F461547

General Info

Members Datasets Scaffolds Average Seq Length
542 257 1084 132

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0062457|Ga0501070_0062457_2060_2542
Length 160
Sequence MLRATACVVARGRFGLGRQLQRFHFRIAAMADTRRPLSPHLQIYKWQVQMVTSILHRATGIALAVGTLLVVWGLLSLAAGEAAFDQFKICIGSVPGMILLAGWSWALFYHLCNGIRHLLQDTGAGYAIPQFVRSSWLSVVVSLVLVAIVWACVLTSGGAA

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
107 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
121 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
180 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
181 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
193 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
194 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
195 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
196 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
197 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
200 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
201 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
202 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
203 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
204 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
248 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 3.32
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.74
Nodule 0
Rhizoplane 1.66
Rhizosphere 71.22
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0062457 3300049586 Bacteria 3086
2 SwRhRL2b_contig_1453 2162886007 Bacteria 3318
3 JGI24739J22299_10000042 3300001989 Bacteria 34840
4 JGI24739J22299_10000091 3300001989 Bacteria 26347
5 JGI24737J22298_10002031 3300001990 Bacteria 7238
6 JGI24737J22298_10030880 3300001990 Bacteria 1675
7 JGI24735J21928_10006310 3300002067 Bacteria 3912
8 JGI25162J39368_1000529 3300002737 Bacteria 28464
9 JGI25157J39369_1000446 3300002741 Bacteria 26463
10 JGI25157J39369_1000950 3300002741 Bacteria 13652
11 JGI25157J39369_1001638 3300002741 Bacteria 7690
12 JGI25157J39369_1002462 3300002741 Bacteria 4576
13 JGI25157J39369_1003251 3300002741 Bacteria 3412
14 JGI25163J39215_1000279 3300002771 Bacteria 18007
15 JGI25163J39215_1000580 3300002771 Bacteria 10307
16 JGI25164J39214_1000102 3300002772 Bacteria 83707
17 JGI25164J39214_1000142 3300002772 Bacteria 68956
18 JGI25164J39214_1000561 3300002772 Bacteria 16869
19 JGI25164J39214_1000564 3300002772 Bacteria 16819
20 JGI25165J46597_1000058 3300003214 Bacteria 212833
21 JGI25165J46597_1000090 3300003214 Bacteria 168833
22 JGI25165J46597_1001122 3300003214 Bacteria 16865
23 JGI25165J46597_1001290 3300003214 Bacteria 14538
24 rootH1_10127202 3300003316 Bacteria 1374
25 rootH2_10011619 3300003320 Bacteria 16641
26 rootH2_10069172 3300003320 Bacteria 2806
27 rootH1_10142898 3300003323 Bacteria 1151
28 Ga0006558J51389_1026097 3300003558 Bacteria 1260
29 Ga0006560J51390_1026969 3300003565 Bacteria 1220
30 Ga0006554J51385_1023919 3300003567 Bacteria 1464
31 Ga0006562J51391_1022432 3300003578 Bacteria 5470
32 Ga0006562J51391_1022433 3300003578 Bacteria 3793
33 Ga0055538_1000714 3300003751 Bacteria 9924
34 Ga0055539_1000821 3300003752 Bacteria 7316
35 Ga0055527_1000105 3300003760 Bacteria 60329
36 Ga0055527_1000253 3300003760 Bacteria 32992
37 Ga0055535_1000034 3300003761 Bacteria 181954
38 Ga0055535_1000150 3300003761 Bacteria 74086
39 Ga0055535_1000488 3300003761 Bacteria 35722
40 Ga0055535_1000765 3300003761 Bacteria 23814
41 Ga0055535_1000789 3300003761 Bacteria 23078
42 Ga0055535_1008250 3300003761 Bacteria 1898
43 Ga0055542_1000198 3300003762 Bacteria 74085
44 Ga0055542_1000685 3300003762 Bacteria 26937
45 Ga0055542_1001221 3300003762 Bacteria 14371
46 Ga0055542_1002647 3300003762 Bacteria 5596
47 Ga0055542_1010441 3300003762 Bacteria 1696
48 Ga0055529_1000083 3300003763 Bacteria 146729
49 Ga0055529_1000305 3300003763 Bacteria 56629
50 Ga0055529_1000343 3300003763 Bacteria 51957
51 Ga0055529_1000443 3300003763 Bacteria 41149
52 Ga0055529_1000667 3300003763 Bacteria 24036
53 Ga0055534_1012094 3300003784 Bacteria 1724
54 Ga0055528_1026599 3300003790 Bacteria 1655
55 Ga0055531_10011520 3300003794 Bacteria 4251
56 Ga0065165_1003017 3300005262 Bacteria 12699
57 Ga0070658_10084617 3300005327 Bacteria 2608
58 Ga0070676_10073029 3300005328 Bacteria 2063
59 Ga0070683_100510265 3300005329 Bacteria 1149
60 Ga0070670_100457303 3300005331 Bacteria 1132
61 Ga0068869_100029649 3300005334 Bacteria 3836
62 Ga0070666_10000005 3300005335 Bacteria 343092
63 Ga0070666_10158341 3300005335 Bacteria 1582
64 Ga0070680_100171468 3300005336 Bacteria 1826
65 Ga0070682_100222268 3300005337 Bacteria 1345
66 Ga0068868_100127646 3300005338 Bacteria 2079
67 Ga0070660_100014647 3300005339 Bacteria 5656
68 Ga0070660_100060185 3300005339 Bacteria 2947
69 Ga0070660_100263617 3300005339 Bacteria 1407
70 Ga0070660_101233886 3300005339 Bacteria 634
71 Ga0070691_10927065 3300005341 Bacteria 539
72 Ga0070661_100037225 3300005344 Bacteria 3539
73 Ga0070661_100101390 3300005344 Bacteria 2141
74 Ga0070661_100412929 3300005344 Bacteria 1069
75 Ga0070692_10003905 3300005345 Bacteria 6145
76 Ga0070692_10638255 3300005345 Bacteria 709
77 Ga0070668_100047703 3300005347 Bacteria 3293
