F461510

General Info

Members Datasets Scaffolds Average Seq Length
542 413 1084 219

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0008512|Ga0395899_0008512_6123_6875
Length 250
Sequence MNYNFDWNVVANAFPAMMQGLGITVQITLITIAISMVLAVPVAVGRMSKIEVIRWAAQGYIEIFRCTPLLVQLFWIFYALPALTGVTLPGEVSAVIALTANLTAFMAEAYRSGFQSVPVEQVEAGRMLQLNRFQQLRYIIVPQALRQQLPVILSLNISLFKDTALVSTIAVADLMFISNTISSQTYRSLEVFTLAAFVYFAIAFPVSLATSALERRMQNSSGLGAPPPKKLVARMMPGSRTADPRTAVPA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
52 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
79 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
98 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
99 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
100 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
103 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
104 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
105 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
106 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
107 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
108 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
109 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
112 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
113 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
114 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
115 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
213 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
216 2508501050 Microvirga lupini Lut6 Isolate Nodule
217 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
218 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
219 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
220 2511231022 Pseudomonas sp. GM79 Isolate Nodule
221 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
222 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
223 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
224 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
225 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
226 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
227 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
228 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
229 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
230 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
231 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
232 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
233 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
234 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
235 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
236 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
237 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
238 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
239 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
240 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
241 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
242 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
243 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
244 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
245 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
246 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
247 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
248 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
249 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
250 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
251 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
252 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
253 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
254 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
255 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
256 2773857670 Pseudomonas sp. 478 Isolate Unclassified
257 2773857925 Microvirga vignae BR3299 Isolate Unclassified
258 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
259 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
260 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
261 2784132072 Pseudomonas sp. 460 Isolate Unclassified
262 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
263 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
264 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
265 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
266 2791355266 Rhizobium sp. L43 Isolate Nodule
267 2791355267 Rhizobium sp. L18 Isolate Nodule
268 2802429633 Rhizobium anhuiense J3 Isolate Nodule
269 2802429634 Rhizobium anhuiense S10 Isolate Nodule
270 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
271 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
272 2802429637 Rhizobium anhuiense C15 Isolate Nodule
273 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
274 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
275 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
276 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
277 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
278 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
279 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
280 2844163670 Ensifer sp. 1H6 Isolate Unclassified
281 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
282 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
283 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
284 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
285 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
286 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
287 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
288 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
289 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
290 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
291 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
292 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
293 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
294 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
295 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
296 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
297 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
298 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
