F461510
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 542 | 413 | 1084 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0008512|Ga0395899_0008512_6123_6875 |
| Length | 250 |
| Sequence | MNYNFDWNVVANAFPAMMQGLGITVQITLITIAISMVLAVPVAVGRMSKIEVIRWAAQGYIEIFRCTPLLVQLFWIFYALPALTGVTLPGEVSAVIALTANLTAFMAEAYRSGFQSVPVEQVEAGRMLQLNRFQQLRYIIVPQALRQQLPVILSLNISLFKDTALVSTIAVADLMFISNTISSQTYRSLEVFTLAAFVYFAIAFPVSLATSALERRMQNSSGLGAPPPKKLVARMMPGSRTADPRTAVPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 16 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 28 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 29 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 30 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 31 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 32 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 33 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 34 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 35 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 43 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 49 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 50 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 51 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 56 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 79 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 81 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 82 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 83 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 84 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 85 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 86 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 87 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 88 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 89 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 90 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 91 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 92 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 93 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 94 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 95 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 96 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 97 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 98 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 99 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 100 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 101 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 102 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 103 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 104 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 105 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 106 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 107 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 108 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 109 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 110 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 111 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 112 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 113 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 114 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 115 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 116 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 117 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 118 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 119 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 181 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 182 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 183 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 187 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 188 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 189 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 190 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 191 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 192 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 193 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 194 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 195 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 196 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 208 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 209 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 210 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 211 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 212 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 213 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 214 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 215 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 216 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 217 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 218 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 219 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 220 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 221 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 222 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 223 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 224 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 225 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 226 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 227 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 228 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 229 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 230 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 231 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 232 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 233 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 234 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 235 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 236 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 237 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 238 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 239 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 240 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 241 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 242 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 243 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 244 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 245 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 246 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 247 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 248 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 249 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 250 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 251 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 252 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 253 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 254 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 255 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 256 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 257 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 258 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 259 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 260 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 261 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 262 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 263 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 264 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 265 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 266 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 267 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 268 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 269 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 270 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 271 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 272 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 273 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 274 