78 Ga0070669_100084069 3300005353 Bacteria 2374
79 Ga0070671_100398732 3300005355 Bacteria 1177
80 Ga0070688_100379867 3300005365 Bacteria 1041
81 Ga0070659_100002615 3300005366 Bacteria 12808
82 Ga0070659_100010942 3300005366 Bacteria 6696
83 Ga0070659_100429987 3300005366 Bacteria 1117
84 Ga0070659_100535392 3300005366 Bacteria 1001
85 Ga0070659_100828250 3300005366 Bacteria 806
86 Ga0070667_100268654 3300005367 Bacteria 1529
87 Ga0070667_101052342 3300005367 Bacteria 760
88 Ga0070714_100000034 3300005435 Bacteria 130742
89 Ga0070714_101766067 3300005435 Bacteria 604
90 Ga0070710_10241069 3300005437 Bacteria 1158
91 Ga0070711_100053534 3300005439 Bacteria 2782
92 Ga0070711_100788002 3300005439 Bacteria 805
93 Ga0070694_100133139 3300005444 Bacteria 1798
94 Ga0070678_100002303 3300005456 Bacteria 10412
95 Ga0070662_100039345 3300005457 Bacteria 3362
96 Ga0070662_100273719 3300005457 Bacteria 1364
97 Ga0070662_100867638 3300005457 Bacteria 769
98 Ga0070681_10001208 3300005458 Bacteria 22475
99 Ga0070681_10011042 3300005458 Bacteria 8930
100 Ga0070681_10012125 3300005458 Bacteria 8550
101 Ga0068867_100868889 3300005459 Bacteria 809
102 Ga0068867_101820985 3300005459 Bacteria 573
103 Ga0070679_100002407 3300005530 Bacteria 16967
104 Ga0070679_100025171 3300005530 Bacteria 5838
105 Ga0070679_100137234 3300005530 Bacteria 2427
106 Ga0070679_100914185 3300005530 Bacteria 821
107 Ga0070684_101913831 3300005535 Bacteria 560
108 Ga0068853_100003663 3300005539 Bacteria 11785
109 Ga0068853_100076470 3300005539 Bacteria 2923
110 Ga0068853_100147205 3300005539 Bacteria 2117
111 Ga0070696_100001218 3300005546 Bacteria 16719
112 Ga0070696_100011587 3300005546 Bacteria 5908
113 Ga0070696_100027352 3300005546 Bacteria 3885
114 Ga0070693_100023546 3300005547 Bacteria 3293
115 Ga0070693_100045860 3300005547 Bacteria 2480
116 Ga0070693_100310412 3300005547 Bacteria 1066
117 Ga0070665_100018710 3300005548 Bacteria 6945
118 Ga0070665_100101467 3300005548 Bacteria 2881
119 Ga0068855_100015915 3300005563 Bacteria 9048
120 Ga0068855_100102918 3300005563 Bacteria 3286
121 Ga0068855_100281616 3300005563 Bacteria 1846
122 Ga0070664_100943826 3300005564 Bacteria 810
123 Ga0068857_100011171 3300005577 Bacteria 7809
124 Ga0068857_100014459 3300005577 Bacteria 6886
125 Ga0068857_100136395 3300005577 Bacteria 2215
126 Ga0068857_100213911 3300005577 Bacteria 1759
127 Ga0068854_100013946 3300005578 Bacteria 5287
128 Ga0068854_100015759 3300005578 Bacteria 5019
129 Ga0068854_100115542 3300005578 Bacteria 2030
130 Ga0068854_100819998 3300005578 Bacteria 812
131 Ga0068856_100011722 3300005614 Bacteria 8502
132 Ga0068856_100014629 3300005614 Bacteria 7581
133 Ga0068856_100036247 3300005614 Bacteria 4836
134 Ga0068856_100544617 3300005614 Bacteria 1182
135 Ga0068856_100564780 3300005614 Bacteria 1159
136 Ga0068852_100161254 3300005616 Bacteria 2094
137 Ga0068859_100291417 3300005617 Bacteria 1725
138 Ga0068859_101109272 3300005617 Bacteria 870
139 Ga0068859_101992271 3300005617 Bacteria 641
140 Ga0068866_10388608 3300005718 Bacteria 897
141 Ga0068851_10437507 3300005834 Bacteria 775
142 Ga0068870_10007797 3300005840 Bacteria 4789
143 Ga0068858_100080401 3300005842 Bacteria 3028
144 Ga0068858_101326167 3300005842 Bacteria 708
145 Ga0068860_100158982 3300005843 Bacteria 2178
146 Ga0068860_100549344 3300005843 Bacteria 1157
147 Ga0068862_101094638 3300005844 Bacteria 792
148 Ga0068862_101456606 3300005844 Bacteria 689
149 Ga0075369_10071843 3300006186 Bacteria 1524
150 Ga0068871_100154215 3300006358 Bacteria 1960
151 Ga0068865_100005258 3300006881 Bacteria 7826
152 Ga0068865_100089935 3300006881 Bacteria 2225
153 Ga0097620_100291415 3300006931 Bacteria 1725
154 Ga0097620_101109262 3300006931 Bacteria 870
155 Ga0097620_101992159 3300006931 Bacteria 641
156 Ga0105240_10128165 3300009093 Bacteria 3047
157 Ga0105240_12100020 3300009093 Bacteria 586
158 Ga0105245_11449815 3300009098 Bacteria 737
159 Ga0105241_10196666 3300009174 Bacteria 1681
160 Ga0105241_11198595 3300009174 Bacteria 719
161 Ga0105242_10329868 3300009176 Bacteria 1403
162 Ga0105237_10066156 3300009545 Bacteria 3610
163 Ga0105237_10136351 3300009545 Bacteria 2448
164 Ga0105237_11818842 3300009545 Bacteria 617
165 Ga0105238_10000060 3300009551 Bacteria 129934
166 Ga0105238_10001388 3300009551 Bacteria 24287
167 Ga0105238_10012789 3300009551 Bacteria 8470
168 Ga0105238_10069871 3300009551 Bacteria 3512
169 Ga0105238_10130701 3300009551 Bacteria 2489
170 Ga0105147_101220 3300009982 Bacteria 2067
171 Ga0105239_10045014 3300010375 Bacteria 4837
172 Ga0105239_10176072 3300010375 Bacteria 2393
173 Ga0157373_10002017 3300013100 Bacteria 15391
174 Ga0157373_10029000 3300013100 Bacteria 3989
175 Ga0157373_10362225 3300013100 Bacteria 1035
176 Ga0157371_10005539 3300013102 Bacteria 10625
177 Ga0157370_10001227 3300013104 Bacteria 32113
178 Ga0157370_10001569 3300013104 Bacteria 28272
179 Ga0157370_10011574 3300013104 Bacteria 9209
180 Ga0157370_10011968 3300013104 Bacteria 9044
181 Ga0157369_10008129 3300013105 Bacteria 12028
182 Ga0157374_10027757 3300013296 Bacteria 5111
183 Ga0157378_10530126 3300013297 Bacteria 1180
184 Ga0163162_10000294 3300013306 Bacteria 45823