299 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
300 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
301 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
302 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
303 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
304 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
305 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
306 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
307 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
308 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
309 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
310 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
311 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
312 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
313 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
314 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
315 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
316 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
317 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
318 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
319 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
320 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
321 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
322 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
323 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
324 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
325 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
326 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
327 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
328 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
329 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
330 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
331 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
332 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
333 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
334 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
335 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
336 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
337 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
338 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
339 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
340 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
341 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
342 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
343 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
344 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
345 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
346 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
347 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
348 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
349 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
350 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
351 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
352 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
353 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
354 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
355 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
356 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
357 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
358 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
359 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
360 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
361 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
362 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
363 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
364 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
365 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
366 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
367 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
368 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
369 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
370 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
371 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
372 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
373 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
374 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
375 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
376 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
377 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
378 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
379 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
380 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
381 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
382 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
383 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
384 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
385 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
386 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
387 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
388 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
389 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
390 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
391 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
392 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
393 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
394 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
395 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
396 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
397 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
398 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
399 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
400 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
401 8005258706 Rhizobium sp. R693 Isolate Nodule
402 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
403 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
404 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
405 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
406 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
407 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
408 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
409 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
410 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
411 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
412 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
413 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.44
Metatranscriptomes 0
Isolates 38.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.18
Nodule 29.7
Rhizoplane 1.11
Rhizosphere 43.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0008512 3300037312 Bacteria 7901
2 MRS2a_Contig_2265 2124908027 Bacteria 2288
3 JGI25159J45721_1000080 3300002987 Bacteria 46567
4 JGI25151J46595_10003218 3300003187 Bacteria 9135
5 JGI25153J46596_10004438 3300003215 Bacteria 7569
6 rootH2_10214548 3300003320 Bacteria 1581
7 JGI25160J50197_1000160 3300003354 Bacteria 57733
8 JGI25160J50197_1001380 3300003354 Bacteria 12223
9 JGI25161J50226_1000644 3300003374 Bacteria 14074
10 JGI25161J50226_1007165 3300003374 Bacteria 1908
11 Ga0055526_1000913 3300003771 Bacteria 21962
12 Ga0055526_1001250 3300003771 Bacteria 18238
13 Ga0055526_1001730 3300003771 Bacteria 15178
14 Ga0055524_1001595 3300003775 Bacteria 12719
15 Ga0055524_1034056 3300003775 Bacteria 1415
16 Ga0055536_1010628 3300003781 Bacteria 3626
17 Ga0055528_1000496 3300003790 Bacteria 31066
18 Ga0055528_1008574 3300003790 Bacteria 4356
19 Ga0055540_1000077 3300003792 Bacteria 114283
20 Ga0055540_1000095 3300003792 Bacteria 97555
21 Ga0055540_1008583 3300003792 Bacteria 3664
22 Ga0055531_10003881 3300003794 Bacteria 9356
23 Ga0058692_1000056 3300003856 Bacteria 105284
24 Ga0055543_1000410 3300004625 Bacteria 27002
25 Ga0055543_1000625 3300004625 Bacteria 19011
26 Ga0065165_1000534 3300005262 Bacteria 57771
27 Ga0065165_1011591 3300005262 Bacteria 3655
28 Ga0065714_10002449 3300005288 Bacteria 17872
29 Ga0065714_10002712 3300005288 Bacteria 12352
30 Ga0070658_10049106 3300005327 Bacteria 3418
31 Ga0070683_100217589 3300005329 Bacteria 1815
32 Ga0070660_100000020 3300005339 Bacteria 98286
33 Ga0070659_100000047 3300005366 Bacteria 98286
34 Ga0070659_100271906 3300005366 Bacteria 1408
35 Ga0070685_10345784 3300005466 Bacteria 1015
36 Ga0068856_100369980 3300005614 Bacteria 1452
37 Ga0068858_100275034 3300005842 Bacteria 1603
38 Ga0081455_10145112 3300005937 Bacteria 1837
39 Ga0081538_10004588 3300005981 Bacteria 12706
40 Ga0075365_10026094 3300006038 Bacteria 3705
41 Ga0075363_100089546 3300006048 Bacteria 1692
42 Ga0075432_10000599 3300006058 Bacteria 10906
43 Ga0075362_10120493 3300006177 Bacteria 1241
44 Ga0075369_10034998 3300006186 Bacteria 2133
45 Ga0075366_10013907 3300006195 Bacteria 4587
46 Ga0079104_1001104 3300006946 Bacteria 19946
47 Ga0105251_10000038 3300009011 Bacteria 116060
48 Ga0105251_10010946 3300009011 Bacteria 5218
49 Ga0105244_10002923 3300009036 Bacteria 12611
50 Ga0105244_10053974 3300009036 Bacteria 2040
51 Ga0105250_10004934 3300009092 Bacteria 6049
52 Ga0105247_10662791 3300009101 Bacteria 781
53 Ga0105243_10068349 3300009148 Bacteria 2863
54 Ga0105242_10178827 3300009176 Bacteria 1870
55 Ga0105238_10009567 3300009551 Bacteria 9694
56 Ga0123341_1000082 3300009765 Bacteria 40371
57 Ga0105239_10005879 3300010375 Bacteria 14296
58 Ga0105239_10128292 3300010375 Bacteria 2820
59 Ga0157373_10211748 3300013100 Bacteria 1367
60 Ga0157370_10022288 3300013104 Bacteria 6304
61 Ga0157369_10138693 3300013105 Bacteria 2574
62 Ga0157372_11394652 3300013307 Bacteria 808
63 Ga0182008_10000970 3300014497 Bacteria 19917
64 Ga0182006_1002548 3300015261 Bacteria 9886
65 Ga0182007_10000152 3300015262 Bacteria 46887
66 Ga0182005_1000181 3300015265 Bacteria 43402
67 Ga0209436_100101 3300025208 Bacteria 42360
68 Ga0207425_1002551 3300025245 Bacteria 6340
69 Ga0209148_1000331 3300025254 Bacteria 64881
70 Ga0209759_1020394 3300025256 Bacteria 1539
71 Ga0209129_1000917 3300025258 Bacteria 18018
72 Ga0209129_1024250 3300025258 Bacteria 1070
73 Ga0209455_1000371 3300025272 Bacteria 41412
74 Ga0209673_1000294 3300025273 Bacteria 93050
75 Ga0209673_1000968 3300025273 Bacteria 35620
76 Ga0209130_1000309 3300025284 Bacteria 57785
77 Ga0209130_1023894 3300025284 Bacteria 1341
78 Ga0209676_1002316 3300025292 Bacteria 13827
79 Ga0209025_1000260 3300025294 Bacteria 124240
80 Ga0209025_1001911 3300025294 Bacteria 24216
81 Ga0209025_1022425 3300025294 Bacteria 3349
82 Ga0209564_1000341 3300025295 Bacteria 89262
83 Ga0209564_1001129 3300025295 Bacteria 31419
84 Ga0209758_1001982 3300025297 Bacteria 22133
85 Ga0209758_1003817 3300025297 Bacteria 13248
86 Ga0209050_1010756 3300025298 Bacteria 4459
87 Ga0209050_1011672 3300025298 Bacteria 4133
88 Ga0209256_1000719 3300025299 Bacteria 43868
89 Ga0209256_1003376 3300025299 Bacteria 11297
90 Ga0207426_1000503 3300025302 Bacteria 57785
91 Ga0207426_1001199 3300025302 Bacteria 23041
92 Ga0209051_1000027 3300025303 Bacteria 412172
93 Ga0209051_1003762 3300025303 Bacteria 9734
94 Ga0209051_1041767 3300025303 Bacteria 1628
95 Ga0209257_1000599 3300025304 Bacteria 59865
96 Ga0209257_1002580 3300025304 Bacteria 17618
97 Ga0207696_1000018 3300025711 Bacteria 478605
98 Ga0207655_1001322 3300025728 Bacteria 23408
99 Ga0207655_1011199 3300025728 Bacteria 5360
100 Ga0207713_1000185 3300025735 Bacteria 88697
101 Ga0207713_1002035 3300025735 Bacteria 15137
102 Ga0207688_10056684 3300025901 Bacteria 2202
103 Ga0207705_10036303 3300025909 Bacteria 3527
104 Ga0207657_10000390 3300025919 Bacteria 46278
105 Ga0207649_10384538 3300025920 Bacteria 1047
106 Ga0207690_10000037 3300025932 Bacteria 142658
107 Ga0207690_10225952 3300025932 Bacteria 1435
108 Ga0207702_10317460 3300026078 Bacteria 1483
109 Ga0209281_1000778 3300027111 Bacteria 30318
110 Ga0209371_1000121 3300027312 Bacteria 132565
111 Ga0207428_10002525 3300027907 Bacteria 18264
112 Ga0268256_1000107 3300030500 Bacteria 121028
113 Ga0307408_100355446 3300031548 Bacteria 1244
114 Ga0307405_10029046 3300031731 Bacteria 3228
115 Ga0307405_10141687 3300031731 Bacteria 1677
116 Ga0307413_10027454 3300031824 Bacteria 3155
117 Ga0307413_10055294 3300031824 Bacteria 2414
118 Ga0307410_10145813 3300031852 Bacteria 1756
119 Ga0307410_10411796 3300031852 Bacteria 1094
