F461551

General Info

Members Datasets Scaffolds Average Seq Length
542 250 534 424

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0042120|Ga0501044_0042120_1895_3346
Length 483
Sequence LIVKLFYCFAIVIIKIKTIQNSIEFQTLGFITINPFNHKIIKSATFAPFAKNNNSNNPLIKIHIMADIFERLLKNYGPIGQHRERAHGYFAFPKLEGEIGSRMKFRGKEMVVWSLNNYLGLGNHPEIRKADAEGAAQYGLALPMGARMMSGNSSHHELLEKKLADFESKEDAILLNFGYQGMVSLIDVLCSRHDIIVYDAESHACIIDGVRLHPGHRYVFKHNDLEDLEKQLQRATALIEKQKAGGILVITEGVFGMAGDQGKLKEIAALKKKYEFRLLVDDAHGFGTLGKTGAGAGEEQGVQDEIDVYFSTFAKSMASIGAFIAGPKAIIDYIRYNIRSQIFAKSLPMPLVIGNLKRLELLMTRPELKNKLWDVATKLQKGLKEKGFDIGKTDSVVTPVYMKGGVEEATAMVMDLRENYGIFCSIVVYPVIPKGHIIYRLIPTAVHTDDDIQRTLTAFSETKQKLDAGAYKVSAIPDMAEAQ

Samples

Sample ID Description Type Environment
1 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
2 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
6 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
7 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
8 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
9 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
159 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
177 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
237 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
238 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
242 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
243 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
244 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
250 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 0.18
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.17
Nodule 0
Rhizoplane 0.92
Rhizosphere 89.48
Stem 0
Stem Tuber 0
Unclassified 4.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002443 3300003203 Bacteria 8784
2 rootH1_10077283 3300003316 Bacteria 2520
3 rootH1_10077283 3300003323 Bacteria 1524
4 rootH2_10004251 3300003320 Bacteria 26993
5 rootH2_10006476 3300003320 Bacteria 13433
6 rootH2_10015397 3300003320 Bacteria 9042
7 rootH2_10060022 3300003320 Bacteria 11430
8 rootH2_10100492 3300003320 Bacteria 10831
9 rootL2_10049203 3300003322 Bacteria 1689
10 rootH1_10010378 3300003323 Bacteria 33865
11 Ga0065704_10099338 3300005289 Bacteria 2316
12 Ga0065704_10119336 3300005289 Bacteria 1801
13 Ga0065712_10001125 3300005290 Bacteria 7828
14 Ga0065715_10159944 3300005293 Bacteria 1639
15 Ga0070658_10000095 3300005327 Bacteria 77839
16 Ga0070658_10214111 3300005327 Bacteria 1628
17 Ga0070676_10000252 3300005328 Bacteria 23270
18 Ga0070676_10061321 3300005328 Bacteria 2235
19 Ga0070683_100008690 3300005329 Bacteria 8635
20 Ga0070683_100045191 3300005329 Bacteria 4065
21 Ga0070683_100057007 3300005329 Bacteria 3629
22 Ga0070683_100199335 3300005329 Bacteria 1901
23 Ga0070690_100073297 3300005330 Bacteria 2228
24 Ga0070677_10032680 3300005333 Bacteria 1998
25 Ga0068869_100001288 3300005334 Bacteria 14839
26 Ga0068869_100019691 3300005334 Bacteria 4617
27 Ga0068869_100036058 3300005334 Bacteria 3509
28 Ga0068869_100172232 3300005334 Bacteria 1692
29 Ga0068868_100000091 3300005338 Bacteria 55405
30 Ga0068868_100014538 3300005338 Bacteria 5803
31 Ga0068868_100020279 3300005338 Bacteria 4990
32 Ga0068868_100022248 3300005338 Bacteria 4783
33 Ga0068868_100043518 3300005338 Bacteria 3508
34 Ga0070689_100003775 3300005340 Bacteria 10144
35 Ga0070689_100082320 3300005340 Bacteria 2528
36 Ga0070691_10023815 3300005341 Bacteria 2844
37 Ga0070661_100004533 3300005344 Bacteria 9559
38 Ga0070661_100063212 3300005344 Bacteria 2718
39 Ga0070661_100074356 3300005344 Bacteria 2502
40 Ga0070668_100000043 3300005347 Bacteria 78564