185 Ga0163162_10007449 3300013306 Bacteria 10644
186 Ga0163162_10052559 3300013306 Bacteria 4092
187 Ga0163162_10561032 3300013306 Bacteria 1269
188 Ga0157372_10008772 3300013307 Bacteria 10737
189 Ga0157372_10089260 3300013307 Bacteria 3502
190 Ga0157372_10426742 3300013307 Bacteria 1545
191 Ga0157372_10594097 3300013307 Bacteria 1290
192 Ga0157372_10876806 3300013307 Bacteria 1042
193 Ga0157375_12525027 3300013308 Bacteria 614
194 Ga0182008_10004760 3300014497 Bacteria 7858
195 Ga0182008_10007657 3300014497 Bacteria 5952
196 Ga0182008_10228507 3300014497 Bacteria 954
197 Ga0182008_10462063 3300014497 Bacteria 692
198 Ga0157379_11703261 3300014968 Bacteria 618
199 Ga0157376_10007093 3300014969 Bacteria 7956
200 Ga0157376_10058476 3300014969 Bacteria 3229
201 Ga0182006_1006458 3300015261 Bacteria 5447
202 Ga0182006_1019261 3300015261 Bacteria 2874
203 Ga0182006_1019850 3300015261 Bacteria 2823
204 Ga0182007_10049487 3300015262 Bacteria 1388
205 Ga0182007_10091395 3300015262 Bacteria 1002
206 Ga0182007_10112168 3300015262 Bacteria 908
207 Ga0182005_1002081 3300015265 Bacteria 7458
208 Ga0183368_1003 3300015687 Bacteria 1276390
209 Ga0206356_10558970 3300020070 Bacteria 3412
210 Ga0206351_10475332 3300020077 Bacteria 807
211 Ga0213876_10098043 3300021384 Bacteria 1553
212 Ga0224712_10091259 3300022467 Bacteria 1276
213 Ga0224712_10211084 3300022467 Bacteria 885
214 Ga0209435_102859 3300025206 Bacteria 1996
215 Ga0209435_112230 3300025206 Bacteria 920
216 Ga0209435_112906 3300025206 Bacteria 890
217 Ga0209760_100373 3300025207 Bacteria 11781
218 Ga0209784_100016 3300025224 Bacteria 481036
219 Ga0209566_101739 3300025225 Bacteria 5233
220 Ga0209674_100012 3300025226 Bacteria 950162
221 Ga0209674_100244 3300025226 Bacteria 45968
222 Ga0209674_100318 3300025226 Bacteria 31053
223 Ga0209674_100489 3300025226 Bacteria 16826
224 Ga0209672_100007 3300025228 Bacteria 959482
225 Ga0209672_100078 3300025228 Bacteria 156926
226 Ga0209672_100265 3300025228 Bacteria 38562
227 Ga0209672_100885 3300025228 Bacteria 13666
228 Ga0209672_101218 3300025228 Bacteria 10392
229 Ga0209563_100079 3300025230 Bacteria 203017
230 Ga0207427_100019 3300025231 Bacteria 513977
231 Ga0207427_100033 3300025231 Bacteria 338459
232 Ga0207427_100050 3300025231 Bacteria 227233
233 Ga0207427_100123 3300025231 Bacteria 98859
234 Ga0207427_106794 3300025231 Bacteria 1407
235 Ga0209437_100012 3300025233 Bacteria 792625
236 Ga0209437_100105 3300025233 Bacteria 220034
237 Ga0209437_100120 3300025233 Bacteria 205054
238 Ga0209437_100192 3300025233 Bacteria 122888
239 Ga0209437_100227 3300025233 Bacteria 98939
240 Ga0209258_100012 3300025242 Bacteria 825544
241 Ga0209258_100039 3300025242 Bacteria 386366
242 Ga0209258_100046 3300025242 Bacteria 369794
243 Ga0209258_100095 3300025242 Bacteria 223270
244 Ga0209258_100238 3300025242 Bacteria 102043
245 Ga0209258_100308 3300025242 Bacteria 77195
246 Ga0209646_1000582 3300025246 Bacteria 15094
247 Ga0209646_1000774 3300025246 Bacteria 11002
248 Ga0209646_1000800 3300025246 Bacteria 10718
249 Ga0209026_1000012 3300025250 Bacteria 480426
250 Ga0209026_1000140 3300025250 Bacteria 115081
251 Ga0209026_1000158 3300025250 Bacteria 106333
252 Ga0209026_1000249 3300025250 Bacteria 68455
253 Ga0209026_1000623 3300025250 Bacteria 22318
254 Ga0209026_1001417 3300025250 Bacteria 10663
255 Ga0209677_102724 3300025253 Bacteria 6342
256 Ga0209148_1000001 3300025254 Bacteria 2545271
257 Ga0209148_1000005 3300025254 Bacteria 1806504
258 Ga0209148_1000014 3300025254 Bacteria 925277
259 Ga0209148_1000039 3300025254 Bacteria 482479
260 Ga0209148_1000087 3300025254 Bacteria 260905
261 Ga0209148_1000098 3300025254 Bacteria 233172
262 Ga0209148_1000800 3300025254 Bacteria 23023
263 Ga0209759_1000750 3300025256 Bacteria 28083
264 Ga0209759_1002324 3300025256 Bacteria 8531
265 Ga0209759_1003101 3300025256 Bacteria 6824
266 Ga0209759_1005416 3300025256 Bacteria 4477
267 Ga0209129_1005552 3300025258 Bacteria 4407
268 Ga0209233_1000002 3300025261 Bacteria 2501366
269 Ga0209233_1000080 3300025261 Bacteria 338459
270 Ga0209233_1000174 3300025261 Bacteria 144639
271 Ga0209233_1000184 3300025261 Bacteria 134246
272 Ga0209233_1000283 3300025261 Bacteria 70137
273 Ga0209455_1000010 3300025272 Bacteria 959482
274 Ga0209455_1000034 3300025272 Bacteria 483129
275 Ga0209455_1000039 3300025272 Bacteria 437734
276 Ga0209455_1000126 3300025272 Bacteria 165771
277 Ga0209455_1000225 3300025272 Bacteria 76514
278 Ga0209455_1002762 3300025272 Bacteria 6578
279 Ga0209455_1017613 3300025272 Bacteria 1492
280 Ga0209455_1025444 3300025272 Bacteria 1076
281 Ga0209673_1006698 3300025273 Bacteria 5497
282 Ga0209130_1007294 3300025284 Bacteria 3433
283 Ga0209676_1004522 3300025292 Bacteria 7706
284 Ga0209676_1100738 3300025292 Bacteria 615
285 Ga0209025_1014734 3300025294 Bacteria 4780
286 Ga0209025_1088587 3300025294 Bacteria 1020
287 Ga0209758_1000683 3300025297 Bacteria 50557
288 Ga0209758_1036407 3300025297 Bacteria 1921
289 Ga0209758_1069191 3300025297 Bacteria 1120
290 Ga0209050_1002075 3300025298 Bacteria 18403
291 Ga0209050_1085080 3300025298 Bacteria 662
292 Ga0209256_1004463 3300025299 Bacteria 8757