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 275 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 276 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 277 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 278 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 279 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 280 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 281 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 282 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 283 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 284 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 285 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 286 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 287 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 288 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 289 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 290 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 291 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 292 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 293 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 294 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 295 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 296 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 297 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 298 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 299 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 300 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 301 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 302 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 303 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 304 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 305 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 306 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 307 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 308 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 309 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 310 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 311 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 312 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 313 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 314 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 315 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 316 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 317 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 318 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 319 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 320 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 321 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 322 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 323 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 324 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 325 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 326 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 327 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 328 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 329 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 330 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 331 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 332 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 333 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 334 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 335 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 336 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 337 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 338 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 339 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 340 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 341 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 342 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 343 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 344 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 345 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 346 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 347 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 348 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 349 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 350 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 351 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 352 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 353 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 354 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 355 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 356 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 357 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 358 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 359 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 360 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 361 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 362 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 363 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 364 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 365 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 366 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 367 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 368 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 369 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 370 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 371 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 372 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 373 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 374 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 375 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 376 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 377 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 378 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 379 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 380 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 381 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 382 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 383 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 384 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 385 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 386 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 387 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 388 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 389 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 390 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 391 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 392 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 393 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 394 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 395 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 396 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 397 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 398 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 399 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 400 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 401 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 402 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 403 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 404 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 405 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 406 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 407 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 408 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 409 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 410 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 411 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 412 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 413 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 61.44 |
| Metatranscriptomes | 0 |
| Isolates | 38.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.18 |