41 Ga0070668_100132293 3300005347 Bacteria 2003
42 Ga0070669_100001290 3300005353 Bacteria 18112
43 Ga0070669_100208733 3300005353 Bacteria 1540
44 Ga0070675_100001568 3300005354 Bacteria 16882
45 Ga0070675_100074307 3300005354 Bacteria 2823
46 Ga0070671_100005102 3300005355 Bacteria 10459
47 Ga0070671_100032076 3300005355 Bacteria 4344
48 Ga0070671_100038329 3300005355 Bacteria 3978
49 Ga0070671_100086070 3300005355 Bacteria 2629
50 Ga0070674_100010396 3300005356 Bacteria 5626
51 Ga0070673_100000283 3300005364 Bacteria 26297
52 Ga0070673_100010965 3300005364 Bacteria 6167
53 Ga0070673_100054398 3300005364 Bacteria 3148
54 Ga0070688_100007499 3300005365 Bacteria 5883
55 Ga0070688_100036312 3300005365 Bacteria 2996
56 Ga0070659_100068688 3300005366 Bacteria 2811
57 Ga0070659_100127904 3300005366 Unclassified 2062
58 Ga0070667_100000254 3300005367 Bacteria 60664
59 Ga0070667_100036575 3300005367 Bacteria 4116
60 Ga0070713_100187878 3300005436 Bacteria 1860
61 Ga0070701_10010013 3300005438 Bacteria 4177
62 Ga0070700_100079782 3300005441 Bacteria 2110
63 Ga0070678_100009678 3300005456 Bacteria 5854
64 Ga0070678_100016467 3300005456 Bacteria 4732
65 Ga0070678_100029001 3300005456 Bacteria 3784
66 Ga0070662_100015824 3300005457 Bacteria 5059
67 Ga0070662_100147322 3300005457 Bacteria 1830
68 Ga0070681_10226055 3300005458 Bacteria 1786
69 Ga0068867_100004928 3300005459 Bacteria 9407
70 Ga0068867_100006379 3300005459 Bacteria 8336
71 Ga0068867_100013641 3300005459 Bacteria 5754
72 Ga0070685_10045641 3300005466 Unclassified 2513
73 Ga0070698_100000392 3300005471 Bacteria 46091
74 Ga0070698_100018803 3300005471 Bacteria 7270
75 Ga0070684_100001451 3300005535 Bacteria 17095
76 Ga0070684_100015304 3300005535 Bacteria 6243
77 Ga0070684_100133584 3300005535 Bacteria 2240
78 Ga0070684_100187380 3300005535 Bacteria 1882
79 Ga0068853_100000775 3300005539 Bacteria 22175
80 Ga0068853_100001183 3300005539 Bacteria 18575
81 Ga0070672_100000160 3300005543 Bacteria 37362
82 Ga0070672_100031030 3300005543 Bacteria 4020
83 Ga0070665_100000013 3300005548 Bacteria 484927
84 Ga0070665_100000350 3300005548 Bacteria 69455
85 Ga0070665_100041482 3300005548 Bacteria 4626
86 Ga0068855_100021854 3300005563 Bacteria 7672
87 Ga0068855_100023977 3300005563 Bacteria 7305
88 Ga0068855_100028412 3300005563 Bacteria 6691
89 Ga0070664_100007172 3300005564 Bacteria 8985
90 Ga0070664_100071997 3300005564 Bacteria 2963
91 Ga0070664_100111932 3300005564 Bacteria 2383
92 Ga0068857_100029027 3300005577 Bacteria 4881
93 Ga0068854_100014675 3300005578 Bacteria 5168
94 Ga0068854_100099345 3300005578 Bacteria 2180
95 Ga0068856_100042211 3300005614 Bacteria 4486
96 Ga0068852_100001112 3300005616 Bacteria 17736
97 Ga0068852_100087125 3300005616 Unclassified 2785
98 Ga0068852_100120225 3300005616 Bacteria 2403
99 Ga0068859_100013629 3300005617 Bacteria 8150
100 Ga0068859_100050546 3300005617 Bacteria 4175
101 Ga0068864_100001658 3300005618 Bacteria 18334
102 Ga0068864_100002233 3300005618 Bacteria 16004
103 Ga0068864_100049539 3300005618 Bacteria 3614
104 Ga0068864_100058315 3300005618 Bacteria 3336
105 Ga0068866_10053000 3300005718 Bacteria 2072
106 Ga0068866_10055609 3300005718 Unclassified 2033
107 Ga0068861_100007548 3300005719 Bacteria 7458
108 Ga0068861_100126826 3300005719 Bacteria 2066
109 Ga0068851_10003603 3300005834 Bacteria 6905
110 Ga0068863_100009683 3300005841 Bacteria 9401
111 Ga0068858_100000662 3300005842 Bacteria 35985
112 Ga0068858_100110254 3300005842 Bacteria 2570
113 Ga0068860_100003177 3300005843 Bacteria 16946
114 Ga0068860_100003412 3300005843 Bacteria 16333