293 Ga0209256_1005209 3300025299 Bacteria 7637
294 Ga0209256_1005400 3300025299 Bacteria 7387
295 Ga0209051_1038870 3300025303 Bacteria 1726
296 Ga0209257_1000080 3300025304 Bacteria 312038
297 Ga0209257_1001547 3300025304 Bacteria 26709
298 Ga0209257_1008506 3300025304 Bacteria 5806
299 Ga0209257_1029183 3300025304 Bacteria 1801
300 Ga0207656_10299258 3300025321 Bacteria 796
301 Ga0207692_10213131 3300025898 Bacteria 1141
302 Ga0207642_10548362 3300025899 Bacteria 714
303 Ga0207647_10001002 3300025904 Bacteria 21914
304 Ga0207647_10004453 3300025904 Bacteria 10383
305 Ga0207647_10008693 3300025904 Bacteria 7255
306 Ga0207647_10083343 3300025904 Bacteria 1915
307 Ga0207645_10082788 3300025907 Bacteria 2057
308 Ga0207645_10308190 3300025907 Bacteria 1055
309 Ga0207643_10229213 3300025908 Bacteria 1139
310 Ga0207705_10067253 3300025909 Bacteria 2593
311 Ga0207705_10284209 3300025909 Bacteria 1267
312 Ga0207654_10360826 3300025911 Bacteria 1002
313 Ga0207707_10006292 3300025912 Bacteria 10367
314 Ga0207707_10009177 3300025912 Bacteria 8588
315 Ga0207707_10023879 3300025912 Bacteria 5347
316 Ga0207707_10038212 3300025912 Bacteria 4195
317 Ga0207707_10040851 3300025912 Bacteria 4050
318 Ga0207695_10002599 3300025913 Bacteria 26471
319 Ga0207695_10080851 3300025913 Bacteria 3290
320 Ga0207671_10000020 3300025914 Bacteria 309636
321 Ga0207671_10000033 3300025914 Bacteria 245869
322 Ga0207671_10496407 3300025914 Bacteria 973
323 Ga0207663_10027658 3300025916 Bacteria 3309
324 Ga0207663_10680632 3300025916 Bacteria 813
325 Ga0207660_10045374 3300025917 Bacteria 3096
326 Ga0207660_10148084 3300025917 Bacteria 1801
327 Ga0207660_10816721 3300025917 Bacteria 761
328 Ga0207657_10024017 3300025919 Bacteria 5660
329 Ga0207657_10045229 3300025919 Bacteria 3865
330 Ga0207657_10050843 3300025919 Bacteria 3604
331 Ga0207657_10131673 3300025919 Bacteria 2049
332 Ga0207657_10346073 3300025919 Bacteria 1173
333 Ga0207657_10906164 3300025919 Bacteria 679
334 Ga0207649_10048455 3300025920 Bacteria 2621
335 Ga0207649_10316864 3300025920 Bacteria 1145
336 Ga0207649_11178135 3300025920 Bacteria 605
337 Ga0207652_10001336 3300025921 Bacteria 21912
338 Ga0207652_10020621 3300025921 Bacteria 5431
339 Ga0207652_10064579 3300025921 Bacteria 3167
340 Ga0207652_10072216 3300025921 Bacteria 3001
341 Ga0207681_10073632 3300025923 Bacteria 2390
342 Ga0207694_10007514 3300025924 Bacteria 8262
343 Ga0207694_10131346 3300025924 Bacteria 2007
344 Ga0207694_10161066 3300025924 Bacteria 1812
345 Ga0207694_10433922 3300025924 Bacteria 1095
346 Ga0207694_10784292 3300025924 Bacteria 805
347 Ga0207694_10971648 3300025924 Bacteria 718
348 Ga0207659_10490179 3300025926 Bacteria 1039
349 Ga0207700_10068954 3300025928 Bacteria 2712
350 Ga0207700_10304051 3300025928 Bacteria 1378
351 Ga0207700_10711552 3300025928 Bacteria 897
352 Ga0207664_10000021 3300025929 Bacteria 216875
353 Ga0207664_10006216 3300025929 Bacteria 8201
354 Ga0207690_10002181 3300025932 Bacteria 11936
355 Ga0207690_10011077 3300025932 Bacteria 5378
356 Ga0207690_10012273 3300025932 Bacteria 5127
357 Ga0207690_10033257 3300025932 Bacteria 3314
358 Ga0207690_10053311 3300025932 Bacteria 2713
359 Ga0207690_10082830 3300025932 Bacteria 2244
360 Ga0207690_11375325 3300025932 Bacteria 590
361 Ga0207706_10058024 3300025933 Bacteria 3410
362 Ga0207706_10062092 3300025933 Bacteria 3291
363 Ga0207706_10354799 3300025933 Bacteria 1275
364 Ga0207686_10203020 3300025934 Bacteria 1421
365 Ga0207704_10009145 3300025938 Bacteria 4767
366 Ga0207689_10007944 3300025942 Bacteria 9266
367 Ga0207661_10310746 3300025944 Bacteria 1415
368 Ga0207679_11224884 3300025945 Bacteria 689
369 Ga0207667_10000626 3300025949 Bacteria 45737
370 Ga0207667_10003601 3300025949 Bacteria 19116
371 Ga0207667_10013920 3300025949 Bacteria 9190
372 Ga0207667_10032128 3300025949 Bacteria 5658
373 Ga0207667_10457012 3300025949 Bacteria 1297
374 Ga0207668_10012033 3300025972 Bacteria 5281
375 Ga0207640_10011142 3300025981 Bacteria 5084
376 Ga0207640_10032424 3300025981 Bacteria 3239
377 Ga0207640_11318594 3300025981 Bacteria 645
378 Ga0207658_11062045 3300025986 Bacteria 739
379 Ga0207703_10029726 3300026035 Bacteria 4313
380 Ga0207639_10011219 3300026041 Bacteria 6216
381 Ga0207639_10059429 3300026041 Bacteria 2944
382 Ga0207639_10082743 3300026041 Bacteria 2545
383 Ga0207678_10417116 3300026067 Bacteria 1164
384 Ga0207678_10577913 3300026067 Bacteria 984
385 Ga0207702_10000290 3300026078 Bacteria 58330
386 Ga0207702_10002845 3300026078 Bacteria 16179
387 Ga0207702_10010831 3300026078 Bacteria 7606
388 Ga0207702_10132875 3300026078 Bacteria 2241
389 Ga0207702_10454544 3300026078 Bacteria 1243
390 Ga0207641_12001016 3300026088 Bacteria 581
391 Ga0207648_10938767 3300026089 Bacteria 809
392 Ga0207648_11509520 3300026089 Bacteria 632
393 Ga0207674_10000218 3300026116 Bacteria 71563
394 Ga0207674_10022041 3300026116 Bacteria 6849
395 Ga0207674_10030751 3300026116 Bacteria 5643
396 Ga0207674_10173995 3300026116 Bacteria 2105
397 Ga0207674_10853495 3300026116 Bacteria 878
398 Ga0207683_10017401 3300026121 Bacteria 6127
399 Ga0207683_10949973 3300026121 Bacteria 798
400 Ga0207698_10002678 3300026142 Bacteria 10595