| Nodule | 29.7 |
| Rhizoplane | 1.11 |
| Rhizosphere | 43.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395899_0008512 | 3300037312 | Bacteria | 7901 |
| 2 | MRS2a_Contig_2265 | 2124908027 | Bacteria | 2288 |
| 3 | JGI25159J45721_1000080 | 3300002987 | Bacteria | 46567 |
| 4 | JGI25151J46595_10003218 | 3300003187 | Bacteria | 9135 |
| 5 | JGI25153J46596_10004438 | 3300003215 | Bacteria | 7569 |
| 6 | rootH2_10214548 | 3300003320 | Bacteria | 1581 |
| 7 | JGI25160J50197_1000160 | 3300003354 | Bacteria | 57733 |
| 8 | JGI25160J50197_1001380 | 3300003354 | Bacteria | 12223 |
| 9 | JGI25161J50226_1000644 | 3300003374 | Bacteria | 14074 |
| 10 | JGI25161J50226_1007165 | 3300003374 | Bacteria | 1908 |
| 11 | Ga0055526_1000913 | 3300003771 | Bacteria | 21962 |
| 12 | Ga0055526_1001250 | 3300003771 | Bacteria | 18238 |
| 13 | Ga0055526_1001730 | 3300003771 | Bacteria | 15178 |
| 14 | Ga0055524_1001595 | 3300003775 | Bacteria | 12719 |
| 15 | Ga0055524_1034056 | 3300003775 | Bacteria | 1415 |
| 16 | Ga0055536_1010628 | 3300003781 | Bacteria | 3626 |
| 17 | Ga0055528_1000496 | 3300003790 | Bacteria | 31066 |
| 18 | Ga0055528_1008574 | 3300003790 | Bacteria | 4356 |
| 19 | Ga0055540_1000077 | 3300003792 | Bacteria | 114283 |
| 20 | Ga0055540_1000095 | 3300003792 | Bacteria | 97555 |
| 21 | Ga0055540_1008583 | 3300003792 | Bacteria | 3664 |
| 22 | Ga0055531_10003881 | 3300003794 | Bacteria | 9356 |
| 23 | Ga0058692_1000056 | 3300003856 | Bacteria | 105284 |
| 24 | Ga0055543_1000410 | 3300004625 | Bacteria | 27002 |
| 25 | Ga0055543_1000625 | 3300004625 | Bacteria | 19011 |
| 26 | Ga0065165_1000534 | 3300005262 | Bacteria | 57771 |
| 27 | Ga0065165_1011591 | 3300005262 | Bacteria | 3655 |
| 28 | Ga0065714_10002449 | 3300005288 | Bacteria | 17872 |
| 29 | Ga0065714_10002712 | 3300005288 | Bacteria | 12352 |
| 30 | Ga0070658_10049106 | 3300005327 | Bacteria | 3418 |
| 31 | Ga0070683_100217589 | 3300005329 | Bacteria | 1815 |
| 32 | Ga0070660_100000020 | 3300005339 | Bacteria | 98286 |
| 33 | Ga0070659_100000047 | 3300005366 | Bacteria | 98286 |
| 34 | Ga0070659_100271906 | 3300005366 | Bacteria | 1408 |
| 35 | Ga0070685_10345784 | 3300005466 | Bacteria | 1015 |
| 36 | Ga0068856_100369980 | 3300005614 | Bacteria | 1452 |
| 37 | Ga0068858_100275034 | 3300005842 | Bacteria | 1603 |
| 38 | Ga0081455_10145112 | 3300005937 | Bacteria | 1837 |
| 39 | Ga0081538_10004588 | 3300005981 | Bacteria | 12706 |
| 40 | Ga0075365_10026094 | 3300006038 | Bacteria | 3705 |
| 41 | Ga0075363_100089546 | 3300006048 | Bacteria | 1692 |
| 42 | Ga0075432_10000599 | 3300006058 | Bacteria | 10906 |
| 43 | Ga0075362_10120493 | 3300006177 | Bacteria | 1241 |
| 44 | Ga0075369_10034998 | 3300006186 | Bacteria | 2133 |
| 45 | Ga0075366_10013907 | 3300006195 | Bacteria | 4587 |
| 46 | Ga0079104_1001104 | 3300006946 | Bacteria | 19946 |
| 47 | Ga0105251_10000038 | 3300009011 | Bacteria | 116060 |
| 48 | Ga0105251_10010946 | 3300009011 | Bacteria | 5218 |
| 49 | Ga0105244_10002923 | 3300009036 | Bacteria | 12611 |
| 50 | Ga0105244_10053974 | 3300009036 | Bacteria | 2040 |
| 51 | Ga0105250_10004934 | 3300009092 | Bacteria | 6049 |
| 52 | Ga0105247_10662791 | 3300009101 | Bacteria | 781 |
| 53 | Ga0105243_10068349 | 3300009148 | Bacteria | 2863 |
| 54 | Ga0105242_10178827 | 3300009176 | Bacteria | 1870 |
| 55 | Ga0105238_10009567 | 3300009551 | Bacteria | 9694 |
| 56 | Ga0123341_1000082 | 3300009765 | Bacteria | 40371 |
| 57 | Ga0105239_10005879 | 3300010375 | Bacteria | 14296 |
| 58 | Ga0105239_10128292 | 3300010375 | Bacteria | 2820 |
| 59 | Ga0157373_10211748 | 3300013100 | Bacteria | 1367 |
| 60 | Ga0157370_10022288 | 3300013104 | Bacteria | 6304 |
| 61 | Ga0157369_10138693 | 3300013105 | Bacteria | 2574 |
| 62 | Ga0157372_11394652 | 3300013307 | Bacteria | 808 |
| 63 | Ga0182008_10000970 | 3300014497 | Bacteria | 19917 |
| 64 | Ga0182006_1002548 | 3300015261 | Bacteria | 9886 |
| 65 | Ga0182007_10000152 | 3300015262 | Bacteria | 46887 |
| 66 | Ga0182005_1000181 | 3300015265 | Bacteria | 43402 |
| 67 | Ga0209436_100101 | 3300025208 | Bacteria | 42360 |
| 68 | Ga0207425_1002551 | 3300025245 | Bacteria | 6340 |
| 69 | Ga0209148_1000331 | 3300025254 | Bacteria | 64881 |
| 70 | Ga0209759_1020394 | 3300025256 | Bacteria | 1539 |
| 71 | Ga0209129_1000917 | 3300025258 | Bacteria | 18018 |
| 72 | Ga0209129_1024250 | 3300025258 | Bacteria | 1070 |
| 73 | Ga0209455_1000371 | 3300025272 | Bacteria | 41412 |
| 74 | Ga0209673_1000294 | 3300025273 | Bacteria | 93050 |
| 75 | Ga0209673_1000968 | 3300025273 | Bacteria | 35620 |
| 76 | Ga0209130_1000309 | 3300025284 | Bacteria | 57785 |
| 77 | Ga0209130_1023894 | 3300025284 | Bacteria | 1341 |
| 78 | Ga0209676_1002316 | 3300025292 | Bacteria | 13827 |
| 79 | Ga0209025_1000260 | 3300025294 | Bacteria | 124240 |
| 80 | Ga0209025_1001911 | 3300025294 | Bacteria | 24216 |
| 81 | Ga0209025_1022425 | 3300025294 | Bacteria | 3349 |
| 82 | Ga0209564_1000341 | 3300025295 | Bacteria | 89262 |
| 83 | Ga0209564_1001129 | 3300025295 | Bacteria | 31419 |
| 84 | Ga0209758_1001982 | 3300025297 | Bacteria | 22133 |
| 85 | Ga0209758_1003817 | 3300025297 | Bacteria | 13248 |
| 86 | Ga0209050_1010756 | 3300025298 | Bacteria | 4459 |
| 87 | Ga0209050_1011672 | 3300025298 | Bacteria | 4133 |
| 88 | Ga0209256_1000719 | 3300025299 | Bacteria | 43868 |
| 89 | Ga0209256_1003376 | 3300025299 | Bacteria | 11297 |
| 90 | Ga0207426_1000503 | 3300025302 | Bacteria | 57785 |
| 91 | Ga0207426_1001199 | 3300025302 | Bacteria | 23041 |
| 92 | Ga0209051_1000027 | 3300025303 | Bacteria | 412172 |
| 93 | Ga0209051_1003762 | 3300025303 | Bacteria | 9734 |
| 94 | Ga0209051_1041767 | 3300025303 | Bacteria | 1628 |
| 95 | Ga0209257_1000599 | 3300025304 | Bacteria | 59865 |
| 96 | Ga0209257_1002580 | 3300025304 | Bacteria | 17618 |
| 97 | Ga0207696_1000018 | 3300025711 | Bacteria | 478605 |
| 98 | Ga0207655_1001322 | 3300025728 | Bacteria | 23408 |
| 99 | Ga0207655_1011199 | 3300025728 | Bacteria | 5360 |
| 100 | Ga0207713_1000185 | 3300025735 | Bacteria | 88697 |
| 101 | Ga0207713_1002035 | 3300025735 | Bacteria | 15137 |
| 102 | Ga0207688_10056684 | 3300025901 | Bacteria | 2202 |
| 103 | Ga0207705_10036303 | 3300025909 | Bacteria | 3527 |
| 104 | Ga0207657_10000390 | 3300025919 | Bacteria | 46278 |
| 105 | Ga0207649_10384538 | 3300025920 | Bacteria | 1047 |
| 106 | Ga0207690_10000037 | 3300025932 | Bacteria | 142658 |
| 107 | Ga0207690_10225952 | 3300025932 | Bacteria | 1435 |
| 108 | Ga0207702_10317460 | 3300026078 | Bacteria | 1483 |
| 109 | Ga0209281_1000778 | 3300027111 | Bacteria | 30318 |
| 110 | Ga0209371_1000121 | 3300027312 | Bacteria | 132565 |
| 111 | Ga0207428_10002525 | 3300027907 | Bacteria | 18264 |
| 112 | Ga0268256_1000107 | 3300030500 | Bacteria | 121028 |
| 113 | Ga0307408_100355446 | 3300031548 | Bacteria | 1244 |
| 114 | Ga0307405_10029046 | 3300031731 | Bacteria | 3228 |
| 115 | Ga0307405_10141687 | 3300031731 | Bacteria | 1677 |
| 116 | Ga0307413_10027454 | 3300031824 | Bacteria | 3155 |
| 117 | Ga0307413_10055294 | 3300031824 | Bacteria | 2414 |
| 118 | Ga0307410_10145813 | 3300031852 | Bacteria | 1756 |
| 119 | Ga0307410_10411796 | 3300031852 | Bacteria | 1094 |
| 120 | Ga0307406_10016078 | 3300031901 | Bacteria | 4341 |
| 121 | Ga0307406_10093425 | 3300031901 | Bacteria | 2031 |
| 122 | Ga0307406_10425518 | 3300031901 | Bacteria | 1059 |
| 123 | Ga0307407_10020138 | 3300031903 | Bacteria | 3411 |
| 124 | Ga0307409_100113298 | 3300031995 | Bacteria | 2279 |
| 125 | Ga0307409_100382540 | 3300031995 | Bacteria | 1338 |
| 126 | Ga0307416_100007287 | 3300032002 | Bacteria | 7014 |
| 127 | Ga0307415_100129578 | 3300032126 | Bacteria | 1907 |
| 128 | Ga0373937_0197626 | 3300036401 | Bacteria | 1890 |
| 129 | Ga0373925_0052189 | 3300037068 | Bacteria | 3055 |
| 130 | Ga0395899_0002826 | 3300037312 | Bacteria | 13986 |
| 131 | Ga0395900_0008030 | 3300037418 | Bacteria | 10861 |
| 132 | Ga0395900_0109630 | 3300037418 | Bacteria | 2836 |
| 133 | Ga0395898_0003468 | 3300037466 | Bacteria | 17615 |
| 134 | Ga0395898_0010331 | 3300037466 | Bacteria | 9766 |
| 135 | Ga0395898_0147701 | 3300037466 | Bacteria | 2250 |
| 136 | Ga0395905_0000024 | 3300037471 | Bacteria | 318806 |