120 Ga0307406_10016078 3300031901 Bacteria 4341
121 Ga0307406_10093425 3300031901 Bacteria 2031
122 Ga0307406_10425518 3300031901 Bacteria 1059
123 Ga0307407_10020138 3300031903 Bacteria 3411
124 Ga0307409_100113298 3300031995 Bacteria 2279
125 Ga0307409_100382540 3300031995 Bacteria 1338
126 Ga0307416_100007287 3300032002 Bacteria 7014
127 Ga0307415_100129578 3300032126 Bacteria 1907
128 Ga0373937_0197626 3300036401 Bacteria 1890
129 Ga0373925_0052189 3300037068 Bacteria 3055
130 Ga0395899_0002826 3300037312 Bacteria 13986
131 Ga0395900_0008030 3300037418 Bacteria 10861
132 Ga0395900_0109630 3300037418 Bacteria 2836
133 Ga0395898_0003468 3300037466 Bacteria 17615
134 Ga0395898_0010331 3300037466 Bacteria 9766
135 Ga0395898_0147701 3300037466 Bacteria 2250
136 Ga0395905_0000024 3300037471 Bacteria 318806
137 Ga0395905_0001801 3300037471 Bacteria 24828
138 Ga0395905_0080861 3300037471 Bacteria 3046
139 Ga0395901_0000434 3300038443 Bacteria 48945
140 Ga0395901_0027622 3300038443 Bacteria 5832
141 Ga0395901_0096386 3300038443 Bacteria 3100
142 Ga0395901_0199731 3300038443 Bacteria 2096
143 Ga0400483_044762 3300039062 Bacteria 1104
144 Ga0400483_188268 3300039062 Bacteria 1882
145 Ga0439438_001222 3300041405 Bacteria 11398
146 Ga0439447_009478 3300041407 Bacteria 2947
147 Ga0439466_0008929 3300041411 Bacteria 3768
148 Ga0439466_0016051 3300041411 Bacteria 2711
149 Ga0439465_0009838 3300041413 Bacteria 3012
150 Ga0451835_0189026 3300041492 Bacteria 1202
151 Ga0451835_0889751 3300041492 Bacteria 2335
152 Ga0451837_1430986 3300041494 Bacteria 2695
153 Ga0451839_1280463 3300041496 Bacteria 725
154 Ga0451841_0648979 3300041498 Bacteria 851
155 Ga0451845_0509085 3300041501 Bacteria 1645
156 Ga0451847_0054784 3300041503 Bacteria 2806
157 Ga0451849_0219018 3300041505 Bacteria 3632
158 Ga0451851_0579564 3300041507 Bacteria 3963
159 Ga0451853_0692887 3300041512 Bacteria 3567
160 Ga0439442_009557 3300042002 Bacteria 1961
161 Ga0439449_0089202 3300042007 Bacteria 1138
162 Ga0439449_0148502 3300042007 Bacteria 874
163 Ga0439451_010933 3300042009 Bacteria 1830
164 Ga0439452_000072 3300042010 Bacteria 88574
165 Ga0439440_0002240 3300042993 Bacteria 3624
166 Ga0466963_0250889 3300044694 Bacteria 1242
167 Ga0466963_0302111 3300044694 Bacteria 1126
168 Ga0466957_0000424 3300044842 Bacteria 20789
169 Ga0466960_0027509 3300044901 Bacteria 2595
170 Ga0495627_003113 3300046453 Bacteria 7516
171 Ga0495592_0049789 3300046454 Bacteria 3114
172 Ga0495591_001339 3300046458 Bacteria 15482
173 Ga0495591_001915 3300046458 Bacteria 12215
174 Ga0495638_0000337 3300046460 Bacteria 59070
175 Ga0495638_0032044 3300046460 Bacteria 3372
176 Ga0495638_0060974 3300046460 Bacteria 2332
177 Ga0495651_0028015 3300046462 Bacteria 4391
178 Ga0495653_0006986 3300046463 Bacteria 9265
179 Ga0495653_0061261 3300046463 Bacteria 2847
180 Ga0495653_0068971 3300046463 Bacteria 2650
181 Ga0495582_0002108 3300046473 Bacteria 11126
182 Ga0495605_0012525 3300046474 Bacteria 4702
183 Ga0495639_0006288 3300046475 Bacteria 5101
184 Ga0495639_0142014 3300046475 Bacteria 1155
185 Ga0495664_0005994 3300046477 Bacteria 6701
186 Ga0495585_0000012 3300046492 Bacteria 203064
187 Ga0495585_0031944 3300046492 Bacteria 2985
188 Ga0495594_0140572 3300046499 Bacteria 1369
189 Ga0495607_0017376 3300046501 Bacteria 4620
190 Ga0495583_0002549 3300046506 Bacteria 15393
191 Ga0495606_0002150 3300046507 Bacteria 23749
192 Ga0495610_0001335 3300046512 Bacteria 21880
193 Ga0495610_0002873 3300046512 Bacteria 13984
194 Ga0495610_0041811 3300046512 Bacteria 2298
195 Ga0495610_0061814 3300046512 Bacteria 1778
196 Ga0495616_0006862 3300046513 Bacteria 6858
197 Ga0495616_0049818 3300046513 Bacteria 2097
198 Ga0495620_0031262 3300046515 Bacteria 2441
199 Ga0495630_0003330 3300046517 Bacteria 11191
200 Ga0495630_0005890 3300046517 Bacteria 8668
201 Ga0495630_0013664 3300046517 Bacteria 5902
202 Ga0495630_0025235 3300046517 Bacteria 4394
203 Ga0495632_0002236 3300046519 Bacteria 14936
204 Ga0495637_0000104 3300046520 Bacteria 62838
205 Ga0495637_0006512 3300046520 Bacteria 5853
206 Ga0495648_0007964 3300046524 Bacteria 8404
207 Ga0495648_0012641 3300046524 Bacteria 6278
208 Ga0495666_0000923 3300046526 Bacteria 13825
209 Ga0495666_0013659 3300046526 Bacteria 4049
210 Ga0495666_0073246 3300046526 Bacteria 1625
211 Ga0495654_0003761 3300046530 Bacteria 9192
212 Ga0495665_0029429 3300046531 Bacteria 2943
213 Ga0495665_0048337 3300046531 Bacteria 2255
214 Ga0495586_0002053 3300046535 Bacteria 10938
215 Ga0495587_0001330 3300046536 Bacteria 16412
216 Ga0495597_0002064 3300046542 Bacteria 13397
217 Ga0495645_0056587 3300046543 Bacteria 2847
218 Ga0495645_0236758 3300046543 Bacteria 1220
219 Ga0495622_0007978 3300046557 Bacteria 4908
220 Ga0495622_0054733 3300046557 Bacteria 1851
221 Ga0495656_0004721 3300046615 Bacteria 4683
222 Ga0495634_0001217 3300046642 Bacteria 23743
223 Ga0495634_0136118 3300046642 Bacteria 1563
224 Ga0495625_0001537 3300046660 Bacteria 27559
225 Ga0495625_0005428 3300046660 Bacteria 11638
226 Ga0495635_0000478 3300046663 Bacteria 25287
227 Ga0495659_0000022 3300046664 Bacteria 72378
228 Ga0495661_0081415 3300046665 Bacteria 1866
229 Ga0495661_0085935 3300046665 Bacteria 1802
230 Ga0495588_0027462 3300046674 Bacteria 2844
231 Ga0495588_0041330 3300046674 Bacteria 2354
232 Ga0495657_0015936 3300046675 Bacteria 5486
233 Ga0495599_0120963 3300046678 Bacteria 1628
234 Ga0495599_0348035 3300046678 Bacteria 889
235 Ga0495623_0003127 3300046679 Bacteria 10909
236 Ga0495623_0005374 3300046679 Bacteria 8381
237 Ga0495646_0000376 3300046680 Bacteria 23282
238 Ga0495646_0003831 3300046680 Bacteria 9396
239 Ga0495613_0002368 3300046689 Bacteria 14285
240 Ga0495670_0025008 3300046691 Bacteria 2953
241 Ga0495670_0038162 3300046691 Bacteria 2395
242 Ga0495671_0052308 3300046692 Bacteria 2030
243 Ga0495649_0000036 3300046694 Bacteria 134537
244 Ga0495649_0000202 3300046694 Bacteria 52910
245 Ga0495649_0001349 3300046694 Bacteria 18658
246 Ga0495649_0003058 3300046694 Bacteria 11456
247 Ga0495649_0022900 3300046694 Bacteria 3493
248 Ga0495589_0000711 3300046794 Bacteria 21577
249 Ga0495589_0001234 3300046794 Bacteria 15147
250 Ga0495589_0098260 3300046794 Bacteria 1418
251 Ga0495600_0014597 3300046809 Bacteria 4951