115 Ga0068860_100016858 3300005843 Bacteria 7121
116 Ga0068860_100098808 3300005843 Bacteria 2783
117 Ga0068860_100124190 3300005843 Bacteria 2474
118 Ga0068860_100176071 3300005843 Bacteria 2067
119 Ga0068860_100268600 3300005843 Bacteria 1664
120 Ga0068860_100290040 3300005843 Bacteria 1601
121 Ga0068862_100005117 3300005844 Bacteria 11020
122 Ga0081539_10000523 3300005985 Bacteria 79800
123 Ga0075366_10048280 3300006195 Bacteria 2524
124 Ga0075366_10089759 3300006195 Bacteria 1841
125 Ga0097621_100003063 3300006237 Bacteria 11459
126 Ga0097621_100025640 3300006237 Bacteria 4615
127 Ga0097621_100040839 3300006237 Bacteria 3731
128 Ga0097621_100169834 3300006237 Bacteria 1879
129 Ga0068871_100023419 3300006358 Unclassified 4777
130 Ga0068871_100075229 3300006358 Bacteria 2787
131 Ga0075429_100002343 3300006880 Bacteria 15928
132 Ga0068865_100098352 3300006881 Bacteria 2138
133 Ga0097620_100013629 3300006931 Bacteria 8150
134 Ga0097620_100050542 3300006931 Bacteria 4175
135 Ga0105240_10000075 3300009093 Bacteria 199596
136 Ga0105240_10000165 3300009093 Bacteria 134738
137 Ga0105240_10000288 3300009093 Bacteria 98146
138 Ga0105240_10000289 3300009093 Bacteria 98095
139 Ga0105240_10033896 3300009093 Bacteria 6593
140 Ga0105240_10034751 3300009093 Bacteria 6500
141 Ga0105240_10067828 3300009093 Bacteria 4421
142 Ga0105240_10076357 3300009093 Bacteria 4130
143 Ga0111539_10068994 3300009094 Bacteria 4174
144 Ga0111539_10104927 3300009094 Bacteria 3316
145 Ga0111539_10174847 3300009094 Bacteria 2508
146 Ga0105247_10003123 3300009101 Bacteria 10936
147 Ga0114129_10004929 3300009147 Bacteria 18833
148 Ga0114129_10031046 3300009147 Bacteria 7557
149 Ga0114129_10040254 3300009147 Bacteria 6588
150 Ga0105241_10001610 3300009174 Bacteria 17198
151 Ga0105241_10025697 3300009174 Bacteria 4377
152 Ga0105241_10093784 3300009174 Bacteria 2373
153 Ga0105242_10008487 3300009176 Bacteria 7891
154 Ga0105242_10016344 3300009176 Bacteria 5771
155 Ga0105242_10082120 3300009176 Bacteria 2696
156 Ga0105248_10050581 3300009177 Bacteria 4661
157 Ga0105248_10110092 3300009177 Bacteria 3106
158 Ga0105237_10000072 3300009545 Bacteria 135507
159 Ga0105237_10000340 3300009545 Bacteria 65768
160 Ga0105237_10002461 3300009545 Bacteria 22986
161 Ga0105237_10005667 3300009545 Bacteria 14053
162 Ga0105237_10008015 3300009545 Bacteria 11497
163 Ga0105237_10008332 3300009545 Bacteria 11248
164 Ga0105237_10056300 3300009545 Bacteria 3936
165 Ga0105237_10075770 3300009545 Bacteria 3355
166 Ga0105237_10186517 3300009545 Bacteria 2074
167 Ga0105238_10001478 3300009551 Bacteria 23578
168 Ga0105238_10008668 3300009551 Bacteria 10174
169 Ga0105238_10069611 3300009551 Bacteria 3519
170 Ga0105238_10079785 3300009551 Bacteria 3262
171 Ga0105249_10000651 3300009553 Bacteria 31572
172 Ga0105249_10000793 3300009553 Bacteria 28356
173 Ga0105249_10000820 3300009553 Bacteria 28000
174 Ga0105249_10010031 3300009553 Bacteria 8313
175 Ga0105249_10025615 3300009553 Bacteria 5313
176 Ga0105249_10059211 3300009553 Bacteria 3513
177 Ga0105249_10077985 3300009553 Bacteria 3073
178 Ga0105239_10000299 3300010375 Bacteria 73314
179 Ga0105239_10000547 3300010375 Bacteria 53884
180 Ga0105239_10010274 3300010375 Bacteria 10485
181 Ga0105239_10021788 3300010375 Bacteria 7064
182 Ga0105239_10024438 3300010375 Bacteria 6658
183 Ga0105239_10026185 3300010375 Bacteria 6420
184 Ga0105239_10043151 3300010375 Bacteria 4942
185 Ga0105246_10024929 3300011119 Unclassified 3894
186 Ga0105246_10113710 3300011119 Bacteria 1993
187 Ga0157373_10029609 3300013100 Bacteria 3943