| 137 | Ga0395905_0001801 | 3300037471 | Bacteria | 24828 |
| 138 | Ga0395905_0080861 | 3300037471 | Bacteria | 3046 |
| 139 | Ga0395901_0000434 | 3300038443 | Bacteria | 48945 |
| 140 | Ga0395901_0027622 | 3300038443 | Bacteria | 5832 |
| 141 | Ga0395901_0096386 | 3300038443 | Bacteria | 3100 |
| 142 | Ga0395901_0199731 | 3300038443 | Bacteria | 2096 |
| 143 | Ga0400483_044762 | 3300039062 | Bacteria | 1104 |
| 144 | Ga0400483_188268 | 3300039062 | Bacteria | 1882 |
| 145 | Ga0439438_001222 | 3300041405 | Bacteria | 11398 |
| 146 | Ga0439447_009478 | 3300041407 | Bacteria | 2947 |
| 147 | Ga0439466_0008929 | 3300041411 | Bacteria | 3768 |
| 148 | Ga0439466_0016051 | 3300041411 | Bacteria | 2711 |
| 149 | Ga0439465_0009838 | 3300041413 | Bacteria | 3012 |
| 150 | Ga0451835_0189026 | 3300041492 | Bacteria | 1202 |
| 151 | Ga0451835_0889751 | 3300041492 | Bacteria | 2335 |
| 152 | Ga0451837_1430986 | 3300041494 | Bacteria | 2695 |
| 153 | Ga0451839_1280463 | 3300041496 | Bacteria | 725 |
| 154 | Ga0451841_0648979 | 3300041498 | Bacteria | 851 |
| 155 | Ga0451845_0509085 | 3300041501 | Bacteria | 1645 |
| 156 | Ga0451847_0054784 | 3300041503 | Bacteria | 2806 |
| 157 | Ga0451849_0219018 | 3300041505 | Bacteria | 3632 |
| 158 | Ga0451851_0579564 | 3300041507 | Bacteria | 3963 |
| 159 | Ga0451853_0692887 | 3300041512 | Bacteria | 3567 |
| 160 | Ga0439442_009557 | 3300042002 | Bacteria | 1961 |
| 161 | Ga0439449_0089202 | 3300042007 | Bacteria | 1138 |
| 162 | Ga0439449_0148502 | 3300042007 | Bacteria | 874 |
| 163 | Ga0439451_010933 | 3300042009 | Bacteria | 1830 |
| 164 | Ga0439452_000072 | 3300042010 | Bacteria | 88574 |
| 165 | Ga0439440_0002240 | 3300042993 | Bacteria | 3624 |
| 166 | Ga0466963_0250889 | 3300044694 | Bacteria | 1242 |
| 167 | Ga0466963_0302111 | 3300044694 | Bacteria | 1126 |
| 168 | Ga0466957_0000424 | 3300044842 | Bacteria | 20789 |
| 169 | Ga0466960_0027509 | 3300044901 | Bacteria | 2595 |
| 170 | Ga0495627_003113 | 3300046453 | Bacteria | 7516 |
| 171 | Ga0495592_0049789 | 3300046454 | Bacteria | 3114 |
| 172 | Ga0495591_001339 | 3300046458 | Bacteria | 15482 |
| 173 | Ga0495591_001915 | 3300046458 | Bacteria | 12215 |
| 174 | Ga0495638_0000337 | 3300046460 | Bacteria | 59070 |
| 175 | Ga0495638_0032044 | 3300046460 | Bacteria | 3372 |
| 176 | Ga0495638_0060974 | 3300046460 | Bacteria | 2332 |
| 177 | Ga0495651_0028015 | 3300046462 | Bacteria | 4391 |
| 178 | Ga0495653_0006986 | 3300046463 | Bacteria | 9265 |
| 179 | Ga0495653_0061261 | 3300046463 | Bacteria | 2847 |
| 180 | Ga0495653_0068971 | 3300046463 | Bacteria | 2650 |
| 181 | Ga0495582_0002108 | 3300046473 | Bacteria | 11126 |
| 182 | Ga0495605_0012525 | 3300046474 | Bacteria | 4702 |
| 183 | Ga0495639_0006288 | 3300046475 | Bacteria | 5101 |
| 184 | Ga0495639_0142014 | 3300046475 | Bacteria | 1155 |
| 185 | Ga0495664_0005994 | 3300046477 | Bacteria | 6701 |
| 186 | Ga0495585_0000012 | 3300046492 | Bacteria | 203064 |
| 187 | Ga0495585_0031944 | 3300046492 | Bacteria | 2985 |
| 188 | Ga0495594_0140572 | 3300046499 | Bacteria | 1369 |
| 189 | Ga0495607_0017376 | 3300046501 | Bacteria | 4620 |
| 190 | Ga0495583_0002549 | 3300046506 | Bacteria | 15393 |
| 191 | Ga0495606_0002150 | 3300046507 | Bacteria | 23749 |
| 192 | Ga0495610_0001335 | 3300046512 | Bacteria | 21880 |
| 193 | Ga0495610_0002873 | 3300046512 | Bacteria | 13984 |
| 194 | Ga0495610_0041811 | 3300046512 | Bacteria | 2298 |
| 195 | Ga0495610_0061814 | 3300046512 | Bacteria | 1778 |
| 196 | Ga0495616_0006862 | 3300046513 | Bacteria | 6858 |
| 197 | Ga0495616_0049818 | 3300046513 | Bacteria | 2097 |
| 198 | Ga0495620_0031262 | 3300046515 | Bacteria | 2441 |
| 199 | Ga0495630_0003330 | 3300046517 | Bacteria | 11191 |
| 200 | Ga0495630_0005890 | 3300046517 | Bacteria | 8668 |
| 201 | Ga0495630_0013664 | 3300046517 | Bacteria | 5902 |
| 202 | Ga0495630_0025235 | 3300046517 | Bacteria | 4394 |
| 203 | Ga0495632_0002236 | 3300046519 | Bacteria | 14936 |
| 204 | Ga0495637_0000104 | 3300046520 | Bacteria | 62838 |
| 205 | Ga0495637_0006512 | 3300046520 | Bacteria | 5853 |
| 206 | Ga0495648_0007964 | 3300046524 | Bacteria | 8404 |
| 207 | Ga0495648_0012641 | 3300046524 | Bacteria | 6278 |
| 208 | Ga0495666_0000923 | 3300046526 | Bacteria | 13825 |
| 209 | Ga0495666_0013659 | 3300046526 | Bacteria | 4049 |
| 210 | Ga0495666_0073246 | 3300046526 | Bacteria | 1625 |
| 211 | Ga0495654_0003761 | 3300046530 | Bacteria | 9192 |
| 212 | Ga0495665_0029429 | 3300046531 | Bacteria | 2943 |
| 213 | Ga0495665_0048337 | 3300046531 | Bacteria | 2255 |
| 214 | Ga0495586_0002053 | 3300046535 | Bacteria | 10938 |
| 215 | Ga0495587_0001330 | 3300046536 | Bacteria | 16412 |
| 216 | Ga0495597_0002064 | 3300046542 | Bacteria | 13397 |
| 217 | Ga0495645_0056587 | 3300046543 | Bacteria | 2847 |
| 218 | Ga0495645_0236758 | 3300046543 | Bacteria | 1220 |
| 219 | Ga0495622_0007978 | 3300046557 | Bacteria | 4908 |
| 220 | Ga0495622_0054733 | 3300046557 | Bacteria | 1851 |
| 221 | Ga0495656_0004721 | 3300046615 | Bacteria | 4683 |
| 222 | Ga0495634_0001217 | 3300046642 | Bacteria | 23743 |
| 223 | Ga0495634_0136118 | 3300046642 | Bacteria | 1563 |
| 224 | Ga0495625_0001537 | 3300046660 | Bacteria | 27559 |
| 225 | Ga0495625_0005428 | 3300046660 | Bacteria | 11638 |
| 226 | Ga0495635_0000478 | 3300046663 | Bacteria | 25287 |
| 227 | Ga0495659_0000022 | 3300046664 | Bacteria | 72378 |
| 228 | Ga0495661_0081415 | 3300046665 | Bacteria | 1866 |
| 229 | Ga0495661_0085935 | 3300046665 | Bacteria | 1802 |
| 230 | Ga0495588_0027462 | 3300046674 | Bacteria | 2844 |
| 231 | Ga0495588_0041330 | 3300046674 | Bacteria | 2354 |
| 232 | Ga0495657_0015936 | 3300046675 | Bacteria | 5486 |
| 233 | Ga0495599_0120963 | 3300046678 | Bacteria | 1628 |
| 234 | Ga0495599_0348035 | 3300046678 | Bacteria | 889 |
| 235 | Ga0495623_0003127 | 3300046679 | Bacteria | 10909 |
| 236 | Ga0495623_0005374 | 3300046679 | Bacteria | 8381 |
| 237 | Ga0495646_0000376 | 3300046680 | Bacteria | 23282 |
| 238 | Ga0495646_0003831 | 3300046680 | Bacteria | 9396 |
| 239 | Ga0495613_0002368 | 3300046689 | Bacteria | 14285 |
| 240 | Ga0495670_0025008 | 3300046691 | Bacteria | 2953 |
| 241 | Ga0495670_0038162 | 3300046691 | Bacteria | 2395 |
| 242 | Ga0495671_0052308 | 3300046692 | Bacteria | 2030 |
| 243 | Ga0495649_0000036 | 3300046694 | Bacteria | 134537 |
| 244 | Ga0495649_0000202 | 3300046694 | Bacteria | 52910 |
| 245 | Ga0495649_0001349 | 3300046694 | Bacteria | 18658 |
| 246 | Ga0495649_0003058 | 3300046694 | Bacteria | 11456 |
| 247 | Ga0495649_0022900 | 3300046694 | Bacteria | 3493 |
| 248 | Ga0495589_0000711 | 3300046794 | Bacteria | 21577 |
| 249 | Ga0495589_0001234 | 3300046794 | Bacteria | 15147 |
| 250 | Ga0495589_0098260 | 3300046794 | Bacteria | 1418 |
| 251 | Ga0495600_0014597 | 3300046809 | Bacteria | 4951 |
| 252 | Ga0495660_0003169 | 3300046810 | Bacteria | 10245 |
| 253 | Ga0495581_0031122 | 3300047315 | Bacteria | 3092 |
| 254 | Ga0495604_0001884 | 3300047317 | Bacteria | 17046 |
| 255 | Ga0495604_0009365 | 3300047317 | Bacteria | 7747 |
| 256 | Ga0495604_0026289 | 3300047317 | Bacteria | 4634 |
| 257 | Ga0495674_0001838 | 3300047319 | Bacteria | 20925 |
| 258 | Ga0495672_0022949 | 3300047320 | Bacteria | 4048 |
| 259 | Ga0495680_0000645 | 3300047322 | Bacteria | 39120 |
| 260 | Ga0495680_0003589 | 3300047322 | Bacteria | 15193 |
| 261 | Ga0495680_0016115 | 3300047322 | Bacteria | 6426 |
| 262 | Ga0495680_0058939 | 3300047322 | Bacteria | 2965 |
| 263 | Ga0495680_0116848 | 3300047322 | Bacteria | 1972 |
| 264 | Ga0495683_0002684 | 3300047323 | Bacteria | 10614 |
| 265 | Ga0495687_000822 | 3300047443 | Bacteria | 33205 |
| 266 | Ga0495687_063793 | 3300047443 | Bacteria | 1507 |
| 267 | Ga0495675_0001391 | 3300047444 | Bacteria | 14679 |
| 268 | Ga0495675_0010086 | 3300047444 | Bacteria | 5893 |
| 269 | Ga0495675_0098344 | 3300047444 | Bacteria | 1833 |
| 270 | Ga0495675_0110180 | 3300047444 | Bacteria | 1719 |
| 271 | Ga0495681_0091994 | 3300047470 | Bacteria | 1337 |
| 272 | Ga0495684_0027342 | 3300047471 | Bacteria | 4379 |
| 273 | Ga0495686_0000556 | 3300047472 | Bacteria | 53309 |
| 274 | Ga0495686_0001910 | 3300047472 | Bacteria | 20811 |