252 Ga0495660_0003169 3300046810 Bacteria 10245
253 Ga0495581_0031122 3300047315 Bacteria 3092
254 Ga0495604_0001884 3300047317 Bacteria 17046
255 Ga0495604_0009365 3300047317 Bacteria 7747
256 Ga0495604_0026289 3300047317 Bacteria 4634
257 Ga0495674_0001838 3300047319 Bacteria 20925
258 Ga0495672_0022949 3300047320 Bacteria 4048
259 Ga0495680_0000645 3300047322 Bacteria 39120
260 Ga0495680_0003589 3300047322 Bacteria 15193
261 Ga0495680_0016115 3300047322 Bacteria 6426
262 Ga0495680_0058939 3300047322 Bacteria 2965
263 Ga0495680_0116848 3300047322 Bacteria 1972
264 Ga0495683_0002684 3300047323 Bacteria 10614
265 Ga0495687_000822 3300047443 Bacteria 33205
266 Ga0495687_063793 3300047443 Bacteria 1507
267 Ga0495675_0001391 3300047444 Bacteria 14679
268 Ga0495675_0010086 3300047444 Bacteria 5893
269 Ga0495675_0098344 3300047444 Bacteria 1833
270 Ga0495675_0110180 3300047444 Bacteria 1719
271 Ga0495681_0091994 3300047470 Bacteria 1337
272 Ga0495684_0027342 3300047471 Bacteria 4379
273 Ga0495686_0000556 3300047472 Bacteria 53309
274 Ga0495686_0001910 3300047472 Bacteria 20811
275 Ga0495686_0150917 3300047472 Bacteria 1364
276 Ga0495593_0002125 3300047673 Bacteria 11847
277 Ga0495593_0016068 3300047673 Bacteria 4225
278 Ga0495593_0038118 3300047673 Bacteria 2597
279 Ga0495593_0102802 3300047673 Bacteria 1464
280 Ga0495593_0155285 3300047673 Bacteria 1156
281 Ga0495602_0056287 3300048088 Bacteria 3459
282 Ga0496104_0706132 3300048907 Bacteria 916
283 Ga0496105_0018615 3300048908 Bacteria 5589
284 Ga0496106_0014056 3300048909 Bacteria 5915
285 Ga0496107_0074350 3300048910 Bacteria 2472
286 Ga0496112_0013355 3300048915 Bacteria 7581
287 Ga0496113_0020262 3300048916 Bacteria 4673
288 Ga0496116_0001588 3300048919 Bacteria 25003
289 Ga0496116_0033242 3300048919 Bacteria 3662
290 Ga0496117_0014535 3300048920 Bacteria 6775
291 Ga0496118_0025629 3300048921 Bacteria 5048
292 Ga0496118_0086251 3300048921 Bacteria 2182
293 Ga0496119_0035847 3300048922 Bacteria 3244
294 Ga0496121_0009631 3300048924 Bacteria 11067
295 Ga0496121_0023127 3300048924 Bacteria 5999
296 Ga0496122_0000244 3300048925 Bacteria 122107
297 Ga0496122_0001098 3300048925 Bacteria 46802
298 Ga0496122_0006544 3300048925 Bacteria 13325
299 Ga0496123_0000201 3300048926 Bacteria 121915
300 Ga0496123_0018936 3300048926 Bacteria 5446
301 Ga0496123_0184371 3300048926 Bacteria 1086
302 Ga0496124_0064843 3300048927 Bacteria 3048
303 Ga0496124_0133783 3300048927 Bacteria 1966
304 Ga0496125_0000083 3300048928 Bacteria 227168
305 Ga0496125_0048058 3300048928 Bacteria 3562
306 Ga0496126_0010318 3300048929 Bacteria 9806
307 Ga0501031_0443822 3300049568 Bacteria 838
308 Ga0501032_0143226 3300049569 Bacteria 1574
309 Ga0501032_0212619 3300049569 Bacteria 1260
310 Ga0501033_0224251 3300049570 Bacteria 1337
311 Ga0501034_0000944 3300049571 Bacteria 42142
312 Ga0501034_0116791 3300049571 Bacteria 2656
313 Ga0501034_0310564 3300049571 Bacteria 1511
314 Ga0501034_0318065 3300049571 Bacteria 1490
315 Ga0501034_0571227 3300049571 Bacteria 1038
316 Ga0501038_0199667 3300049574 Bacteria 1606
317 Ga0501038_0211984 3300049574 Bacteria 1549
318 Ga0501038_0330146 3300049574 Bacteria 1191
319 Ga0501039_0739816 3300049575 Bacteria 768
320 Ga0501043_0056013 3300049579 Bacteria 3097
321 Ga0501047_0074320 3300049581 Bacteria 3272
322 Ga0501074_0526929 3300049590 Bacteria 837
323 Ga0501035_0021190 3300049822 Bacteria 5974
324 Ga0501045_0297943 3300049824 Bacteria 1200
325 nmdc:mga03683_115414_c1 3300050489 Bacteria 1191
326 nmdc:mga03n38_52176_c1 3300050490 Bacteria 1829
327 nmdc:mga0yw44_18797_c1 3300050492 Bacteria 3795
328 nmdc:mga0k408_57878_c1 3300050493 Bacteria 2251
329 nmdc:mga07m45_5402_c1 3300050496 Bacteria 6355
330 Ga0500654_174895 3300053099 Bacteria 697
331 Ga0500608_115247 3300053122 Bacteria 1227
332 Ga0500568_0024236 3300053139 Bacteria 2572
333 Ga0500636_0000095 3300053177 Bacteria 44876
334 2508731924 2508501050 Bacteria 9633614
335 2509391277 2509276021 Bacteria 7634384
336 2509445463 2509276033 Bacteria 7180565
337 2510892559 2510461076 Bacteria 8618824
338 2511365551 2511231022 Bacteria 6719296
339 2511499490 2511231052 Bacteria 6974333
340 2512528875 2512047086 Bacteria 6850303
341 2513566011 2513237083 Bacteria 8410967
342 2513568317 2513237084 Bacteria 7231967
343 2513580956 2513237085 Bacteria 7695351
344 2513586236 2513237086 Bacteria 7265287
345 2513597402 2513237088 Bacteria 6927906
346 2513634777 2513237093 Bacteria 7545552
347 2513924102 2513237146 Bacteria 7166346
348 2514018568 2513237162 Bacteria 7468464
349 2514050467 2513237166 Bacteria 10373764
350 2516018730 2515154189 Bacteria 9629850
351 2527080879 2526164713 Bacteria 6780608
352 2551676119 2551306084 Bacteria 8942552
353 2551683926 2551306085 Bacteria 7347181
354 2551693256 2551306086 Bacteria 6843938
355 2551704877 2551306087 Bacteria 7351905
356 2551721491 2551306090 Bacteria 7953713
357 2551732173 2551306092 Bacteria 6992595
358 2551739681 2551306093 Bacteria 7064773
359 2558906782 2558860112 Bacteria 9931328
360 2585541717 2585427528 Bacteria 6842387
361 2585840064 2585427593 Bacteria 7141551
362 2599416148 2599185170 Bacteria 7295545
363 2617384087 2617270742 Bacteria 6808054
364 2644200483 2643221636 Bacteria 6583769
365 2694636653 2693429784 Bacteria 7241525
366 2738824343 2738541296 Bacteria 7285013
367 2738836726 2738541298 Bacteria 7286732
368 2738878257 2738541306 Bacteria 7284992
369 2739036331 2738541333 Bacteria 7106503
370 2739189949 2738543002 Bacteria 7284546
371 2739224850 2738543008 Bacteria 7282815
372 2753566914 2751185846 Bacteria 7242164
373 2756676618 2756170246 Bacteria 7451806
374 2774120049 2773857670 Bacteria 6407454
375 2774872470 2773857925 Bacteria 6472445
376 2776266898 2775506902 Bacteria 6208009
377 2776267805 2775506902 Bacteria 6208009
378 2776281776 2775506904 Bacteria 5954060
379 2776283134 2775506904 Bacteria 5954060
380 2778176605 2775507266 Bacteria 7392367
381 2784312020 2784132072 Bacteria 6596533
382 2792580021 2791355082 Bacteria 5973319
383 2792642174 2791355094 Bacteria 7011481
384 2792833954 2791355137 Bacteria 9654227
385 2793317412 2791355259 Bacteria 7254731
386 2793362354 2791355266 Bacteria 7116587
387 2793365161 2791355267 Bacteria 7222458
388 2806046434 2802429633 Bacteria 7341974