188 Ga0157373_10105117 3300013100 Bacteria 1986
189 Ga0157373_10120433 3300013100 Bacteria 1844
190 Ga0157371_10012607 3300013102 Bacteria 6452
191 Ga0157371_10021535 3300013102 Bacteria 4731
192 Ga0157370_10019758 3300013104 Bacteria 6744
193 Ga0157370_10085476 3300013104 Bacteria 2963
194 Ga0157370_10171780 3300013104 Bacteria 2015
195 Ga0157370_10272176 3300013104 Bacteria 1565
196 Ga0157369_10090507 3300013105 Bacteria 3267
197 Ga0157374_10000007 3300013296 Bacteria 595643
198 Ga0157374_10000084 3300013296 Bacteria 94138
199 Ga0157374_10000411 3300013296 Bacteria 38796
200 Ga0157374_10035513 3300013296 Bacteria 4560
201 Ga0157374_10040433 3300013296 Bacteria 4295
202 Ga0157374_10046446 3300013296 Bacteria 4021
203 Ga0157374_10065071 3300013296 Bacteria 3423
204 Ga0157374_10078294 3300013296 Bacteria 3131
205 Ga0157374_10091978 3300013296 Bacteria 2893
206 Ga0157374_10118575 3300013296 Unclassified 2552
207 Ga0157374_10233483 3300013296 Bacteria 1807
208 Ga0157378_10001872 3300013297 Bacteria 18898
209 Ga0157378_10004531 3300013297 Bacteria 12188
210 Ga0157378_10020677 3300013297 Bacteria 5789
211 Ga0157378_10035023 3300013297 Bacteria 4439
212 Ga0157378_10058554 3300013297 Bacteria 3436
213 Ga0157378_10063749 3300013297 Bacteria 3294
214 Ga0163162_10000113 3300013306 Bacteria 71491
215 Ga0163162_10000798 3300013306 Bacteria 29316
216 Ga0163162_10001528 3300013306 Bacteria 21567
217 Ga0163162_10007598 3300013306 Bacteria 10553
218 Ga0163162_10011055 3300013306 Bacteria 8793
219 Ga0163162_10013875 3300013306 Bacteria 7872
220 Ga0163162_10106249 3300013306 Bacteria 2902
221 Ga0163162_10122178 3300013306 Bacteria 2709
222 Ga0163162_10122376 3300013306 Bacteria 2707
223 Ga0157372_10004516 3300013307 Bacteria 14843
224 Ga0157372_10007391 3300013307 Bacteria 11683
225 Ga0157372_10009637 3300013307 Bacteria 10267
226 Ga0157372_10011150 3300013307 Bacteria 9561
227 Ga0157372_10044093 3300013307 Bacteria 4941
228 Ga0157372_10082979 3300013307 Bacteria 3630
229 Ga0157372_10130098 3300013307 Bacteria 2895
230 Ga0157372_10134205 3300013307 Bacteria 2850
231 Ga0157372_10158798 3300013307 Bacteria 2612
232 Ga0157372_10174220 3300013307 Bacteria 2490
233 Ga0157372_10298707 3300013307 Unclassified 1873
234 Ga0157375_10000565 3300013308 Bacteria 33320
235 Ga0157375_10003545 3300013308 Bacteria 13557
236 Ga0157375_10018067 3300013308 Bacteria 6387
237 Ga0157375_10086647 3300013308 Bacteria 3183
238 Ga0157375_10124418 3300013308 Bacteria 2692
239 Ga0157375_10149322 3300013308 Bacteria 2471
240 Ga0163163_10000261 3300014325 Bacteria 53342
241 Ga0163163_10000306 3300014325 Bacteria 48215
242 Ga0163163_10001534 3300014325 Bacteria 19476
243 Ga0163163_10103108 3300014325 Bacteria 2877
244 Ga0157380_10001396 3300014326 Bacteria 15765
245 Ga0157380_10019868 3300014326 Bacteria 5012
246 Ga0157380_10031980 3300014326 Bacteria 4043
247 Ga0157380_10161341 3300014326 Bacteria 1949
248 Ga0157377_10007191 3300014745 Bacteria 5359
249 Ga0157379_10000245 3300014968 Bacteria 42570
250 Ga0157379_10007467 3300014968 Bacteria 9465
251 Ga0157379_10010385 3300014968 Bacteria 8111
252 Ga0157379_10046961 3300014968 Bacteria 3852
253 Ga0157376_10001301 3300014969 Bacteria 16427
254 Ga0157376_10003267 3300014969 Bacteria 11151
255 Ga0157376_10018158 3300014969 Bacteria 5384
256 Ga0163161_10001839 3300017792 Bacteria 15495
257 Ga0163161_10015534 3300017792 Bacteria 5308
258 Ga0163161_10047481 3300017792 Bacteria 3100
259 Ga0163161_10077809 3300017792 Bacteria 2437
260 Ga0163161_10088856 3300017792 Unclassified 2284
261 Ga0206352_10476274 3300020078 Bacteria 1284