| 275 | Ga0495686_0150917 | 3300047472 | Bacteria | 1364 |
| 276 | Ga0495593_0002125 | 3300047673 | Bacteria | 11847 |
| 277 | Ga0495593_0016068 | 3300047673 | Bacteria | 4225 |
| 278 | Ga0495593_0038118 | 3300047673 | Bacteria | 2597 |
| 279 | Ga0495593_0102802 | 3300047673 | Bacteria | 1464 |
| 280 | Ga0495593_0155285 | 3300047673 | Bacteria | 1156 |
| 281 | Ga0495602_0056287 | 3300048088 | Bacteria | 3459 |
| 282 | Ga0496104_0706132 | 3300048907 | Bacteria | 916 |
| 283 | Ga0496105_0018615 | 3300048908 | Bacteria | 5589 |
| 284 | Ga0496106_0014056 | 3300048909 | Bacteria | 5915 |
| 285 | Ga0496107_0074350 | 3300048910 | Bacteria | 2472 |
| 286 | Ga0496112_0013355 | 3300048915 | Bacteria | 7581 |
| 287 | Ga0496113_0020262 | 3300048916 | Bacteria | 4673 |
| 288 | Ga0496116_0001588 | 3300048919 | Bacteria | 25003 |
| 289 | Ga0496116_0033242 | 3300048919 | Bacteria | 3662 |
| 290 | Ga0496117_0014535 | 3300048920 | Bacteria | 6775 |
| 291 | Ga0496118_0025629 | 3300048921 | Bacteria | 5048 |
| 292 | Ga0496118_0086251 | 3300048921 | Bacteria | 2182 |
| 293 | Ga0496119_0035847 | 3300048922 | Bacteria | 3244 |
| 294 | Ga0496121_0009631 | 3300048924 | Bacteria | 11067 |
| 295 | Ga0496121_0023127 | 3300048924 | Bacteria | 5999 |
| 296 | Ga0496122_0000244 | 3300048925 | Bacteria | 122107 |
| 297 | Ga0496122_0001098 | 3300048925 | Bacteria | 46802 |
| 298 | Ga0496122_0006544 | 3300048925 | Bacteria | 13325 |
| 299 | Ga0496123_0000201 | 3300048926 | Bacteria | 121915 |
| 300 | Ga0496123_0018936 | 3300048926 | Bacteria | 5446 |
| 301 | Ga0496123_0184371 | 3300048926 | Bacteria | 1086 |
| 302 | Ga0496124_0064843 | 3300048927 | Bacteria | 3048 |
| 303 | Ga0496124_0133783 | 3300048927 | Bacteria | 1966 |
| 304 | Ga0496125_0000083 | 3300048928 | Bacteria | 227168 |
| 305 | Ga0496125_0048058 | 3300048928 | Bacteria | 3562 |
| 306 | Ga0496126_0010318 | 3300048929 | Bacteria | 9806 |
| 307 | Ga0501031_0443822 | 3300049568 | Bacteria | 838 |
| 308 | Ga0501032_0143226 | 3300049569 | Bacteria | 1574 |
| 309 | Ga0501032_0212619 | 3300049569 | Bacteria | 1260 |
| 310 | Ga0501033_0224251 | 3300049570 | Bacteria | 1337 |
| 311 | Ga0501034_0000944 | 3300049571 | Bacteria | 42142 |
| 312 | Ga0501034_0116791 | 3300049571 | Bacteria | 2656 |
| 313 | Ga0501034_0310564 | 3300049571 | Bacteria | 1511 |
| 314 | Ga0501034_0318065 | 3300049571 | Bacteria | 1490 |
| 315 | Ga0501034_0571227 | 3300049571 | Bacteria | 1038 |
| 316 | Ga0501038_0199667 | 3300049574 | Bacteria | 1606 |
| 317 | Ga0501038_0211984 | 3300049574 | Bacteria | 1549 |
| 318 | Ga0501038_0330146 | 3300049574 | Bacteria | 1191 |
| 319 | Ga0501039_0739816 | 3300049575 | Bacteria | 768 |
| 320 | Ga0501043_0056013 | 3300049579 | Bacteria | 3097 |
| 321 | Ga0501047_0074320 | 3300049581 | Bacteria | 3272 |
| 322 | Ga0501074_0526929 | 3300049590 | Bacteria | 837 |
| 323 | Ga0501035_0021190 | 3300049822 | Bacteria | 5974 |
| 324 | Ga0501045_0297943 | 3300049824 | Bacteria | 1200 |
| 325 | nmdc:mga03683_115414_c1 | 3300050489 | Bacteria | 1191 |
| 326 | nmdc:mga03n38_52176_c1 | 3300050490 | Bacteria | 1829 |
| 327 | nmdc:mga0yw44_18797_c1 | 3300050492 | Bacteria | 3795 |
| 328 | nmdc:mga0k408_57878_c1 | 3300050493 | Bacteria | 2251 |
| 329 | nmdc:mga07m45_5402_c1 | 3300050496 | Bacteria | 6355 |
| 330 | Ga0500654_174895 | 3300053099 | Bacteria | 697 |
| 331 | Ga0500608_115247 | 3300053122 | Bacteria | 1227 |
| 332 | Ga0500568_0024236 | 3300053139 | Bacteria | 2572 |
| 333 | Ga0500636_0000095 | 3300053177 | Bacteria | 44876 |
| 334 | 2508731924 | 2508501050 | Bacteria | 9633614 |
| 335 | 2509391277 | 2509276021 | Bacteria | 7634384 |
| 336 | 2509445463 | 2509276033 | Bacteria | 7180565 |
| 337 | 2510892559 | 2510461076 | Bacteria | 8618824 |
| 338 | 2511365551 | 2511231022 | Bacteria | 6719296 |
| 339 | 2511499490 | 2511231052 | Bacteria | 6974333 |
| 340 | 2512528875 | 2512047086 | Bacteria | 6850303 |
| 341 | 2513566011 | 2513237083 | Bacteria | 8410967 |
| 342 | 2513568317 | 2513237084 | Bacteria | 7231967 |
| 343 | 2513580956 | 2513237085 | Bacteria | 7695351 |
| 344 | 2513586236 | 2513237086 | Bacteria | 7265287 |
| 345 | 2513597402 | 2513237088 | Bacteria | 6927906 |
| 346 | 2513634777 | 2513237093 | Bacteria | 7545552 |
| 347 | 2513924102 | 2513237146 | Bacteria | 7166346 |
| 348 | 2514018568 | 2513237162 | Bacteria | 7468464 |
| 349 | 2514050467 | 2513237166 | Bacteria | 10373764 |
| 350 | 2516018730 | 2515154189 | Bacteria | 9629850 |
| 351 | 2527080879 | 2526164713 | Bacteria | 6780608 |
| 352 | 2551676119 | 2551306084 | Bacteria | 8942552 |
| 353 | 2551683926 | 2551306085 | Bacteria | 7347181 |
| 354 | 2551693256 | 2551306086 | Bacteria | 6843938 |
| 355 | 2551704877 | 2551306087 | Bacteria | 7351905 |
| 356 | 2551721491 | 2551306090 | Bacteria | 7953713 |
| 357 | 2551732173 | 2551306092 | Bacteria | 6992595 |
| 358 | 2551739681 | 2551306093 | Bacteria | 7064773 |
| 359 | 2558906782 | 2558860112 | Bacteria | 9931328 |
| 360 | 2585541717 | 2585427528 | Bacteria | 6842387 |
| 361 | 2585840064 | 2585427593 | Bacteria | 7141551 |
| 362 | 2599416148 | 2599185170 | Bacteria | 7295545 |
| 363 | 2617384087 | 2617270742 | Bacteria | 6808054 |
| 364 | 2644200483 | 2643221636 | Bacteria | 6583769 |
| 365 | 2694636653 | 2693429784 | Bacteria | 7241525 |
| 366 | 2738824343 | 2738541296 | Bacteria | 7285013 |
| 367 | 2738836726 | 2738541298 | Bacteria | 7286732 |
| 368 | 2738878257 | 2738541306 | Bacteria | 7284992 |
| 369 | 2739036331 | 2738541333 | Bacteria | 7106503 |
| 370 | 2739189949 | 2738543002 | Bacteria | 7284546 |
| 371 | 2739224850 | 2738543008 | Bacteria | 7282815 |
| 372 | 2753566914 | 2751185846 | Bacteria | 7242164 |
| 373 | 2756676618 | 2756170246 | Bacteria | 7451806 |
| 374 | 2774120049 | 2773857670 | Bacteria | 6407454 |
| 375 | 2774872470 | 2773857925 | Bacteria | 6472445 |
| 376 | 2776266898 | 2775506902 | Bacteria | 6208009 |
| 377 | 2776267805 | 2775506902 | Bacteria | 6208009 |
| 378 | 2776281776 | 2775506904 | Bacteria | 5954060 |
| 379 | 2776283134 | 2775506904 | Bacteria | 5954060 |
| 380 | 2778176605 | 2775507266 | Bacteria | 7392367 |
| 381 | 2784312020 | 2784132072 | Bacteria | 6596533 |
| 382 | 2792580021 | 2791355082 | Bacteria | 5973319 |
| 383 | 2792642174 | 2791355094 | Bacteria | 7011481 |
| 384 | 2792833954 | 2791355137 | Bacteria | 9654227 |
| 385 | 2793317412 | 2791355259 | Bacteria | 7254731 |
| 386 | 2793362354 | 2791355266 | Bacteria | 7116587 |
| 387 | 2793365161 | 2791355267 | Bacteria | 7222458 |
| 388 | 2806046434 | 2802429633 | Bacteria | 7341974 |
| 389 | 2806053030 | 2802429634 | Bacteria | 7083200 |
| 390 | 2806059762 | 2802429635 | Bacteria | 7650140 |
| 391 | 2806068500 | 2802429636 | Bacteria | 7597525 |
| 392 | 2806074922 | 2802429637 | Bacteria | 7067217 |
| 393 | 2808828809 | 2808606357 | Bacteria | 4466944 |
| 394 | 2834580304 | 2834578030 | Bacteria | 3530182 |
| 395 | 2838036269 | 2838035591 | Bacteria | 7166484 |
| 396 | 2841868598 | 2841864319 | Bacteria | 6742987 |
| 397 | 2842342547 | 2842341865 | Bacteria | 7003929 |
| 398 | 2842365680 | 2842363717 | Bacteria | 6844742 |
| 399 | 2842487388 | 2842482326 | Bacteria | 7212537 |
| 400 | 2844166080 | 2844163670 | Bacteria | 7266046 |
| 401 | 2847689001 | 2847686936 | Bacteria | 6278406 |
| 402 | 2847689007 | 2847686936 | Bacteria | 6278406 |
| 403 | 2852392846 | 2852387548 | Bacteria | 8025568 |
| 404 | 2855830280 | 2855825444 | Bacteria | 6785811 |
| 405 | 2855845942 | 2855839649 | Bacteria | 7135830 |
| 406 | 2855846326 | 2855839649 | Bacteria | 7135830 |
| 407 | 2855876408 | 2855872281 | Bacteria | 6964271 |
| 408 | 2856343094 | 2856342000 | Bacteria | 7176905 |
| 409 | 2856346606 | 2856342000 | Bacteria | 7176905 |
| 410 | 2869240480 | 2869234852 | Bacteria | 6654993 |
| 411 | 2869282153 | 2869278585 | Bacteria | 7077053 |
| 412 | 2874111347 | 2874109183 | Bacteria | 6517025 |
| 413 | 2874140419 | 2874139085 | Bacteria | 7021506 |
| 414 | 2878733905 | 2878730984 | Bacteria | 6380721 |
| 415 | 2881159939 | 2881155292 | Bacteria | 6461656 |
| 416 | 2881159944 | 2881155292 | Bacteria | 6461656 |
| 417 | 2881867552 | 2881861095 | Bacteria | 7128710 |
| 418 | 2882460181 | 2882456835 | Bacteria | 6863978 |
| 419 | 2882915282 | 2882912400 | Bacteria | 6801539 |
