 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

79

288

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ezl-assembly1.cif.gz_A rice l-galactose dehydrogenase (holo form) 0.7311 35 268
8k1i-assembly1.cif.gz_D crystal structure of arabinose dehydrogenase from candida auris 0.7221 71 272
4exa-assembly1.cif.gz_B crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.7149 33 273
8k1i-assembly1.cif.gz_C crystal structure of arabinose dehydrogenase from candida auris 0.711 71 272
4exa-assembly2.cif.gz_C crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.7086 32 273
ID Description Score Start End Superfamily
af_A0A1D6KXU0_49_191_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7643 37 124 3.20.20.100
af_Q9VGF2_1_211_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7461 36 175 3.20.20.100
af_A0A0R0KVN6_7_249_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7153 36 175 3.20.20.100
af_Q20127_83_403_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7096 36 271 3.20.20.100
af_Q2QQV2_1_312_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7026 37 267 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2V9FH82-F1-model_v4 Oxidoreductase 0.9395 83 273
AF-A0A2V9FH82-F1-model_v4 Oxidoreductase 0.9346 83 273
AF-A0A0S8E7Z4-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9165 118 272
AF-A0A2V9QM81-F1-model_v4 Oxidoreductase 0.9137 31 273
AF-A0A836QK15-F1-model_v4 Aldo/keto reductase 0.9029 99 273

Feature Viewer

pLDDT pTM Quality
82.27 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map