262 Ga0213876_10003289 3300021384 Bacteria 9274
263 Ga0209436_104951 3300025208 Bacteria 3187
264 Ga0209646_1000727 3300025246 Bacteria 11616
265 Ga0209130_1001213 3300025284 Bacteria 18290
266 Ga0207426_1000002 3300025302 Bacteria 1249660
267 Ga0207426_1003471 3300025302 Bacteria 8521
268 Ga0207656_10000709 3300025321 Bacteria 10899
269 Ga0207656_10073784 3300025321 Bacteria 1521
270 Ga0207682_10025161 3300025893 Bacteria 2360
271 Ga0207682_10030993 3300025893 Bacteria 2145
272 Ga0207642_10025660 3300025899 Bacteria 2388
273 Ga0207642_10089703 3300025899 Bacteria 1515
274 Ga0207710_10000906 3300025900 Bacteria 15850
275 Ga0207688_10013278 3300025901 Bacteria 4475
276 Ga0207680_10016637 3300025903 Bacteria 3866
277 Ga0207647_10000054 3300025904 Bacteria 86704
278 Ga0207645_10000278 3300025907 Bacteria 42507
279 Ga0207645_10000378 3300025907 Bacteria 36697
280 Ga0207645_10030209 3300025907 Bacteria 3492
281 Ga0207645_10064816 3300025907 Bacteria 2334
282 Ga0207643_10002813 3300025908 Bacteria 9389
283 Ga0207705_10101490 3300025909 Bacteria 2116
284 Ga0207654_10015784 3300025911 Bacteria 3925
285 Ga0207654_10060779 3300025911 Bacteria 2209
286 Ga0207707_10241094 3300025912 Bacteria 1572
287 Ga0207695_10000055 3300025913 Bacteria 382776
288 Ga0207695_10000130 3300025913 Bacteria 224214
289 Ga0207695_10000247 3300025913 Bacteria 140966
290 Ga0207695_10001063 3300025913 Bacteria 48025
291 Ga0207695_10025256 3300025913 Bacteria 6656
292 Ga0207671_10000451 3300025914 Bacteria 56763
293 Ga0207671_10000456 3300025914 Bacteria 56238
294 Ga0207671_10000653 3300025914 Bacteria 45335
295 Ga0207671_10008037 3300025914 Bacteria 9021
296 Ga0207671_10011923 3300025914 Bacteria 7029
297 Ga0207671_10035339 3300025914 Bacteria 3710
298 Ga0207671_10082489 3300025914 Bacteria 2412
299 Ga0207671_10091590 3300025914 Bacteria 2291
300 Ga0207662_10005928 3300025918 Bacteria 6560
301 Ga0207662_10038858 3300025918 Bacteria 2790
302 Ga0207657_10003973 3300025919 Bacteria 15708
303 Ga0207649_10013994 3300025920 Bacteria 4489
304 Ga0207652_10316774 3300025921 Bacteria 1408
305 Ga0207650_10041637 3300025925 Bacteria 3367
306 Ga0207650_10093314 3300025925 Bacteria 2304
307 Ga0207659_10052222 3300025926 Bacteria 2911
308 Ga0207659_10064231 3300025926 Bacteria 2656
309 Ga0207659_10104225 3300025926 Bacteria 2145
310 Ga0207644_10012863 3300025931 Bacteria 5566
311 Ga0207690_10093907 3300025932 Unclassified 2127
312 Ga0207706_10003195 3300025933 Bacteria 15728
313 Ga0207706_10015689 3300025933 Bacteria 6849
314 Ga0207706_10035893 3300025933 Bacteria 4405
315 Ga0207686_10036405 3300025934 Bacteria 2963
316 Ga0207670_10099850 3300025936 Unclassified 2071
317 Ga0207669_10007669 3300025937 Bacteria 5013
318 Ga0207669_10044083 3300025937 Bacteria 2618
319 Ga0207704_10082999 3300025938 Bacteria 2078
320 Ga0207691_10010582 3300025940 Bacteria 8848
321 Ga0207691_10057424 3300025940 Bacteria 3542
322 Ga0207691_10075257 3300025940 Bacteria 3044
323 Ga0207711_10040585 3300025941 Bacteria 3960
324 Ga0207689_10002097 3300025942 Bacteria 18813
325 Ga0207689_10002261 3300025942 Bacteria 18049
326 Ga0207689_10006534 3300025942 Bacteria 10288
327 Ga0207689_10053967 3300025942 Bacteria 3311
328 Ga0207689_10056212 3300025942 Bacteria 3238
329 Ga0207689_10068591 3300025942 Bacteria 2914
330 Ga0207689_10074059 3300025942 Bacteria 2798
331 Ga0207689_10074631 3300025942 Bacteria 2786
332 Ga0207689_10091162 3300025942 Bacteria 2504
333 Ga0207689_10112919 3300025942 Bacteria 2233
334 Ga0207661_10004373 3300025944 Bacteria 9903
335 Ga0207661_10022714 3300025944 Bacteria 4730
336 Ga0207679_10001000 3300025945 Bacteria 18143