389 2806053030 2802429634 Bacteria 7083200
390 2806059762 2802429635 Bacteria 7650140
391 2806068500 2802429636 Bacteria 7597525
392 2806074922 2802429637 Bacteria 7067217
393 2808828809 2808606357 Bacteria 4466944
394 2834580304 2834578030 Bacteria 3530182
395 2838036269 2838035591 Bacteria 7166484
396 2841868598 2841864319 Bacteria 6742987
397 2842342547 2842341865 Bacteria 7003929
398 2842365680 2842363717 Bacteria 6844742
399 2842487388 2842482326 Bacteria 7212537
400 2844166080 2844163670 Bacteria 7266046
401 2847689001 2847686936 Bacteria 6278406
402 2847689007 2847686936 Bacteria 6278406
403 2852392846 2852387548 Bacteria 8025568
404 2855830280 2855825444 Bacteria 6785811
405 2855845942 2855839649 Bacteria 7135830
406 2855846326 2855839649 Bacteria 7135830
407 2855876408 2855872281 Bacteria 6964271
408 2856343094 2856342000 Bacteria 7176905
409 2856346606 2856342000 Bacteria 7176905
410 2869240480 2869234852 Bacteria 6654993
411 2869282153 2869278585 Bacteria 7077053
412 2874111347 2874109183 Bacteria 6517025
413 2874140419 2874139085 Bacteria 7021506
414 2878733905 2878730984 Bacteria 6380721
415 2881159939 2881155292 Bacteria 6461656
416 2881159944 2881155292 Bacteria 6461656
417 2881867552 2881861095 Bacteria 7128710
418 2882460181 2882456835 Bacteria 6863978
419 2882915282 2882912400 Bacteria 6801539
420 2883090168 2883087390 Bacteria 9532701
421 2885271008 2885270888 Bacteria 9831543
422 2885271241 2885270888 Bacteria 9831543
423 2885271618 2885270888 Bacteria 9831543
424 2885272286 2885270888 Bacteria 9831543
425 2885277000 2885270888 Bacteria 9831543
426 2888337327 2888337043 Bacteria 6629336
427 2888337333 2888337043 Bacteria 6629336
428 2891377988 2891373044 Bacteria 5202277
429 2900643567 2900634093 Bacteria 10263517
430 2902689963 2902682994 Bacteria 8951596
431 2903514613 2903513507 Bacteria 6344008
432 2904623844 2904615490 Bacteria 10047340
433 2908673484 2908669403 Bacteria 5740494
434 2913301678 2913295892 Bacteria 6333755
435 2915995861 2915993759 Bacteria 7016183
436 2916008943 2916007675 Bacteria 6898660
437 2916017689 2916014648 Bacteria 6946486
438 2916031352 2916028427 Bacteria 6748433
439 2916058091 2916055098 Bacteria 6758838
440 2916071346 2916068649 Bacteria 6943657
441 2921238490 2921237296 Bacteria 6876710
442 2921266818 2921263974 Bacteria 6864552
443 2921293911 2921289301 Bacteria 7316391
444 2921298370 2921296804 Bacteria 7176999
445 2924155602 2924150972 Bacteria 7169444
446 2924162936 2924158325 Bacteria 7188855
447 2924169607 2924165586 Bacteria 7260590
448 2924175586 2924172951 Bacteria 6749356
449 2924190048 2924186466 Bacteria 6876637
450 2924220392 2924214083 Bacteria 7080103
451 2924224557 2924221636 Bacteria 7113495
452 2924233304 2924228884 Bacteria 6633132
453 2924721020 2924718760 Bacteria 6331356
454 2924731528 2924726620 Bacteria 6271473
455 2924758162 2924754689 Bacteria 6774424
456 2924788754 2924784321 Bacteria 7416538
457 2928161094 2928157003 Bacteria 7522202
458 2936375345 2936375103 Bacteria 6652732
459 2937006551 2937002841 Bacteria 6934057
460 2937043088 2937042894 Bacteria 6741576
461 2937055863 2937049772 Bacteria 6757901
462 2937061252 2937056579 Bacteria 7107896
463 2937072522 2937071275 Bacteria 6984483
464 2937096252 2937091812 Bacteria 6979387
465 2937103870 2937098957 Bacteria 7249374
466 2937132804 2937126314 Bacteria 6771275
467 2937845022 2937843397 Bacteria 5256375
468 2937880654 2937877337 Bacteria 7246526
469 2957429696 2957422303 Bacteria 7172205
470 2957436223 2957430029 Bacteria 7022557
471 2957458299 2957457609 Bacteria 6967680
472 2957474970 2957471148 Bacteria 6797643
473 2957480827 2957478035 Bacteria 6756658
474 2957485188 2957484790 Bacteria 6703082
475 2957503151 2957498199 Bacteria 7126688
476 2957509527 2957505466 Bacteria 7253085
477 2958037950 2958034702 Bacteria 6989922
478 2958049076 2958041894 Bacteria 13082850
479 2958087786 2958084443 Bacteria 7312792
480 2958099488 2958092219 Bacteria 6861151
481 2960608198 2960603979 Bacteria 6898737
482 2960627500 2960624210 Bacteria 6875384
483 2960644970 2960637947 Bacteria 7296468
484 2960649326 2960645483 Bacteria 7211087
485 2960655569 2960652885 Bacteria 7083688
486 2964612649 2964607997 Bacteria 7101408
487 2964633441 2964628898 Bacteria 7083044
488 2964654227 2964649959 Bacteria 6675118
489 2964661361 2964656573 Bacteria 7100150
490 2964683977 2964678106 Bacteria 6792020
491 2964726374 2964719344 Bacteria 7286602
492 2965067827 2965062239 Bacteria 7412989
493 2967683575 2967678726 Bacteria 7264382
494 2967695849 2967693043 Bacteria 6804451
495 2967707908 2967706974 Bacteria 7186053
496 2967719135 2967714385 Bacteria 7000047
497 2967725613 2967721400 Bacteria 7073753
498 2967739089 2967735183 Bacteria 6827012
499 2967763049 2967762386 Bacteria 6923502
500 2967777427 2967775926 Bacteria 6738189
501 2968129408 2968128360 Bacteria 6270294
502 2970026308 2970019648 Bacteria 7072033
503 2970043098 2970040964 Bacteria 6731123
504 2970047756 2970047711 Bacteria 7088379
505 2970058129 2970054988 Bacteria 6611507
506 2970066055 2970061556 Bacteria 7099761
507 2970092963 2970088815 Bacteria 6933825
508 2970114867 2970109326 Bacteria 6863976
509 2970117481 2970116247 Bacteria 6501857
510 2970132343 2970129317 Bacteria 6806560
511 2970139470 2970136068 Bacteria 7207982
512 2970150934 2970149975 Bacteria 6779706
513 2970168036 2970164137 Bacteria 6861252
514 2970174606 2970170962 Bacteria 6876229
515 2970189105 2970184632 Bacteria 7054431
516 2970195503 2970191845 Bacteria 7032787
517 2970596758 2970593180 Bacteria 7073582
518 2977542123 2977537788 Bacteria 6929320
519 2977556609 2977551784 Bacteria 7125765
520 2977575836 2977572785 Bacteria 6763888
521 2977581906 2977579622 Bacteria 6772100
522 2981991232 2981990288 Bacteria 7590678
523 2989350260 2989349275 Bacteria 6349068
524 3004236369 3004232784 Bacteria 6662140
525 3004294094 3004289098 Bacteria 6135450
526 3007423904 3007419365 Bacteria 7026924
527 8002286900 8002285264 Bacteria 6717907
528 8003962178 8003955200 Bacteria 8601927
529 8004711842 8004703790 Bacteria 8006957
530 8005260591 8005258706 Bacteria 6184835
531 8005563508 8005556819 Bacteria 6908598
532 8005565287 8005563573 Bacteria 7153261
533 8005572439 8005570704 Bacteria 6957481