401 Ga0207698_10053589 3300026142 Bacteria 3098
402 Ga0209371_1000016 3300027312 Bacteria 646301
403 Ga0268266_10116506 3300028379 Bacteria 2373
404 Ga0268265_10152465 3300028380 Bacteria 1951
405 Ga0268265_11522866 3300028380 Bacteria 673
406 Ga0268264_10483350 3300028381 Bacteria 1205
407 Ga0265338_10278542 3300028800 Bacteria 1223
408 Ga0268256_1000015 3300030500 Bacteria 646300
409 Ga0316176_1035937 3300030732 Bacteria 797
410 Ga0316182_1248774 3300030745 Bacteria 1736
411 Ga0307408_101438578 3300031548 Bacteria 650
412 Ga0307516_10017807 3300031730 Bacteria 7399
413 Ga0307412_10064358 3300031911 Bacteria 2477
414 Ga0307414_10180206 3300032004 Bacteria 1698
415 Ga0395899_0037966 3300037312 Bacteria 3610
416 Ga0395899_0242383 3300037312 Bacteria 1240
417 Ga0395900_0001732 3300037418 Bacteria 25181
418 Ga0395900_0008996 3300037418 Bacteria 10239
419 Ga0395900_0429103 3300037418 Bacteria 1281
420 Ga0395900_1808556 3300037418 Bacteria 521
421 Ga0395898_0006906 3300037466 Bacteria 12072
422 Ga0395898_0012279 3300037466 Bacteria 8858
423 Ga0395898_0117282 3300037466 Bacteria 2550
424 Ga0395898_0126878 3300037466 Bacteria 2444
425 Ga0395905_0142212 3300037471 Bacteria 2257
426 Ga0395901_0004132 3300038443 Bacteria 14636
427 Ga0395901_0030016 3300038443 Bacteria 5600
428 Ga0395901_0082423 3300038443 Bacteria 3360
429 Ga0395901_0096589 3300038443 Bacteria 3096
430 Ga0395901_0287657 3300038443 Bacteria 1706
431 Ga0395901_1111393 3300038443 Bacteria 760
432 Ga0436365_0650332 3300039437 Bacteria 1996
433 Ga0439436_0000014 3300041404 Bacteria 90241
434 Ga0439465_0000563 3300041413 Bacteria 11173
435 Ga0439465_0012786 3300041413 Bacteria 2624
436 Ga0451789_0513220 3300041443 Bacteria 768
437 Ga0451797_1092716 3300041453 Bacteria 2294
438 Ga0451802_0321649 3300041460 Bacteria 1182
439 Ga0451804_0639808 3300041463 Bacteria 1200
440 Ga0451807_0181925 3300041486 Bacteria 863
441 Ga0451833_0573159 3300041491 Bacteria 760
442 Ga0451837_0118483 3300041494 Bacteria 1980
443 Ga0439445_0006306 3300042004 Bacteria 2725
444 Ga0439449_0000206 3300042007 Bacteria 20728
445 Ga0439455_0101125 3300042012 Bacteria 797
446 Ga0439463_009567 3300042016 Bacteria 2385
447 Ga0466963_0428553 3300044694 Bacteria 933
448 Ga0466963_1247153 3300044694 Bacteria 522
449 Ga0466958_0386443 3300045836 Bacteria 903
450 Ga0466967_0078188 3300045976 Bacteria 2980
451 Ga0495617_000411 3300046452 Bacteria 23420
452 Ga0495651_0790196 3300046462 Bacteria 586
453 Ga0495610_0009510 3300046512 Bacteria 6135
454 Ga0495620_0019985 3300046515 Bacteria 3279
455 Ga0495640_0154904 3300046533 Bacteria 1471
456 Ga0495649_0044419 3300046694 Bacteria 2426
457 Ga0496103_0433442 3300048906 Bacteria 843
458 Ga0496104_0000020 3300048907 Bacteria 247296
459 Ga0496105_0000015 3300048908 Bacteria 218758
460 Ga0496115_0000176 3300048918 Bacteria 59595
461 Ga0496116_0108490 3300048919 Bacteria 1639
462 Ga0496116_0146827 3300048919 Bacteria 1317
463 Ga0496118_0042257 3300048921 Bacteria 3598
464 Ga0496118_0073288 3300048921 Bacteria 2454
465 Ga0496119_0019183 3300048922 Bacteria 5051
466 Ga0496120_0302563 3300048923 Bacteria 732
467 Ga0496123_0007006 3300048926 Bacteria 10750
468 Ga0496126_0000969 3300048929 Bacteria 49256
469 Ga0501031_0077685 3300049568 Bacteria 2162
470 Ga0501032_0082483 3300049569 Bacteria 2139
471 Ga0501032_0255666 3300049569 Bacteria 1136
472 Ga0501033_0013080 3300049570 Bacteria 6325
473 Ga0501033_0075751 3300049570 Bacteria 2469
474 Ga0501034_0057695 3300049571 Bacteria 3903
475 Ga0501034_0062796 3300049571 Bacteria 3729
476 Ga0501034_0339109 3300049571 Bacteria 1433
477 Ga0501034_0929458 3300049571 Bacteria 756
478 Ga0501034_1129674 3300049571 Bacteria 664
479 Ga0501036_0073177 3300049572 Bacteria 2897
480 Ga0501036_0123730 3300049572 Bacteria 2184
481 Ga0501036_0761035 3300049572 Bacteria 799
482 Ga0501037_0024412 3300049573 Bacteria 4471
483 Ga0501037_0051695 3300049573 Bacteria 3005
484 Ga0501037_0280491 3300049573 Bacteria 1161
485 Ga0501038_0069493 3300049574 Bacteria 2991
486 Ga0501038_0073014 3300049574 Bacteria 2906
487 Ga0501038_0110405 3300049574 Bacteria 2279
488 Ga0501039_0035229 3300049575 Bacteria 3862
489 Ga0501039_0295659 3300049575 Bacteria 1273
490 Ga0501040_1358567 3300049576 Bacteria 516
491 Ga0501042_0240640 3300049578 Bacteria 1306
492 Ga0501043_0046571 3300049579 Bacteria 3410
493 Ga0501043_0064230 3300049579 Bacteria 2882
494 Ga0501043_0080958 3300049579 Bacteria 2551
495 Ga0501043_0120480 3300049579 Bacteria 2057
496 Ga0501043_0848273 3300049579 Bacteria 658
497 Ga0501046_0084661 3300049580 Bacteria 2445
498 Ga0501046_0091518 3300049580 Bacteria 2339
499 Ga0501046_0340864 3300049580 Bacteria 1089
500 Ga0501047_0114067 3300049581 Bacteria 2584
501 Ga0501047_0154140 3300049581 Bacteria 2172
502 Ga0501047_0236063 3300049581 Bacteria 1680
503 Ga0501047_0273324 3300049581 Bacteria 1536
504 Ga0501047_0473030 3300049581 Bacteria 1081
505 Ga0501047_0760651 3300049581 Bacteria 784
506 Ga0501047_1236463 3300049581 Unclassified 561
507 Ga0501048_0417828 3300049582 Bacteria 959
508 Ga0501048_0455544 3300049582 Bacteria 916
509 Ga0501069_0159245 3300049585 Bacteria 1300
510 Ga0501070_0139587 3300049586 Bacteria 2001