337 Ga0207679_10006064 3300025945 Bacteria 7621
338 Ga0207679_10008382 3300025945 Bacteria 6582
339 Ga0207679_10058779 3300025945 Bacteria 2851
340 Ga0207679_10154822 3300025945 Bacteria 1870
341 Ga0207679_10206669 3300025945 Unclassified 1644
342 Ga0207667_10000876 3300025949 Bacteria 38469
343 Ga0207667_10014139 3300025949 Bacteria 9109
344 Ga0207667_10065810 3300025949 Bacteria 3779
345 Ga0207667_10167305 3300025949 Bacteria 2260
346 Ga0207667_10226312 3300025949 Bacteria 1916
347 Ga0207651_10001142 3300025960 Bacteria 11852
348 Ga0207651_10172148 3300025960 Bacteria 1709
349 Ga0207651_10209065 3300025960 Bacteria 1569
350 Ga0207712_10001144 3300025961 Bacteria 18474
351 Ga0207712_10002226 3300025961 Bacteria 12615
352 Ga0207712_10003360 3300025961 Bacteria 10123
353 Ga0207712_10189079 3300025961 Bacteria 1624
354 Ga0207668_10000821 3300025972 Bacteria 18944
355 Ga0207668_10058059 3300025972 Bacteria 2703
356 Ga0207640_10056771 3300025981 Bacteria 2572
357 Ga0207658_10000176 3300025986 Bacteria 68501
358 Ga0207658_10036627 3300025986 Bacteria 3519
359 Ga0207658_10059670 3300025986 Bacteria 2843
360 Ga0207677_10002439 3300026023 Bacteria 9762
361 Ga0207677_10112793 3300026023 Bacteria 2028
362 Ga0207677_10170519 3300026023 Bacteria 1701
363 Ga0207703_10015388 3300026035 Bacteria 5967
364 Ga0207703_10108540 3300026035 Bacteria 2364
365 Ga0207703_10141168 3300026035 Bacteria 2091
366 Ga0207639_10002156 3300026041 Bacteria 13254
367 Ga0207639_10023922 3300026041 Bacteria 4415
368 Ga0207639_10128706 3300026041 Bacteria 2092
369 Ga0207639_10295631 3300026041 Bacteria 1429
370 Ga0207708_10074080 3300026075 Bacteria 2610
371 Ga0207702_10031921 3300026078 Bacteria 4393
372 Ga0207641_10001688 3300026088 Bacteria 21481
373 Ga0207641_10046151 3300026088 Bacteria 3671
374 Ga0207648_10000559 3300026089 Bacteria 41660
375 Ga0207648_10001588 3300026089 Bacteria 24911
376 Ga0207648_10003650 3300026089 Bacteria 16115
377 Ga0207648_10210911 3300026089 Bacteria 1724
378 Ga0207676_10002713 3300026095 Bacteria 12603
379 Ga0207676_10002891 3300026095 Bacteria 12243
380 Ga0207676_10251495 3300026095 Bacteria 1591
381 Ga0207674_10027837 3300026116 Bacteria 5973
382 Ga0207674_10142782 3300026116 Bacteria 2353
383 Ga0207674_10279698 3300026116 Bacteria 1617
384 Ga0207675_100000304 3300026118 Bacteria 47181
385 Ga0207675_100014076 3300026118 Bacteria 7460
386 Ga0207675_100024456 3300026118 Bacteria 5616
387 Ga0207675_100114633 3300026118 Bacteria 2546
388 Ga0207675_100178128 3300026118 Bacteria 2035
389 Ga0207683_10002440 3300026121 Bacteria 16224
390 Ga0207683_10004324 3300026121 Bacteria 12267
391 Ga0207683_10075011 3300026121 Bacteria 2993
392 Ga0207683_10131401 3300026121 Bacteria 2252
393 Ga0207698_10002781 3300026142 Bacteria 10438
394 Ga0207698_10020311 3300026142 Bacteria 4569
395 Ga0207698_10128842 3300026142 Unclassified 2158
396 Ga0207428_10112997 3300027907 Bacteria 2088
397 Ga0268266_10000024 3300028379 Bacteria 490820
398 Ga0268266_10010154 3300028379 Bacteria 8251
399 Ga0268264_10001731 3300028381 Bacteria 20053
400 Ga0268264_10002252 3300028381 Bacteria 17081
401 Ga0268264_10144514 3300028381 Bacteria 2125
402 Ga0268264_10198412 3300028381 Bacteria 1834
403 Ga0268264_10293829 3300028381 Bacteria 1527
404 Ga0307517_10002335 3300028786 Bacteria 30606
405 Ga0307511_10003820 3300030521 Bacteria 15420
406 Ga0265327_10000030 3300031251 Bacteria 333531
407 Ga0265327_10021760 3300031251 Bacteria 3860
408 Ga0307513_10039327 3300031456 Bacteria 5244
409 Ga0316578_10004211 3300031728 Bacteria 6754