534 8018168680 8018163183 Bacteria 7277977
535 8020943672 8020938398 Bacteria 7472757
536 8020953688 8020953355 Bacteria 7439080
537 8039103045 8039098773 Bacteria 6602928
538 8055273567 8055266321 Bacteria 7999742
539 8056139940 8056137416 Bacteria 6147080
540 8056157472 8056155041 Bacteria 6486948
541 8056182625 8056177738 Bacteria 6748268
542 8056377670 8056375014 Bacteria 7006639
543 Ga0395899_0008512
544 MRS2a_Contig_2265
545 JGI25159J45721_1000080
546 JGI25151J46595_10003218
547 JGI25153J46596_10004438
548 rootH2_10214548
549 JGI25160J50197_1000160
550 JGI25160J50197_1001380
551 JGI25161J50226_1000644
552 JGI25161J50226_1007165
553 Ga0055526_1000913
554 Ga0055526_1001250
555 Ga0055526_1001730
556 Ga0055524_1001595
557 Ga0055524_1034056
558 Ga0055536_1010628
559 Ga0055528_1000496
560 Ga0055528_1008574
561 Ga0055540_1000077
562 Ga0055540_1000095
563 Ga0055540_1008583
564 Ga0055531_10003881
565 Ga0058692_1000056
566 Ga0055543_1000410
567 Ga0055543_1000625
568 Ga0065165_1000534
569 Ga0065165_1011591
570 Ga0065714_10002449
571 Ga0065714_10002712
572 Ga0070658_10049106
573 Ga0070683_100217589
574 Ga0070660_100000020
575 Ga0070659_100000047
576 Ga0070659_100271906
577 Ga0070685_10345784
578 Ga0068856_100369980
579 Ga0068858_100275034
580 Ga0081455_10145112
581 Ga0081538_10004588
582 Ga0075365_10026094
583 Ga0075363_100089546
584 Ga0075432_10000599
585 Ga0075362_10120493
586 Ga0075369_10034998
587 Ga0075366_10013907
588 Ga0079104_1001104
589 Ga0105251_10000038
590 Ga0105251_10010946
591 Ga0105244_10002923
592 Ga0105244_10053974
593 Ga0105250_10004934
594 Ga0105247_10662791
595 Ga0105243_10068349
596 Ga0105242_10178827
597 Ga0105238_10009567
598 Ga0123341_1000082
599 Ga0105239_10005879
600 Ga0105239_10128292
601 Ga0157373_10211748
602 Ga0157370_10022288
603 Ga0157369_10138693
604 Ga0157372_11394652
605 Ga0182008_10000970
606 Ga0182006_1002548
607 Ga0182007_10000152
608 Ga0182005_1000181
609 Ga0209436_100101
610 Ga0207425_1002551
611 Ga0209148_1000331
612 Ga0209759_1020394
613 Ga0209129_1000917
614 Ga0209129_1024250
615 Ga0209455_1000371
616 Ga0209673_1000294
617 Ga0209673_1000968
618 Ga0209130_1000309
619 Ga0209130_1023894
620 Ga0209676_1002316
621 Ga0209025_1000260
622 Ga0209025_1001911
623 Ga0209025_1022425
624 Ga0209564_1000341
625 Ga0209564_1001129
626 Ga0209758_1001982
627 Ga0209758_1003817
628 Ga0209050_1010756
629 Ga0209050_1011672
630 Ga0209256_1000719
631 Ga0209256_1003376
632 Ga0207426_1000503
633 Ga0207426_1001199
634 Ga0209051_1000027
635 Ga0209051_1003762
636 Ga0209051_1041767
637 Ga0209257_1000599
638 Ga0209257_1002580
639 Ga0207696_1000018
640 Ga0207655_1001322
641 Ga0207655_1011199
642 Ga0207713_1000185
643 Ga0207713_1002035
644 Ga0207688_10056684
645 Ga0207705_10036303
646 Ga0207657_10000390
647 Ga0207649_10384538
648 Ga0207690_10000037
649 Ga0207690_10225952
650 Ga0207702_10317460
651 Ga0209281_1000778
652 Ga0209371_1000121
653 Ga0207428_10002525
654 Ga0268256_1000107
655 Ga0307408_100355446
656 Ga0307405_10029046
657 Ga0307405_10141687
658 Ga0307413_10027454
659 Ga0307413_10055294
660 Ga0307410_10145813
661 Ga0307410_10411796
662 Ga0307406_10016078
663 Ga0307406_10093425
664 Ga0307406_10425518
665 Ga0307407_10020138
666 Ga0307409_100113298
667 Ga0307409_100382540
668 Ga0307416_100007287
669 Ga0307415_100129578
670 Ga0373937_0197626
671 Ga0373925_0052189
672 Ga0395899_0002826
673 Ga0395900_0008030
674 Ga0395900_0109630
675 Ga0395898_0003468
676 Ga0395898_0010331
677 Ga0395898_0147701
678 Ga0395905_0000024
679 Ga0395905_0001801
680 Ga0395905_0080861
681 Ga0395901_0000434
682 Ga0395901_0027622
683 Ga0395901_0096386
684 Ga0395901_0199731
685 Ga0400483_044762
686 Ga0400483_188268
687 Ga0439438_001222
688 Ga0439447_009478
689 Ga0439466_0008929
690 Ga0439466_0016051
691 Ga0439465_0009838
692 Ga0451835_0189026
693 Ga0451835_0889751
694 Ga0451837_1430986
695 Ga0451839_1280463
696 Ga0451841_0648979
697 Ga0451845_0509085
698 Ga0451847_0054784
699 Ga0451849_0219018
700 Ga0451851_0579564
701 Ga0451853_0692887
702 Ga0439442_009557
703 Ga0439449_0089202
704 Ga0439449_0148502
705 Ga0439451_010933
706 Ga0439452_000072
707 Ga0439440_0002240
708 Ga0466963_0250889
709 Ga0466963_0302111
710 Ga0466957_0000424
711 Ga0466960_0027509
712 Ga0495627_003113
713 Ga0495592_0049789
714 Ga0495591_001339
715 Ga0495591_001915
716 Ga0495638_0000337
717 Ga0495638_0032044
718 Ga0495638_0060974
719 Ga0495651_0028015
720 Ga0495653_0006986
721 Ga0495653_0061261
722 Ga0495653_0068971
723 Ga0495582_0002108
724 Ga0495605_0012525
725 Ga0495639_0006288
726 Ga0495639_0142014
727 Ga0495664_0005994
728 Ga0495585_0000012
729 Ga0495585_0031944
730 Ga0495594_0140572
731 Ga0495607_0017376
732 Ga0495583_0002549
733 Ga0495606_0002150
734 Ga0495610_0001335
735 Ga0495610_0002873
736 Ga0495610_0041811
737 Ga0495610_0061814
738 Ga0495616_0006862
739 Ga0495616_0049818
740 Ga0495620_0031262
741 Ga0495630_0003330
742 Ga0495630_0005890
743 Ga0495630_0013664
744 Ga0495630_0025235
745 Ga0495632_0002236
746 Ga0495637_0000104
747 Ga0495637_0006512
748 Ga0495648_0007964
749 Ga0495648_0012641
750 Ga0495666_0000923
751 Ga0495666_0013659
752 Ga0495666_0073246
753 Ga0495654_0003761
754 Ga0495665_0029429
755 Ga0495665_0048337
756 Ga0495586_0002053
757 Ga0495587_0001330
758 Ga0495597_0002064
759 Ga0495645_0056587
760 Ga0495645_0236758
761 Ga0495622_0007978
762 Ga0495622_0054733
763 Ga0495656_0004721
764 Ga0495634_0001217
765 Ga0495634_0136118
766 Ga0495625_0001537
767 Ga0495625_0005428
768 Ga0495635_0000478
769 Ga0495659_0000022
770 Ga0495661_0081415
771 Ga0495661_0085935
772 Ga0495588_0027462
773 Ga0495588_0041330
774 Ga0495657_0015936
775 Ga0495599_0120963
776 Ga0495599_0348035
777 Ga0495623_0003127
778 Ga0495623_0005374
779 Ga0495646_0000376
780 Ga0495646_0003831
781 Ga0495613_0002368
782 Ga0495670_0025008
783 Ga0495670_0038162
784 Ga0495671_0052308
785 Ga0495649_0000036
786 Ga0495649_0000202
787 Ga0495649_0001349
788 Ga0495649_0003058
789 Ga0495649_0022900
790 Ga0495589_0000711
791 Ga0495589_0001234
792 Ga0495589_0098260
793 Ga0495600_0014597
794 Ga0495660_0003169
795 Ga0495581_0031122
796 Ga0495604_0001884
797 Ga0495604_0009365
798 Ga0495604_0026289
799 Ga0495674_0001838
800 Ga0495672_0022949
801 Ga0495680_0000645
802 Ga0495680_0003589
803 Ga0495680_0016115
804 Ga0495680_0058939