| 420 | 2883090168 | 2883087390 | Bacteria | 9532701 |
| 421 | 2885271008 | 2885270888 | Bacteria | 9831543 |
| 422 | 2885271241 | 2885270888 | Bacteria | 9831543 |
| 423 | 2885271618 | 2885270888 | Bacteria | 9831543 |
| 424 | 2885272286 | 2885270888 | Bacteria | 9831543 |
| 425 | 2885277000 | 2885270888 | Bacteria | 9831543 |
| 426 | 2888337327 | 2888337043 | Bacteria | 6629336 |
| 427 | 2888337333 | 2888337043 | Bacteria | 6629336 |
| 428 | 2891377988 | 2891373044 | Bacteria | 5202277 |
| 429 | 2900643567 | 2900634093 | Bacteria | 10263517 |
| 430 | 2902689963 | 2902682994 | Bacteria | 8951596 |
| 431 | 2903514613 | 2903513507 | Bacteria | 6344008 |
| 432 | 2904623844 | 2904615490 | Bacteria | 10047340 |
| 433 | 2908673484 | 2908669403 | Bacteria | 5740494 |
| 434 | 2913301678 | 2913295892 | Bacteria | 6333755 |
| 435 | 2915995861 | 2915993759 | Bacteria | 7016183 |
| 436 | 2916008943 | 2916007675 | Bacteria | 6898660 |
| 437 | 2916017689 | 2916014648 | Bacteria | 6946486 |
| 438 | 2916031352 | 2916028427 | Bacteria | 6748433 |
| 439 | 2916058091 | 2916055098 | Bacteria | 6758838 |
| 440 | 2916071346 | 2916068649 | Bacteria | 6943657 |
| 441 | 2921238490 | 2921237296 | Bacteria | 6876710 |
| 442 | 2921266818 | 2921263974 | Bacteria | 6864552 |
| 443 | 2921293911 | 2921289301 | Bacteria | 7316391 |
| 444 | 2921298370 | 2921296804 | Bacteria | 7176999 |
| 445 | 2924155602 | 2924150972 | Bacteria | 7169444 |
| 446 | 2924162936 | 2924158325 | Bacteria | 7188855 |
| 447 | 2924169607 | 2924165586 | Bacteria | 7260590 |
| 448 | 2924175586 | 2924172951 | Bacteria | 6749356 |
| 449 | 2924190048 | 2924186466 | Bacteria | 6876637 |
| 450 | 2924220392 | 2924214083 | Bacteria | 7080103 |
| 451 | 2924224557 | 2924221636 | Bacteria | 7113495 |
| 452 | 2924233304 | 2924228884 | Bacteria | 6633132 |
| 453 | 2924721020 | 2924718760 | Bacteria | 6331356 |
| 454 | 2924731528 | 2924726620 | Bacteria | 6271473 |
| 455 | 2924758162 | 2924754689 | Bacteria | 6774424 |
| 456 | 2924788754 | 2924784321 | Bacteria | 7416538 |
| 457 | 2928161094 | 2928157003 | Bacteria | 7522202 |
| 458 | 2936375345 | 2936375103 | Bacteria | 6652732 |
| 459 | 2937006551 | 2937002841 | Bacteria | 6934057 |
| 460 | 2937043088 | 2937042894 | Bacteria | 6741576 |
| 461 | 2937055863 | 2937049772 | Bacteria | 6757901 |
| 462 | 2937061252 | 2937056579 | Bacteria | 7107896 |
| 463 | 2937072522 | 2937071275 | Bacteria | 6984483 |
| 464 | 2937096252 | 2937091812 | Bacteria | 6979387 |
| 465 | 2937103870 | 2937098957 | Bacteria | 7249374 |
| 466 | 2937132804 | 2937126314 | Bacteria | 6771275 |
| 467 | 2937845022 | 2937843397 | Bacteria | 5256375 |
| 468 | 2937880654 | 2937877337 | Bacteria | 7246526 |
| 469 | 2957429696 | 2957422303 | Bacteria | 7172205 |
| 470 | 2957436223 | 2957430029 | Bacteria | 7022557 |
| 471 | 2957458299 | 2957457609 | Bacteria | 6967680 |
| 472 | 2957474970 | 2957471148 | Bacteria | 6797643 |
| 473 | 2957480827 | 2957478035 | Bacteria | 6756658 |
| 474 | 2957485188 | 2957484790 | Bacteria | 6703082 |
| 475 | 2957503151 | 2957498199 | Bacteria | 7126688 |
| 476 | 2957509527 | 2957505466 | Bacteria | 7253085 |
| 477 | 2958037950 | 2958034702 | Bacteria | 6989922 |
| 478 | 2958049076 | 2958041894 | Bacteria | 13082850 |
| 479 | 2958087786 | 2958084443 | Bacteria | 7312792 |
| 480 | 2958099488 | 2958092219 | Bacteria | 6861151 |
| 481 | 2960608198 | 2960603979 | Bacteria | 6898737 |
| 482 | 2960627500 | 2960624210 | Bacteria | 6875384 |
| 483 | 2960644970 | 2960637947 | Bacteria | 7296468 |
| 484 | 2960649326 | 2960645483 | Bacteria | 7211087 |
| 485 | 2960655569 | 2960652885 | Bacteria | 7083688 |
| 486 | 2964612649 | 2964607997 | Bacteria | 7101408 |
| 487 | 2964633441 | 2964628898 | Bacteria | 7083044 |
| 488 | 2964654227 | 2964649959 | Bacteria | 6675118 |
| 489 | 2964661361 | 2964656573 | Bacteria | 7100150 |
| 490 | 2964683977 | 2964678106 | Bacteria | 6792020 |
| 491 | 2964726374 | 2964719344 | Bacteria | 7286602 |
| 492 | 2965067827 | 2965062239 | Bacteria | 7412989 |
| 493 | 2967683575 | 2967678726 | Bacteria | 7264382 |
| 494 | 2967695849 | 2967693043 | Bacteria | 6804451 |
| 495 | 2967707908 | 2967706974 | Bacteria | 7186053 |
| 496 | 2967719135 | 2967714385 | Bacteria | 7000047 |
| 497 | 2967725613 | 2967721400 | Bacteria | 7073753 |
| 498 | 2967739089 | 2967735183 | Bacteria | 6827012 |
| 499 | 2967763049 | 2967762386 | Bacteria | 6923502 |
| 500 | 2967777427 | 2967775926 | Bacteria | 6738189 |
| 501 | 2968129408 | 2968128360 | Bacteria | 6270294 |
| 502 | 2970026308 | 2970019648 | Bacteria | 7072033 |
| 503 | 2970043098 | 2970040964 | Bacteria | 6731123 |
| 504 | 2970047756 | 2970047711 | Bacteria | 7088379 |
| 505 | 2970058129 | 2970054988 | Bacteria | 6611507 |
| 506 | 2970066055 | 2970061556 | Bacteria | 7099761 |
| 507 | 2970092963 | 2970088815 | Bacteria | 6933825 |
| 508 | 2970114867 | 2970109326 | Bacteria | 6863976 |
| 509 | 2970117481 | 2970116247 | Bacteria | 6501857 |
| 510 | 2970132343 | 2970129317 | Bacteria | 6806560 |
| 511 | 2970139470 | 2970136068 | Bacteria | 7207982 |
| 512 | 2970150934 | 2970149975 | Bacteria | 6779706 |
| 513 | 2970168036 | 2970164137 | Bacteria | 6861252 |
| 514 | 2970174606 | 2970170962 | Bacteria | 6876229 |
| 515 | 2970189105 | 2970184632 | Bacteria | 7054431 |
| 516 | 2970195503 | 2970191845 | Bacteria | 7032787 |
| 517 | 2970596758 | 2970593180 | Bacteria | 7073582 |
| 518 | 2977542123 | 2977537788 | Bacteria | 6929320 |
| 519 | 2977556609 | 2977551784 | Bacteria | 7125765 |
| 520 | 2977575836 | 2977572785 | Bacteria | 6763888 |
| 521 | 2977581906 | 2977579622 | Bacteria | 6772100 |
| 522 | 2981991232 | 2981990288 | Bacteria | 7590678 |
| 523 | 2989350260 | 2989349275 | Bacteria | 6349068 |
| 524 | 3004236369 | 3004232784 | Bacteria | 6662140 |
| 525 | 3004294094 | 3004289098 | Bacteria | 6135450 |
| 526 | 3007423904 | 3007419365 | Bacteria | 7026924 |
| 527 | 8002286900 | 8002285264 | Bacteria | 6717907 |
| 528 | 8003962178 | 8003955200 | Bacteria | 8601927 |
| 529 | 8004711842 | 8004703790 | Bacteria | 8006957 |
| 530 | 8005260591 | 8005258706 | Bacteria | 6184835 |
| 531 | 8005563508 | 8005556819 | Bacteria | 6908598 |
| 532 | 8005565287 | 8005563573 | Bacteria | 7153261 |
| 533 | 8005572439 | 8005570704 | Bacteria | 6957481 |
| 534 | 8018168680 | 8018163183 | Bacteria | 7277977 |
| 535 | 8020943672 | 8020938398 | Bacteria | 7472757 |
| 536 | 8020953688 | 8020953355 | Bacteria | 7439080 |
| 537 | 8039103045 | 8039098773 | Bacteria | 6602928 |
| 538 | 8055273567 | 8055266321 | Bacteria | 7999742 |
| 539 | 8056139940 | 8056137416 | Bacteria | 6147080 |
| 540 | 8056157472 | 8056155041 | Bacteria | 6486948 |
| 541 | 8056182625 | 8056177738 | Bacteria | 6748268 |
| 542 | 8056377670 | 8056375014 | Bacteria | 7006639 |
| 543 | Ga0395899_0008512 | |||
| 544 | MRS2a_Contig_2265 | |||
| 545 | JGI25159J45721_1000080 | |||
| 546 | JGI25151J46595_10003218 | |||
| 547 | JGI25153J46596_10004438 | |||
| 548 | rootH2_10214548 | |||
| 549 | JGI25160J50197_1000160 | |||
| 550 | JGI25160J50197_1001380 | |||
| 551 | JGI25161J50226_1000644 | |||
| 552 | JGI25161J50226_1007165 | |||
| 553 | Ga0055526_1000913 | |||
| 554 | Ga0055526_1001250 | |||
| 555 | Ga0055526_1001730 | |||
| 556 | Ga0055524_1001595 | |||
| 557 | Ga0055524_1034056 | |||
| 558 | Ga0055536_1010628 | |||
| 559 | Ga0055528_1000496 | |||
| 560 | Ga0055528_1008574 | |||
| 561 | Ga0055540_1000077 | |||
| 562 | Ga0055540_1000095 | |||
| 563 | Ga0055540_1008583 | |||
| 564 | Ga0055531_10003881 | |||
| 565 | Ga0058692_1000056 | |||
| 566 | Ga0055543_1000410 | |||
| 567 | Ga0055543_1000625 | |||
| 568 | Ga0065165_1000534 | |||
| 569 | Ga0065165_1011591 | |||
| 570 | Ga0065714_10002449 | |||
| 571 | Ga0065714_10002712 | |||
| 572 | Ga0070658_10049106 | |||
| 573 | Ga0070683_100217589 | |||
| 574 | Ga0070660_100000020 | |||
| 575 | Ga0070659_100000047 | |||
| 576 | Ga0070659_100271906 | |||
| 577 | Ga0070685_10345784 | |||
| 578 | Ga0068856_100369980 | |||
| 579 | Ga0068858_100275034 | |||
| 580 | Ga0081455_10145112 | |||
| 581 | Ga0081538_10004588 | |||
| 582 | Ga0075365_10026094 | |||
| 583 | Ga0075363_100089546 | |||
| 584 | Ga0075432_10000599 | |||