511 Ga0501070_0284660 3300049586 Bacteria 1348
512 Ga0501073_0141293 3300049589 Bacteria 1668
513 Ga0501073_0191870 3300049589 Bacteria 1414
514 Ga0501074_0158923 3300049590 Bacteria 1614
515 Ga0501225_0012331 3300049705 Bacteria 2400
516 Ga0501079_0461062 3300049741 Bacteria 998
517 Ga0501080_0029389 3300049742 Bacteria 5116
518 Ga0501080_0324732 3300049742 Bacteria 1393
519 Ga0501080_0709886 3300049742 Bacteria 886
520 Ga0501080_0965323 3300049742 Bacteria 740
521 Ga0501035_0007993 3300049822 Bacteria 9859
522 Ga0501035_0035525 3300049822 Bacteria 4522
523 Ga0501035_0081470 3300049822 Bacteria 2856
524 Ga0501035_0455421 3300049822 Bacteria 1058
525 Ga0501035_0661601 3300049822 Bacteria 846
526 Ga0501044_0071730 3300049823 Bacteria 3521
527 Ga0501044_0110801 3300049823 Bacteria 2753
528 Ga0501044_0150356 3300049823 Bacteria 2311
529 Ga0501044_0171681 3300049823 Bacteria 2139
530 Ga0501044_0945359 3300049823 Bacteria 735
531 Ga0501045_0449433 3300049824 Bacteria 958
532 nmdc:mga0sz30_102027_c1 3300050516 Bacteria 1254
533 Ga0587073_0070380 3300059492 Bacteria 844
534 Ga0587080_054436 3300059503 Bacteria 764
535 Ga0587082_034968 3300059504 Bacteria 895
536 Ga0587088_057309 3300059508 Bacteria 780
537 Ga0587067_054114 3300059640 Bacteria 822
538 Ga0587068_087097 3300059641 Bacteria 639
539 Ga0587072_064238 3300059643 Bacteria 762
540 Ga0587078_037262 3300059646 Bacteria 676
541 Ga0587120_010691 3300059659 Bacteria 780
542 8003016065 8003014200 Bacteria 4059994
543 Ga0501070_0062457
544 SwRhRL2b_contig_1453
545 JGI24739J22299_10000042
546 JGI24739J22299_10000091
547 JGI24737J22298_10002031
548 JGI24737J22298_10030880
549 JGI24735J21928_10006310
550 JGI25162J39368_1000529
551 JGI25157J39369_1000446
552 JGI25157J39369_1000950
553 JGI25157J39369_1001638
554 JGI25157J39369_1002462
555 JGI25157J39369_1003251
556 JGI25163J39215_1000279
557 JGI25163J39215_1000580
558 JGI25164J39214_1000102
559 JGI25164J39214_1000142
560 JGI25164J39214_1000561
561 JGI25164J39214_1000564
562 JGI25165J46597_1000058
563 JGI25165J46597_1000090
564 JGI25165J46597_1001122
565 JGI25165J46597_1001290
566 rootH1_10127202
567 rootH2_10011619
568 rootH2_10069172
569 rootH1_10142898
570 Ga0006558J51389_1026097
571 Ga0006560J51390_1026969
572 Ga0006554J51385_1023919
573 Ga0006562J51391_1022432
574 Ga0006562J51391_1022433
575 Ga0055538_1000714
576 Ga0055539_1000821
577 Ga0055527_1000105
578 Ga0055527_1000253
579 Ga0055535_1000034
580 Ga0055535_1000150
581 Ga0055535_1000488
582 Ga0055535_1000765
583 Ga0055535_1000789
584 Ga0055535_1008250
585 Ga0055542_1000198
586 Ga0055542_1000685
587 Ga0055542_1001221
588 Ga0055542_1002647
589 Ga0055542_1010441
590 Ga0055529_1000083
591 Ga0055529_1000305
592 Ga0055529_1000343
593 Ga0055529_1000443
594 Ga0055529_1000667
595 Ga0055534_1012094
596 Ga0055528_1026599
597 Ga0055531_10011520
598 Ga0065165_1003017
599 Ga0070658_10084617
600 Ga0070676_10073029
601 Ga0070683_100510265
602 Ga0070670_100457303
603 Ga0068869_100029649
604 Ga0070666_10000005
605 Ga0070666_10158341
606 Ga0070680_100171468
607 Ga0070682_100222268
608 Ga0068868_100127646
609 Ga0070660_100014647
610 Ga0070660_100060185
611 Ga0070660_100263617
612 Ga0070660_101233886
613 Ga0070691_10927065
614 Ga0070661_100037225
615 Ga0070661_100101390
616 Ga0070661_100412929
617 Ga0070692_10003905
618 Ga0070692_10638255
619 Ga0070668_100047703
620 Ga0070669_100084069
621 Ga0070671_100398732
622 Ga0070688_100379867
623 Ga0070659_100002615
624 Ga0070659_100010942
625 Ga0070659_100429987
626 Ga0070659_100535392
627 Ga0070659_100828250
628 Ga0070667_100268654
629 Ga0070667_101052342
630 Ga0070714_100000034
631 Ga0070714_101766067
632 Ga0070710_10241069
633 Ga0070711_100053534
634 Ga0070711_100788002
635 Ga0070694_100133139
636 Ga0070678_100002303
637 Ga0070662_100039345
638 Ga0070662_100273719
639 Ga0070662_100867638
640 Ga0070681_10001208
641 Ga0070681_10011042
642 Ga0070681_10012125
643 Ga0068867_100868889
644 Ga0068867_101820985
645 Ga0070679_100002407
646 Ga0070679_100025171
647 Ga0070679_100137234
648 Ga0070679_100914185
649 Ga0070684_101913831
650 Ga0068853_100003663
651 Ga0068853_100076470
652 Ga0068853_100147205
653 Ga0070696_100001218
654 Ga0070696_100011587
655 Ga0070696_100027352
656 Ga0070693_100023546
657 Ga0070693_100045860
658 Ga0070693_100310412
659 Ga0070665_100018710
660 Ga0070665_100101467
661 Ga0068855_100015915
662 Ga0068855_100102918
663 Ga0068855_100281616
664 Ga0070664_100943826
665 Ga0068857_100011171
666 Ga0068857_100014459
667 Ga0068857_100136395
668 Ga0068857_100213911
669 Ga0068854_100013946
670 Ga0068854_100015759
671 Ga0068854_100115542
672 Ga0068854_100819998
673 Ga0068856_100011722
674 Ga0068856_100014629
675 Ga0068856_100036247
676 Ga0068856_100544617
677 Ga0068856_100564780
678 Ga0068852_100161254
679 Ga0068859_100291417
680 Ga0068859_101109272
681 Ga0068859_101992271
682 Ga0068866_10388608
683 Ga0068851_10437507
684 Ga0068870_10007797
685 Ga0068858_100080401
686 Ga0068858_101326167
687 Ga0068860_100158982
688 Ga0068860_100549344
689 Ga0068862_101094638
690 Ga0068862_101456606
691 Ga0075369_10071843
692 Ga0068871_100154215
693 Ga0068865_100005258
694 Ga0068865_100089935
695 Ga0097620_100291415