410 Ga0307516_10167432 3300031730 Bacteria 1941
411 Ga0316577_10010214 3300031733 Bacteria 5062
412 Ga0307407_10014107 3300031903 Bacteria 3902
413 Ga0307414_10000104 3300032004 Bacteria 60113
414 Ga0316580_10012070 3300032139 Bacteria 2628
415 Ga0307510_10013038 3300033180 Bacteria 9859
416 Ga0316574_0088797 3300035398 Bacteria 1969
417 Ga0373927_0010011 3300035695 Bacteria 6351
418 Ga0373937_0018980 3300036401 Bacteria 6150
419 Ga0373937_0319720 3300036401 Bacteria 1468
420 Ga0316584_0062765 3300036712 Bacteria 2782
421 Ga0395900_0064108 3300037418 Bacteria 3777
422 Ga0395905_0000208 3300037471 Bacteria 91236
423 Ga0395905_0018145 3300037471 Bacteria 6678
424 Ga0395905_0040566 3300037471 Bacteria 4367
425 Ga0436365_0103853 3300039437 Bacteria 48297
426 Ga0436365_0671234 3300039437 Bacteria 3572
427 Ga0436365_1331410 3300039437 Unclassified 1525
428 Ga0439449_0003552 3300042007 Bacteria 6057
429 Ga0439457_005643 3300042014 Bacteria 3121
430 Ga0439434_0040474 3300042435 Bacteria 1431
431 Ga0451577_0000161 3300042876 Bacteria 146704
432 Ga0451577_0302155 3300042876 Bacteria 1450
433 Ga0466969_0001097 3300044656 Bacteria 14623
434 Ga0466972_0000003 3300044658 Bacteria 391452
435 Ga0466972_0000013 3300044658 Bacteria 229345
436 Ga0466972_0012242 3300044658 Bacteria 4313
437 Ga0466972_0019471 3300044658 Bacteria 3393
438 Ga0466966_0000045 3300044684 Bacteria 92504
439 Ga0466961_0126809 3300044693 Bacteria 1601
440 Ga0466964_0026864 3300044706 Bacteria 2255
441 Ga0453684_0072226 3300044712 Bacteria 4358
442 Ga0453684_0114669 3300044712 Bacteria 3266
443 Ga0453684_0222897 3300044712 Bacteria 2183
444 Ga0466970_0097727 3300044765 Bacteria 1598
445 Ga0466957_0008353 3300044842 Bacteria 5887
446 Ga0466957_0010389 3300044842 Bacteria 5342
447 Ga0466960_0109696 3300044901 Bacteria 1432
448 Ga0466959_0000023 3300045049 Bacteria 124545
449 Ga0451576_0186228 3300045051 Bacteria 2168
450 Ga0495662_0028681 3300046476 Bacteria 2687
451 Ga0495606_0008820 3300046507 Bacteria 8650
452 Ga0495630_0091061 3300046517 Bacteria 2304
453 Ga0495630_0153039 3300046517 Bacteria 1755
454 Ga0495648_0001379 3300046524 Bacteria 23931
455 Ga0495598_0021199 3300046537 Bacteria 1726
456 Ga0495668_0001191 3300046616 Bacteria 26410
457 Ga0495634_0045674 3300046642 Bacteria 2960
458 Ga0495611_0000089 3300046648 Bacteria 63663
459 Ga0495611_0031855 3300046648 Bacteria 2323
460 Ga0495581_0058057 3300047315 Bacteria 2234
461 Ga0495674_0164895 3300047319 Bacteria 1852
462 Ga0495687_000014 3300047443 Bacteria 366896
463 Ga0495684_0079664 3300047471 Bacteria 2487
464 Ga0495686_0000034 3300047472 Bacteria 325038
465 Ga0495686_0000643 3300047472 Bacteria 48144
466 Ga0495686_0017423 3300047472 Bacteria 4841
467 Ga0496101_0047453 3300048904 Bacteria 3084
468 Ga0496104_0169058 3300048907 Bacteria 2097
469 Ga0496111_0162693 3300048914 Bacteria 1657
470 Ga0496114_0000296 3300048917 Bacteria 36568
471 Ga0496115_0094735 3300048918 Bacteria 2443
472 Ga0501032_0014723 3300049569 Bacteria 5535
473 Ga0501032_0034134 3300049569 Bacteria 3483
474 Ga0501033_0037062 3300049570 Bacteria 3652
475 Ga0501033_0153187 3300049570 Bacteria 1662
476 Ga0501034_0008720 3300049571 Bacteria 10675
477 Ga0501034_0019915 3300049571 Bacteria 6854
478 Ga0501034_0029020 3300049571 Bacteria 5625
479 Ga0501036_0039245 3300049572 Bacteria 4007
480 Ga0501036_0048666 3300049572 Bacteria 3589
481 Ga0501037_0014324 3300049573 Bacteria 5843
482 Ga0501037_0031685 3300049573 Bacteria 3904
483 Ga0501038_0079387 3300049574 Bacteria 2767
484 Ga0501039_0065083 3300049575 Bacteria 2827
485 Ga0501043_0013717 3300049579 Bacteria 6339