805 Ga0495680_0116848
806 Ga0495683_0002684
807 Ga0495687_000822
808 Ga0495687_063793
809 Ga0495675_0001391
810 Ga0495675_0010086
811 Ga0495675_0098344
812 Ga0495675_0110180
813 Ga0495681_0091994
814 Ga0495684_0027342
815 Ga0495686_0000556
816 Ga0495686_0001910
817 Ga0495686_0150917
818 Ga0495593_0002125
819 Ga0495593_0016068
820 Ga0495593_0038118
821 Ga0495593_0102802
822 Ga0495593_0155285
823 Ga0495602_0056287
824 Ga0496104_0706132
825 Ga0496105_0018615
826 Ga0496106_0014056
827 Ga0496107_0074350
828 Ga0496112_0013355
829 Ga0496113_0020262
830 Ga0496116_0001588
831 Ga0496116_0033242
832 Ga0496117_0014535
833 Ga0496118_0025629
834 Ga0496118_0086251
835 Ga0496119_0035847
836 Ga0496121_0009631
837 Ga0496121_0023127
838 Ga0496122_0000244
839 Ga0496122_0001098
840 Ga0496122_0006544
841 Ga0496123_0000201
842 Ga0496123_0018936
843 Ga0496123_0184371
844 Ga0496124_0064843
845 Ga0496124_0133783
846 Ga0496125_0000083
847 Ga0496125_0048058
848 Ga0496126_0010318
849 Ga0501031_0443822
850 Ga0501032_0143226
851 Ga0501032_0212619
852 Ga0501033_0224251
853 Ga0501034_0000944
854 Ga0501034_0116791
855 Ga0501034_0310564
856 Ga0501034_0318065
857 Ga0501034_0571227
858 Ga0501038_0199667
859 Ga0501038_0211984
860 Ga0501038_0330146
861 Ga0501039_0739816
862 Ga0501043_0056013
863 Ga0501047_0074320
864 Ga0501074_0526929
865 Ga0501035_0021190
866 Ga0501045_0297943
867 nmdc:mga03683_115414_c1
868 nmdc:mga03n38_52176_c1
869 nmdc:mga0yw44_18797_c1
870 nmdc:mga0k408_57878_c1
871 nmdc:mga07m45_5402_c1
872 Ga0500654_174895
873 Ga0500608_115247
874 Ga0500568_0024236
875 Ga0500636_0000095
876 2508731924
877 2509391277
878 2509445463
879 2510892559
880 2511365551
881 2511499490
882 2512528875
883 2513566011
884 2513568317
885 2513580956
886 2513586236
887 2513597402
888 2513634777
889 2513924102
890 2514018568
891 2514050467
892 2516018730
893 2527080879
894 2551676119
895 2551683926
896 2551693256
897 2551704877
898 2551721491
899 2551732173
900 2551739681
901 2558906782
902 2585541717
903 2585840064
904 2599416148
905 2617384087
906 2644200483
907 2694636653
908 2738824343
909 2738836726
910 2738878257
911 2739036331
912 2739189949
913 2739224850
914 2753566914
915 2756676618
916 2774120049
917 2774872470
918 2776266898
919 2776267805
920 2776281776
921 2776283134
922 2778176605
923 2784312020
924 2792580021
925 2792642174
926 2792833954
927 2793317412
928 2793362354
929 2793365161
930 2806046434
931 2806053030
932 2806059762
933 2806068500
934 2806074922
935 2808828809
936 2834580304
937 2838036269
938 2841868598
939 2842342547
940 2842365680
941 2842487388
942 2844166080
943 2847689001
944 2847689007
945 2852392846
946 2855830280
947 2855845942
948 2855846326
949 2855876408
950 2856343094
951 2856346606
952 2869240480
953 2869282153
954 2874111347
955 2874140419
956 2878733905
957 2881159939
958 2881159944
959 2881867552
960 2882460181
961 2882915282
962 2883090168
963 2885271008
964 2885271241
965 2885271618
966 2885272286
967 2885277000
968 2888337327
969 2888337333
970 2891377988
971 2900643567
972 2902689963
973 2903514613
974 2904623844
975 2908673484
976 2913301678
977 2915995861
978 2916008943
979 2916017689
980 2916031352
981 2916058091
982 2916071346
983 2921238490
984 2921266818
985 2921293911
986 2921298370
987 2924155602
988 2924162936
989 2924169607
990 2924175586
991 2924190048
992 2924220392
993 2924224557
994 2924233304
995 2924721020
996 2924731528
997 2924758162
998 2924788754
999 2928161094
1000 2936375345
1001 2937006551
1002 2937043088
1003 2937055863
1004 2937061252
1005 2937072522
1006 2937096252
1007 2937103870
1008 2937132804
1009 2937845022
1010 2937880654
1011 2957429696
1012 2957436223
1013 2957458299
1014 2957474970
1015 2957480827
1016 2957485188
1017 2957503151
1018 2957509527
1019 2958037950
1020 2958049076
1021 2958087786
1022 2958099488
1023 2960608198
1024 2960627500
1025 2960644970
1026 2960649326
1027 2960655569
1028 2964612649
1029 2964633441
1030 2964654227
1031 2964661361
1032 2964683977
1033 2964726374
1034 2965067827
1035 2967683575
1036 2967695849
1037 2967707908
1038 2967719135
1039 2967725613
1040 2967739089
1041 2967763049
1042 2967777427
1043 2968129408
1044 2970026308
1045 2970043098
1046 2970047756
1047 2970058129
1048 2970066055
1049 2970092963
1050 2970114867
1051 2970117481
1052 2970132343
1053 2970139470
1054 2970150934
1055 2970168036
1056 2970174606
1057 2970189105
1058 2970195503
1059 2970596758
1060 2977542123
1061 2977556609
1062 2977575836
1063 2977581906
1064 2981991232
1065 2989350260
1066 3004236369
1067 3004294094
1068 3007423904
1069 8002286900
1070 8003962178
1071 8004711842
1072 8005260591
1073 8005563508
1074 8005565287
1075 8005572439
1076 8018168680
1077 8020943672
1078 8020953688
1079 8039103045
1080 8055273567
1081 8056139940
1082 8056157472
1083 8056182625
1084 8056377670

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

32

219

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8175 1 210
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8007 1 210
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.76 13 201
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.7359 14 205
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7315 1 204
ID Description Score Start End Superfamily
af_P45768_144_364_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8385 18 211 1.10.3720.10
af_P0AEU3_9_230_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8358 21 212 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8308 8 215 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8258 1 211 1.10.3720.10
af_P0AE34_6_232_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8134 15 211 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A522RPC8-F1-model_v4 Amino acid ABC transporter permease 0.917 2 216 GO:0006865
GO:0022857
GO:0043190
AF-A0A522RPC8-F1-model_v4 Amino acid ABC transporter permease 0.9051 2 216 GO:0006865
GO:0022857
GO:0043190
AF-A0A1Y0L8V6-F1-model_v4 Amino acid ABC transporter permease 0.8999 1 215 GO:0006865
GO:0022857
GO:0043190
AF-A0A366DZI9-F1-model_v4 Polar amino acid transport system permease protein 0.8992 1 211 GO:0006865
GO:0022857
GO:0043190
AF-A0A7C9RBR3-F1-model_v4 Amino acid ABC transporter permease 0.8981 2 216 GO:0006865
GO:0022857
GO:0043190

Map