696 Ga0097620_101109262
697 Ga0097620_101992159
698 Ga0105240_10128165
699 Ga0105240_12100020
700 Ga0105245_11449815
701 Ga0105241_10196666
702 Ga0105241_11198595
703 Ga0105242_10329868
704 Ga0105237_10066156
705 Ga0105237_10136351
706 Ga0105237_11818842
707 Ga0105238_10000060
708 Ga0105238_10001388
709 Ga0105238_10012789
710 Ga0105238_10069871
711 Ga0105238_10130701
712 Ga0105147_101220
713 Ga0105239_10045014
714 Ga0105239_10176072
715 Ga0157373_10002017
716 Ga0157373_10029000
717 Ga0157373_10362225
718 Ga0157371_10005539
719 Ga0157370_10001227
720 Ga0157370_10001569
721 Ga0157370_10011574
722 Ga0157370_10011968
723 Ga0157369_10008129
724 Ga0157374_10027757
725 Ga0157378_10530126
726 Ga0163162_10000294
727 Ga0163162_10007449
728 Ga0163162_10052559
729 Ga0163162_10561032
730 Ga0157372_10008772
731 Ga0157372_10089260
732 Ga0157372_10426742
733 Ga0157372_10594097
734 Ga0157372_10876806
735 Ga0157375_12525027
736 Ga0182008_10004760
737 Ga0182008_10007657
738 Ga0182008_10228507
739 Ga0182008_10462063
740 Ga0157379_11703261
741 Ga0157376_10007093
742 Ga0157376_10058476
743 Ga0182006_1006458
744 Ga0182006_1019261
745 Ga0182006_1019850
746 Ga0182007_10049487
747 Ga0182007_10091395
748 Ga0182007_10112168
749 Ga0182005_1002081
750 Ga0183368_1003
751 Ga0206356_10558970
752 Ga0206351_10475332
753 Ga0213876_10098043
754 Ga0224712_10091259
755 Ga0224712_10211084
756 Ga0209435_102859
757 Ga0209435_112230
758 Ga0209435_112906
759 Ga0209760_100373
760 Ga0209784_100016
761 Ga0209566_101739
762 Ga0209674_100012
763 Ga0209674_100244
764 Ga0209674_100318
765 Ga0209674_100489
766 Ga0209672_100007
767 Ga0209672_100078
768 Ga0209672_100265
769 Ga0209672_100885
770 Ga0209672_101218
771 Ga0209563_100079
772 Ga0207427_100019
773 Ga0207427_100033
774 Ga0207427_100050
775 Ga0207427_100123
776 Ga0207427_106794
777 Ga0209437_100012
778 Ga0209437_100105
779 Ga0209437_100120
780 Ga0209437_100192
781 Ga0209437_100227
782 Ga0209258_100012
783 Ga0209258_100039
784 Ga0209258_100046
785 Ga0209258_100095
786 Ga0209258_100238
787 Ga0209258_100308
788 Ga0209646_1000582
789 Ga0209646_1000774
790 Ga0209646_1000800
791 Ga0209026_1000012
792 Ga0209026_1000140
793 Ga0209026_1000158
794 Ga0209026_1000249
795 Ga0209026_1000623
796 Ga0209026_1001417
797 Ga0209677_102724
798 Ga0209148_1000001
799 Ga0209148_1000005
800 Ga0209148_1000014
801 Ga0209148_1000039
802 Ga0209148_1000087
803 Ga0209148_1000098
804 Ga0209148_1000800
805 Ga0209759_1000750
806 Ga0209759_1002324
807 Ga0209759_1003101
808 Ga0209759_1005416
809 Ga0209129_1005552
810 Ga0209233_1000002
811 Ga0209233_1000080
812 Ga0209233_1000174
813 Ga0209233_1000184
814 Ga0209233_1000283
815 Ga0209455_1000010
816 Ga0209455_1000034
817 Ga0209455_1000039
818 Ga0209455_1000126
819 Ga0209455_1000225
820 Ga0209455_1002762
821 Ga0209455_1017613
822 Ga0209455_1025444
823 Ga0209673_1006698
824 Ga0209130_1007294
825 Ga0209676_1004522
826 Ga0209676_1100738
827 Ga0209025_1014734
828 Ga0209025_1088587
829 Ga0209758_1000683
830 Ga0209758_1036407
831 Ga0209758_1069191
832 Ga0209050_1002075
833 Ga0209050_1085080
834 Ga0209256_1004463
835 Ga0209256_1005209
836 Ga0209256_1005400
837 Ga0209051_1038870
838 Ga0209257_1000080
839 Ga0209257_1001547
840 Ga0209257_1008506
841 Ga0209257_1029183
842 Ga0207656_10299258
843 Ga0207692_10213131
844 Ga0207642_10548362
845 Ga0207647_10001002
846 Ga0207647_10004453
847 Ga0207647_10008693
848 Ga0207647_10083343
849 Ga0207645_10082788
850 Ga0207645_10308190
851 Ga0207643_10229213
852 Ga0207705_10067253
853 Ga0207705_10284209
854 Ga0207654_10360826
855 Ga0207707_10006292
856 Ga0207707_10009177
857 Ga0207707_10023879
858 Ga0207707_10038212
859 Ga0207707_10040851
860 Ga0207695_10002599
861 Ga0207695_10080851
862 Ga0207671_10000020
863 Ga0207671_10000033
864 Ga0207671_10496407
865 Ga0207663_10027658
866 Ga0207663_10680632
867 Ga0207660_10045374
868 Ga0207660_10148084
869 Ga0207660_10816721
870 Ga0207657_10024017
871 Ga0207657_10045229
872 Ga0207657_10050843
873 Ga0207657_10131673
874 Ga0207657_10346073
875 Ga0207657_10906164
876 Ga0207649_10048455
877 Ga0207649_10316864
878 Ga0207649_11178135
879 Ga0207652_10001336
880 Ga0207652_10020621
881 Ga0207652_10064579
882 Ga0207652_10072216
883 Ga0207681_10073632
884 Ga0207694_10007514
885 Ga0207694_10131346
886 Ga0207694_10161066
887 Ga0207694_10433922
888 Ga0207694_10784292
889 Ga0207694_10971648
890 Ga0207659_10490179
891 Ga0207700_10068954
892 Ga0207700_10304051
893 Ga0207700_10711552
894 Ga0207664_10000021
895 Ga0207664_10006216
896 Ga0207690_10002181
897 Ga0207690_10011077
898 Ga0207690_10012273
899 Ga0207690_10033257
900 Ga0207690_10053311
901 Ga0207690_10082830
902 Ga0207690_11375325
903 Ga0207706_10058024
904 Ga0207706_10062092
905 Ga0207706_10354799
906 Ga0207686_10203020
907 Ga0207704_10009145
908 Ga0207689_10007944
909 Ga0207661_10310746
910 Ga0207679_11224884
911 Ga0207667_10000626
912 Ga0207667_10003601
913 Ga0207667_10013920
914 Ga0207667_10032128
915 Ga0207667_10457012
916 Ga0207668_10012033
917 Ga0207640_10011142
918 Ga0207640_10032424
919 Ga0207640_11318594
920 Ga0207658_11062045
921 Ga0207703_10029726
922 Ga0207639_10011219
923 Ga0207639_10059429
924 Ga0207639_10082743
925 Ga0207678_10417116
926 Ga0207678_10577913