| 585 | Ga0075362_10120493 | |||
| 586 | Ga0075369_10034998 | |||
| 587 | Ga0075366_10013907 | |||
| 588 | Ga0079104_1001104 | |||
| 589 | Ga0105251_10000038 | |||
| 590 | Ga0105251_10010946 | |||
| 591 | Ga0105244_10002923 | |||
| 592 | Ga0105244_10053974 | |||
| 593 | Ga0105250_10004934 | |||
| 594 | Ga0105247_10662791 | |||
| 595 | Ga0105243_10068349 | |||
| 596 | Ga0105242_10178827 | |||
| 597 | Ga0105238_10009567 | |||
| 598 | Ga0123341_1000082 | |||
| 599 | Ga0105239_10005879 | |||
| 600 | Ga0105239_10128292 | |||
| 601 | Ga0157373_10211748 | |||
| 602 | Ga0157370_10022288 | |||
| 603 | Ga0157369_10138693 | |||
| 604 | Ga0157372_11394652 | |||
| 605 | Ga0182008_10000970 | |||
| 606 | Ga0182006_1002548 | |||
| 607 | Ga0182007_10000152 | |||
| 608 | Ga0182005_1000181 | |||
| 609 | Ga0209436_100101 | |||
| 610 | Ga0207425_1002551 | |||
| 611 | Ga0209148_1000331 | |||
| 612 | Ga0209759_1020394 | |||
| 613 | Ga0209129_1000917 | |||
| 614 | Ga0209129_1024250 | |||
| 615 | Ga0209455_1000371 | |||
| 616 | Ga0209673_1000294 | |||
| 617 | Ga0209673_1000968 | |||
| 618 | Ga0209130_1000309 | |||
| 619 | Ga0209130_1023894 | |||
| 620 | Ga0209676_1002316 | |||
| 621 | Ga0209025_1000260 | |||
| 622 | Ga0209025_1001911 | |||
| 623 | Ga0209025_1022425 | |||
| 624 | Ga0209564_1000341 | |||
| 625 | Ga0209564_1001129 | |||
| 626 | Ga0209758_1001982 | |||
| 627 | Ga0209758_1003817 | |||
| 628 | Ga0209050_1010756 | |||
| 629 | Ga0209050_1011672 | |||
| 630 | Ga0209256_1000719 | |||
| 631 | Ga0209256_1003376 | |||
| 632 | Ga0207426_1000503 | |||
| 633 | Ga0207426_1001199 | |||
| 634 | Ga0209051_1000027 | |||
| 635 | Ga0209051_1003762 | |||
| 636 | Ga0209051_1041767 | |||
| 637 | Ga0209257_1000599 | |||
| 638 | Ga0209257_1002580 | |||
| 639 | Ga0207696_1000018 | |||
| 640 | Ga0207655_1001322 | |||
| 641 | Ga0207655_1011199 | |||
| 642 | Ga0207713_1000185 | |||
| 643 | Ga0207713_1002035 | |||
| 644 | Ga0207688_10056684 | |||
| 645 | Ga0207705_10036303 | |||
| 646 | Ga0207657_10000390 | |||
| 647 | Ga0207649_10384538 | |||
| 648 | Ga0207690_10000037 | |||
| 649 | Ga0207690_10225952 | |||
| 650 | Ga0207702_10317460 | |||
| 651 | Ga0209281_1000778 | |||
| 652 | Ga0209371_1000121 | |||
| 653 | Ga0207428_10002525 | |||
| 654 | Ga0268256_1000107 | |||
| 655 | Ga0307408_100355446 | |||
| 656 | Ga0307405_10029046 | |||
| 657 | Ga0307405_10141687 | |||
| 658 | Ga0307413_10027454 | |||
| 659 | Ga0307413_10055294 | |||
| 660 | Ga0307410_10145813 | |||
| 661 | Ga0307410_10411796 | |||
| 662 | Ga0307406_10016078 | |||
| 663 | Ga0307406_10093425 | |||
| 664 | Ga0307406_10425518 | |||
| 665 | Ga0307407_10020138 | |||
| 666 | Ga0307409_100113298 | |||
| 667 | Ga0307409_100382540 | |||
| 668 | Ga0307416_100007287 | |||
| 669 | Ga0307415_100129578 | |||
| 670 | Ga0373937_0197626 | |||
| 671 | Ga0373925_0052189 | |||
| 672 | Ga0395899_0002826 | |||
| 673 | Ga0395900_0008030 | |||
| 674 | Ga0395900_0109630 | |||
| 675 | Ga0395898_0003468 | |||
| 676 | Ga0395898_0010331 | |||
| 677 | Ga0395898_0147701 | |||
| 678 | Ga0395905_0000024 | |||
| 679 | Ga0395905_0001801 | |||
| 680 | Ga0395905_0080861 | |||
| 681 | Ga0395901_0000434 | |||
| 682 | Ga0395901_0027622 | |||
| 683 | Ga0395901_0096386 | |||
| 684 | Ga0395901_0199731 | |||
| 685 | Ga0400483_044762 | |||
| 686 | Ga0400483_188268 | |||
| 687 | Ga0439438_001222 | |||
| 688 | Ga0439447_009478 | |||
| 689 | Ga0439466_0008929 | |||
| 690 | Ga0439466_0016051 | |||
| 691 | Ga0439465_0009838 | |||
| 692 | Ga0451835_0189026 | |||
| 693 | Ga0451835_0889751 | |||
| 694 | Ga0451837_1430986 | |||
| 695 | Ga0451839_1280463 | |||
| 696 | Ga0451841_0648979 | |||
| 697 | Ga0451845_0509085 | |||
| 698 | Ga0451847_0054784 | |||
| 699 | Ga0451849_0219018 | |||
| 700 | Ga0451851_0579564 | |||
| 701 | Ga0451853_0692887 | |||
| 702 | Ga0439442_009557 | |||
| 703 | Ga0439449_0089202 | |||
| 704 | Ga0439449_0148502 | |||
| 705 | Ga0439451_010933 | |||
| 706 | Ga0439452_000072 | |||
| 707 | Ga0439440_0002240 | |||
| 708 | Ga0466963_0250889 | |||
| 709 | Ga0466963_0302111 | |||
| 710 | Ga0466957_0000424 | |||
| 711 | Ga0466960_0027509 | |||
| 712 | Ga0495627_003113 | |||
| 713 | Ga0495592_0049789 | |||
| 714 | Ga0495591_001339 | |||
| 715 | Ga0495591_001915 | |||
| 716 | Ga0495638_0000337 | |||
| 717 | Ga0495638_0032044 | |||
| 718 | Ga0495638_0060974 | |||
| 719 | Ga0495651_0028015 | |||
| 720 | Ga0495653_0006986 | |||
| 721 | Ga0495653_0061261 | |||
| 722 | Ga0495653_0068971 | |||
| 723 | Ga0495582_0002108 | |||
| 724 | Ga0495605_0012525 | |||
| 725 | Ga0495639_0006288 | |||
| 726 | Ga0495639_0142014 | |||
| 727 | Ga0495664_0005994 | |||
| 728 | Ga0495585_0000012 | |||
| 729 | Ga0495585_0031944 | |||
| 730 | Ga0495594_0140572 | |||
| 731 | Ga0495607_0017376 | |||
| 732 | Ga0495583_0002549 | |||
| 733 | Ga0495606_0002150 | |||
| 734 | Ga0495610_0001335 | |||
| 735 | Ga0495610_0002873 | |||
| 736 | Ga0495610_0041811 | |||
| 737 | Ga0495610_0061814 | |||
| 738 | Ga0495616_0006862 | |||
| 739 | Ga0495616_0049818 | |||
| 740 | Ga0495620_0031262 | |||
| 741 | Ga0495630_0003330 | |||
| 742 | Ga0495630_0005890 | |||
| 743 | Ga0495630_0013664 | |||
| 744 | Ga0495630_0025235 | |||
| 745 | Ga0495632_0002236 | |||
| 746 | Ga0495637_0000104 | |||
| 747 | Ga0495637_0006512 | |||
| 748 | Ga0495648_0007964 | |||
| 749 | Ga0495648_0012641 | |||
| 750 | Ga0495666_0000923 | |||
| 751 | Ga0495666_0013659 | |||
| 752 | Ga0495666_0073246 | |||
| 753 | Ga0495654_0003761 | |||
| 754 | Ga0495665_0029429 | |||
| 755 | Ga0495665_0048337 | |||
| 756 | Ga0495586_0002053 | |||
| 757 | Ga0495587_0001330 | |||
| 758 | Ga0495597_0002064 | |||
| 759 | Ga0495645_0056587 | |||
| 760 | Ga0495645_0236758 | |||
| 761 | Ga0495622_0007978 | |||
| 762 | Ga0495622_0054733 | |||
| 763 | Ga0495656_0004721 | |||
| 764 | Ga0495634_0001217 | |||
| 765 | Ga0495634_0136118 | |||
| 766 | Ga0495625_0001537 | |||
| 767 | Ga0495625_0005428 | |||
| 768 | Ga0495635_0000478 | |||
| 769 | Ga0495659_0000022 | |||
| 770 | Ga0495661_0081415 | |||
| 771 | Ga0495661_0085935 | |||
| 772 | Ga0495588_0027462 | |||
| 773 | Ga0495588_0041330 | |||
| 774 | Ga0495657_0015936 | |||
| 775 | Ga0495599_0120963 | |||
| 776 | Ga0495599_0348035 | |||
| 777 | Ga0495623_0003127 | |||
| 778 | Ga0495623_0005374 | |||
| 779 | Ga0495646_0000376 | |||
| 780 | Ga0495646_0003831 | |||
| 781 | Ga0495613_0002368 | |||
| 782 | Ga0495670_0025008 | |||
| 783 | Ga0495670_0038162 | |||
| 784 | Ga0495671_0052308 | |||
| 785 | Ga0495649_0000036 | |||
| 786 | Ga0495649_0000202 | |||
| 787 | Ga0495649_0001349 | |||
| 788 | Ga0495649_0003058 | |||
| 789 | Ga0495649_0022900 | |||
| 790 | Ga0495589_0000711 | |||
| 791 | Ga0495589_0001234 | |||
| 792 | Ga0495589_0098260 | |||
| 793 | Ga0495600_0014597 | |||
| 794 | Ga0495660_0003169 | |||
| 795 | Ga0495581_0031122 | |||
| 796 | Ga0495604_0001884 | |||
| 797 | Ga0495604_0009365 | |||
| 798 | Ga0495604_0026289 | |||
| 799 | Ga0495674_0001838 | |||
| 800 | Ga0495672_0022949 | |||
| 801 | Ga0495680_0000645 | |||
| 802 | Ga0495680_0003589 | |||
| 803 | Ga0495680_0016115 | |||
| 804 | Ga0495680_0058939 | |||
| 805 | Ga0495680_0116848 | |||
| 806 | Ga0495683_0002684 | |||
| 807 | Ga0495687_000822 | |||
| 808 | Ga0495687_063793 | |||
| 809 | Ga0495675_0001391 | |||
| 810 | Ga0495675_0010086 | |||
| 811 | Ga0495675_0098344 | |||
| 812 | Ga0495675_0110180 | |||
| 813 | Ga0495681_0091994 | |||
| 814 | Ga0495684_0027342 | |||
| 815 | Ga0495686_0000556 | |||
| 816 | Ga0495686_0001910 | |||
| 817 | Ga0495686_0150917 | |||
| 818 | Ga0495593_0002125 | |||
| 819 | Ga0495593_0016068 | |||
| 820 | Ga0495593_0038118 | |||
| 821 | Ga0495593_0102802 | |||
| 822 | Ga0495593_0155285 | |||
| 823 | Ga0495602_0056287 | |||
| 824 | Ga0496104_0706132 | |||
| 825 | Ga0496105_0018615 | |||
| 826 | Ga0496106_0014056 | |||
| 827 | Ga0496107_0074350 | |||
| 828 | Ga0496112_0013355 | |||
| 829 | Ga0496113_0020262 | |||
| 830 | Ga0496116_0001588 | |||
| 831 | Ga0496116_0033242 | |||
| 832 | Ga0496117_0014535 | |||
| 833 | Ga0496118_0025629 | |||
| 834 | Ga0496118_0086251 | |||
| 835 | Ga0496119_0035847 | |||
| 836 | Ga0496121_0009631 | |||
| 837 | Ga0496121_0023127 | |||
| 838 | Ga0496122_0000244 | |||
| 839 | Ga0496122_0001098 | |||
| 840 | Ga0496122_0006544 | |||