927 Ga0207702_10000290
928 Ga0207702_10002845
929 Ga0207702_10010831
930 Ga0207702_10132875
931 Ga0207702_10454544
932 Ga0207641_12001016
933 Ga0207648_10938767
934 Ga0207648_11509520
935 Ga0207674_10000218
936 Ga0207674_10022041
937 Ga0207674_10030751
938 Ga0207674_10173995
939 Ga0207674_10853495
940 Ga0207683_10017401
941 Ga0207683_10949973
942 Ga0207698_10002678
943 Ga0207698_10053589
944 Ga0209371_1000016
945 Ga0268266_10116506
946 Ga0268265_10152465
947 Ga0268265_11522866
948 Ga0268264_10483350
949 Ga0265338_10278542
950 Ga0268256_1000015
951 Ga0316176_1035937
952 Ga0316182_1248774
953 Ga0307408_101438578
954 Ga0307516_10017807
955 Ga0307412_10064358
956 Ga0307414_10180206
957 Ga0395899_0037966
958 Ga0395899_0242383
959 Ga0395900_0001732
960 Ga0395900_0008996
961 Ga0395900_0429103
962 Ga0395900_1808556
963 Ga0395898_0006906
964 Ga0395898_0012279
965 Ga0395898_0117282
966 Ga0395898_0126878
967 Ga0395905_0142212
968 Ga0395901_0004132
969 Ga0395901_0030016
970 Ga0395901_0082423
971 Ga0395901_0096589
972 Ga0395901_0287657
973 Ga0395901_1111393
974 Ga0436365_0650332
975 Ga0439436_0000014
976 Ga0439465_0000563
977 Ga0439465_0012786
978 Ga0451789_0513220
979 Ga0451797_1092716
980 Ga0451802_0321649
981 Ga0451804_0639808
982 Ga0451807_0181925
983 Ga0451833_0573159
984 Ga0451837_0118483
985 Ga0439445_0006306
986 Ga0439449_0000206
987 Ga0439455_0101125
988 Ga0439463_009567
989 Ga0466963_0428553
990 Ga0466963_1247153
991 Ga0466958_0386443
992 Ga0466967_0078188
993 Ga0495617_000411
994 Ga0495651_0790196
995 Ga0495610_0009510
996 Ga0495620_0019985
997 Ga0495640_0154904
998 Ga0495649_0044419
999 Ga0496103_0433442
1000 Ga0496104_0000020
1001 Ga0496105_0000015
1002 Ga0496115_0000176
1003 Ga0496116_0108490
1004 Ga0496116_0146827
1005 Ga0496118_0042257
1006 Ga0496118_0073288
1007 Ga0496119_0019183
1008 Ga0496120_0302563
1009 Ga0496123_0007006
1010 Ga0496126_0000969
1011 Ga0501031_0077685
1012 Ga0501032_0082483
1013 Ga0501032_0255666
1014 Ga0501033_0013080
1015 Ga0501033_0075751
1016 Ga0501034_0057695
1017 Ga0501034_0062796
1018 Ga0501034_0339109
1019 Ga0501034_0929458
1020 Ga0501034_1129674
1021 Ga0501036_0073177
1022 Ga0501036_0123730
1023 Ga0501036_0761035
1024 Ga0501037_0024412
1025 Ga0501037_0051695
1026 Ga0501037_0280491
1027 Ga0501038_0069493
1028 Ga0501038_0073014
1029 Ga0501038_0110405
1030 Ga0501039_0035229
1031 Ga0501039_0295659
1032 Ga0501040_1358567
1033 Ga0501042_0240640
1034 Ga0501043_0046571
1035 Ga0501043_0064230
1036 Ga0501043_0080958
1037 Ga0501043_0120480
1038 Ga0501043_0848273
1039 Ga0501046_0084661
1040 Ga0501046_0091518
1041 Ga0501046_0340864
1042 Ga0501047_0114067
1043 Ga0501047_0154140
1044 Ga0501047_0236063
1045 Ga0501047_0273324
1046 Ga0501047_0473030
1047 Ga0501047_0760651
1048 Ga0501047_1236463
1049 Ga0501048_0417828
1050 Ga0501048_0455544
1051 Ga0501069_0159245
1052 Ga0501070_0139587
1053 Ga0501070_0284660
1054 Ga0501073_0141293
1055 Ga0501073_0191870
1056 Ga0501074_0158923
1057 Ga0501225_0012331
1058 Ga0501079_0461062
1059 Ga0501080_0029389
1060 Ga0501080_0324732
1061 Ga0501080_0709886
1062 Ga0501080_0965323
1063 Ga0501035_0007993
1064 Ga0501035_0035525
1065 Ga0501035_0081470
1066 Ga0501035_0455421
1067 Ga0501035_0661601
1068 Ga0501044_0071730
1069 Ga0501044_0110801
1070 Ga0501044_0150356
1071 Ga0501044_0171681
1072 Ga0501044_0945359
1073 Ga0501045_0449433
1074 nmdc:mga0sz30_102027_c1
1075 Ga0587073_0070380
1076 Ga0587080_054436
1077 Ga0587082_034968
1078 Ga0587088_057309
1079 Ga0587067_054114
1080 Ga0587068_087097
1081 Ga0587072_064238
1082 Ga0587078_037262
1083 Ga0587120_010691
1084 8003016065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

31

149

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wu2-assembly3.cif.gz_K crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant 0.7246 42 124
2wdv-assembly1.cif.gz_C e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket 0.6992 42 124
6wu6-assembly1.cif.gz_C succinate-coenzyme q reductase 0.6934 42 129
6wu6-assembly1.cif.gz_C succinate-coenzyme q reductase 0.5571 42 129
2wu2-assembly3.cif.gz_K crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant 0.5174 42 124
ID Description Score Start End Superfamily
2wdvK00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7085 42 124 1.20.1300.10
af_Q641Z9_62_169_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6599 42 123 1.20.1300.10
1yq4C02 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6311 42 125 1.20.1300.10
2wqyC02 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.626 42 127 1.20.1300.10
2h89C02 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.5898 42 125 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A520D3K2-F1-model_v4 deleted 0.9692 70 131
AF-F2I3H9-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9609 66 128 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A382QPX9-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9596 56 128 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A258XIN3-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9526 71 131 GO:0016020
GO:0046872
AF-A0A381TYI8-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9358 78 134 GO:0006099
GO:0009055
GO:0016020
GO:0046872

Map