| 841 | Ga0496123_0000201 | |||
| 842 | Ga0496123_0018936 | |||
| 843 | Ga0496123_0184371 | |||
| 844 | Ga0496124_0064843 | |||
| 845 | Ga0496124_0133783 | |||
| 846 | Ga0496125_0000083 | |||
| 847 | Ga0496125_0048058 | |||
| 848 | Ga0496126_0010318 | |||
| 849 | Ga0501031_0443822 | |||
| 850 | Ga0501032_0143226 | |||
| 851 | Ga0501032_0212619 | |||
| 852 | Ga0501033_0224251 | |||
| 853 | Ga0501034_0000944 | |||
| 854 | Ga0501034_0116791 | |||
| 855 | Ga0501034_0310564 | |||
| 856 | Ga0501034_0318065 | |||
| 857 | Ga0501034_0571227 | |||
| 858 | Ga0501038_0199667 | |||
| 859 | Ga0501038_0211984 | |||
| 860 | Ga0501038_0330146 | |||
| 861 | Ga0501039_0739816 | |||
| 862 | Ga0501043_0056013 | |||
| 863 | Ga0501047_0074320 | |||
| 864 | Ga0501074_0526929 | |||
| 865 | Ga0501035_0021190 | |||
| 866 | Ga0501045_0297943 | |||
| 867 | nmdc:mga03683_115414_c1 | |||
| 868 | nmdc:mga03n38_52176_c1 | |||
| 869 | nmdc:mga0yw44_18797_c1 | |||
| 870 | nmdc:mga0k408_57878_c1 | |||
| 871 | nmdc:mga07m45_5402_c1 | |||
| 872 | Ga0500654_174895 | |||
| 873 | Ga0500608_115247 | |||
| 874 | Ga0500568_0024236 | |||
| 875 | Ga0500636_0000095 | |||
| 876 | 2508731924 | |||
| 877 | 2509391277 | |||
| 878 | 2509445463 | |||
| 879 | 2510892559 | |||
| 880 | 2511365551 | |||
| 881 | 2511499490 | |||
| 882 | 2512528875 | |||
| 883 | 2513566011 | |||
| 884 | 2513568317 | |||
| 885 | 2513580956 | |||
| 886 | 2513586236 | |||
| 887 | 2513597402 | |||
| 888 | 2513634777 | |||
| 889 | 2513924102 | |||
| 890 | 2514018568 | |||
| 891 | 2514050467 | |||
| 892 | 2516018730 | |||
| 893 | 2527080879 | |||
| 894 | 2551676119 | |||
| 895 | 2551683926 | |||
| 896 | 2551693256 | |||
| 897 | 2551704877 | |||
| 898 | 2551721491 | |||
| 899 | 2551732173 | |||
| 900 | 2551739681 | |||
| 901 | 2558906782 | |||
| 902 | 2585541717 | |||
| 903 | 2585840064 | |||
| 904 | 2599416148 | |||
| 905 | 2617384087 | |||
| 906 | 2644200483 | |||
| 907 | 2694636653 | |||
| 908 | 2738824343 | |||
| 909 | 2738836726 | |||
| 910 | 2738878257 | |||
| 911 | 2739036331 | |||
| 912 | 2739189949 | |||
| 913 | 2739224850 | |||
| 914 | 2753566914 | |||
| 915 | 2756676618 | |||
| 916 | 2774120049 | |||
| 917 | 2774872470 | |||
| 918 | 2776266898 | |||
| 919 | 2776267805 | |||
| 920 | 2776281776 | |||
| 921 | 2776283134 | |||
| 922 | 2778176605 | |||
| 923 | 2784312020 | |||
| 924 | 2792580021 | |||
| 925 | 2792642174 | |||
| 926 | 2792833954 | |||
| 927 | 2793317412 | |||
| 928 | 2793362354 | |||
| 929 | 2793365161 | |||
| 930 | 2806046434 | |||
| 931 | 2806053030 | |||
| 932 | 2806059762 | |||
| 933 | 2806068500 | |||
| 934 | 2806074922 | |||
| 935 | 2808828809 | |||
| 936 | 2834580304 | |||
| 937 | 2838036269 | |||
| 938 | 2841868598 | |||
| 939 | 2842342547 | |||
| 940 | 2842365680 | |||
| 941 | 2842487388 | |||
| 942 | 2844166080 | |||
| 943 | 2847689001 | |||
| 944 | 2847689007 | |||
| 945 | 2852392846 | |||
| 946 | 2855830280 | |||
| 947 | 2855845942 | |||
| 948 | 2855846326 | |||
| 949 | 2855876408 | |||
| 950 | 2856343094 | |||
| 951 | 2856346606 | |||
| 952 | 2869240480 | |||
| 953 | 2869282153 | |||
| 954 | 2874111347 | |||
| 955 | 2874140419 | |||
| 956 | 2878733905 | |||
| 957 | 2881159939 | |||
| 958 | 2881159944 | |||
| 959 | 2881867552 | |||
| 960 | 2882460181 | |||
| 961 | 2882915282 | |||
| 962 | 2883090168 | |||
| 963 | 2885271008 | |||
| 964 | 2885271241 | |||
| 965 | 2885271618 | |||
| 966 | 2885272286 | |||
| 967 | 2885277000 | |||
| 968 | 2888337327 | |||
| 969 | 2888337333 | |||
| 970 | 2891377988 | |||
| 971 | 2900643567 | |||
| 972 | 2902689963 | |||
| 973 | 2903514613 | |||
| 974 | 2904623844 | |||
| 975 | 2908673484 | |||
| 976 | 2913301678 | |||
| 977 | 2915995861 | |||
| 978 | 2916008943 | |||
| 979 | 2916017689 | |||
| 980 | 2916031352 | |||
| 981 | 2916058091 | |||
| 982 | 2916071346 | |||
| 983 | 2921238490 | |||
| 984 | 2921266818 | |||
| 985 | 2921293911 | |||
| 986 | 2921298370 | |||
| 987 | 2924155602 | |||
| 988 | 2924162936 | |||
| 989 | 2924169607 | |||
| 990 | 2924175586 | |||
| 991 | 2924190048 | |||
| 992 | 2924220392 | |||
| 993 | 2924224557 | |||
| 994 | 2924233304 | |||
| 995 | 2924721020 | |||
| 996 | 2924731528 | |||
| 997 | 2924758162 | |||
| 998 | 2924788754 | |||
| 999 | 2928161094 | |||
| 1000 | 2936375345 | |||
| 1001 | 2937006551 | |||
| 1002 | 2937043088 | |||
| 1003 | 2937055863 | |||
| 1004 | 2937061252 | |||
| 1005 | 2937072522 | |||
| 1006 | 2937096252 | |||
| 1007 | 2937103870 | |||
| 1008 | 2937132804 | |||
| 1009 | 2937845022 | |||
| 1010 | 2937880654 | |||
| 1011 | 2957429696 | |||
| 1012 | 2957436223 | |||
| 1013 | 2957458299 | |||
| 1014 | 2957474970 | |||
| 1015 | 2957480827 | |||
| 1016 | 2957485188 | |||
| 1017 | 2957503151 | |||
| 1018 | 2957509527 | |||
| 1019 | 2958037950 | |||
| 1020 | 2958049076 | |||
| 1021 | 2958087786 | |||
| 1022 | 2958099488 | |||
| 1023 | 2960608198 | |||
| 1024 | 2960627500 | |||
| 1025 | 2960644970 | |||
| 1026 | 2960649326 | |||
| 1027 | 2960655569 | |||
| 1028 | 2964612649 | |||
| 1029 | 2964633441 | |||
| 1030 | 2964654227 | |||
| 1031 | 2964661361 | |||
| 1032 | 2964683977 | |||
| 1033 | 2964726374 | |||
| 1034 | 2965067827 | |||
| 1035 | 2967683575 | |||
| 1036 | 2967695849 | |||
| 1037 | 2967707908 | |||
| 1038 | 2967719135 | |||
| 1039 | 2967725613 | |||
| 1040 | 2967739089 | |||
| 1041 | 2967763049 | |||
| 1042 | 2967777427 | |||
| 1043 | 2968129408 | |||
| 1044 | 2970026308 | |||
| 1045 | 2970043098 | |||
| 1046 | 2970047756 | |||
| 1047 | 2970058129 | |||
| 1048 | 2970066055 | |||
| 1049 | 2970092963 | |||
| 1050 | 2970114867 | |||
| 1051 | 2970117481 | |||
| 1052 | 2970132343 | |||
| 1053 | 2970139470 | |||
| 1054 | 2970150934 | |||
| 1055 | 2970168036 | |||
| 1056 | 2970174606 | |||
| 1057 | 2970189105 | |||
| 1058 | 2970195503 | |||
| 1059 | 2970596758 | |||
| 1060 | 2977542123 | |||
| 1061 | 2977556609 | |||
| 1062 | 2977575836 | |||
| 1063 | 2977581906 | |||
| 1064 | 2981991232 | |||
| 1065 | 2989350260 | |||
| 1066 | 3004236369 | |||
| 1067 | 3004294094 | |||
| 1068 | 3007423904 | |||
| 1069 | 8002286900 | |||
| 1070 | 8003962178 | |||
| 1071 | 8004711842 | |||
| 1072 | 8005260591 | |||
| 1073 | 8005563508 | |||
| 1074 | 8005565287 | |||
| 1075 | 8005572439 | |||
| 1076 | 8018168680 | |||
| 1077 | 8020943672 | |||
| 1078 | 8020953688 | |||
| 1079 | 8039103045 | |||
| 1080 | 8055273567 | |||
| 1081 | 8056139940 | |||
| 1082 | 8056157472 | |||
| 1083 | 8056182625 | |||
| 1084 | 8056377670 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
32
219
0.93
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.8175 | 1 | 210 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.8007 | 1 | 210 |
| 3dhw-assembly1.cif.gz_A | crystal structure of methionine importer metni | 0.76 | 13 | 201 |
| 3dhw-assembly2.cif.gz_E | crystal structure of methionine importer metni | 0.7359 | 14 | 205 |
| 4jbw-assembly2.cif.gz_H | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.7315 | 1 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P45768_144_364_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8385 | 18 | 211 | 1.10.3720.10 |
| af_P0AEU3_9_230_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8358 | 21 | 212 | 1.10.3720.10 |
| af_P0AFT2_3_219_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8308 | 8 | 215 | 1.10.3720.10 |
| af_P0AEQ6_1_218_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8258 | 1 | 211 | 1.10.3720.10 |
| af_P0AE34_6_232_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8134 | 15 | 211 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522RPC8-F1-model_v4 | Amino acid ABC transporter permease | 0.917 | 2 | 216 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A522RPC8-F1-model_v4 | Amino acid ABC transporter permease | 0.9051 | 2 | 216 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A1Y0L8V6-F1-model_v4 | Amino acid ABC transporter permease | 0.8999 | 1 | 215 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A366DZI9-F1-model_v4 | Polar amino acid transport system permease protein | 0.8992 | 1 | 211 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A7C9RBR3-F1-model_v4 | Amino acid ABC transporter permease | 0.8981 | 2 | 216 |
GO:0006865
GO:0022857 GO:0043190 |