486 Ga0501043_0051405 3300049579 Bacteria 3238
487 Ga0501043_0123510 3300049579 Bacteria 2030
488 Ga0501046_0004460 3300049580 Bacteria 12696
489 Ga0501047_0049632 3300049581 Bacteria 4052
490 Ga0501047_0081864 3300049581 Bacteria 3103
491 Ga0501048_0024772 3300049582 Bacteria 4377
492 Ga0501070_0016632 3300049586 Bacteria 6179
493 Ga0501073_0021509 3300049589 Bacteria 4650
494 Ga0501074_0011049 3300049590 Bacteria 6554
495 Ga0501219_000038 3300049703 Bacteria 21298
496 Ga0501225_0014593 3300049705 Bacteria 2193
497 Ga0501080_0056751 3300049742 Bacteria 3645
498 Ga0501083_0023770 3300049744 Bacteria 4250
499 Ga0501035_0165835 3300049822 Bacteria 1910
500 Ga0501044_0005324 3300049823 Bacteria 14315
501 Ga0501044_0014176 3300049823 Bacteria 8608
502 Ga0501044_0042120 3300049823 Bacteria 4752
503 Ga0501044_0211989 3300049823 Bacteria 1891
504 Ga0501284_00117 3300050005 Bacteria 14553
505 nmdc:mga0k408_3745_c1 3300050493 Bacteria 8065
506 nmdc:mga0k408_46741_c1 3300050493 Bacteria 2500
507 nmdc:mga0k408_85211_c1 3300050493 Bacteria 1854
508 nmdc:mga05p37_3343_c1 3300050507 Bacteria 18701
509 nmdc:mga05p37_74163_c1 3300050507 Bacteria 4188
510 nmdc:mga09592_3240_c1 3300050508 Bacteria 13165
511 nmdc:mga0qj67_5946_c1 3300050509 Bacteria 8940
512 nmdc:mga06r32_9171_c1 3300050510 Bacteria 8917
513 nmdc:mga08y16_175013_c1 3300050511 Bacteria 2228
514 nmdc:mga08y16_219620_c1 3300050511 Bacteria 1968
515 nmdc:mga08y16_235721_c1 3300050511 Bacteria 1892
516 Ga0500578_0000155 3300053086 Bacteria 80380
517 Ga0500578_0013905 3300053086 Bacteria 5181
518 Ga0500646_0024319 3300053090 Bacteria 1631
519 Ga0500583_0000043 3300053092 Bacteria 81313
520 Ga0500583_0000795 3300053092 Bacteria 9125
521 Ga0500651_0101859 3300053093 Bacteria 1760
522 Ga0500556_0057293 3300053104 Bacteria 1426
523 Ga0500562_000029 3300053108 Bacteria 94705
524 Ga0500572_005910 3300053111 Bacteria 2786
525 Ga0500608_013238 3300053122 Bacteria 3650
526 Ga0500652_026545 3300053131 Bacteria 2231
527 Ga0500568_0000344 3300053139 Bacteria 36332
528 Ga0500568_0004937 3300053139 Bacteria 7014
529 Ga0500589_003010 3300053147 Bacteria 5896
530 Ga0500616_0006794 3300053153 Bacteria 7410
531 Ga0500622_0000711 3300053156 Bacteria 29208
532 Ga0500622_0001004 3300053156 Bacteria 23799
533 Ga0500636_0043964 3300053177 Bacteria 2636
534 Ga0500611_000033 3300053727 Bacteria 79214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053122 Ga0500608_013238 Ga0500608_013238_10_1038 339
2 iso_pu_bacteria 2643221667 2644372536 408
3 iso_pu_bacteria 2905999023 2905999887 408
4 3300005293 Ga0065715_10159944 Ga0065715_101599442 409
5 iso_pu_bacteria 2929177148 2929178639 409
6 iso_pu_bacteria 2945977869 2945981048 409
7 iso_pu_bacteria 2946013367 2946019550 409
8 iso_pu_bacteria 2643221600 2644011116 410
9 3300025972 Ga0207668_10058059 Ga0207668_100580591 411
10 3300003320 rootH2_10006476 rootH2_1000647612 413
11 3300025208 Ga0209436_104951 Ga0209436_1049512 413
12 3300025284 Ga0209130_1001213 Ga0209130_100121312 413
13 3300025302 Ga0207426_1003471 Ga0207426_10034714 413
14 3300053153 Ga0500616_0006794 Ga0500616_0006794_536_1777 413
15 3300053177 Ga0500636_0043964 Ga0500636_0043964_624_1865 413
16 3300009093 Ga0105240_10000075 Ga0105240_1000007536 414
17 3300009174 Ga0105241_10025697 Ga0105241_100256971 414
18 3300009545 Ga0105237_10000072 Ga0105237_1000007280 414
19 3300010375 Ga0105239_10000547 Ga0105239_1000054729 414
20 3300025911 Ga0207654_10015784 Ga0207654_100157842 414
21 3300025913 Ga0207695_10000055 Ga0207695_10000055168 414
22 3300025914 Ga0207671_10000451 Ga0207671_1000045129 414
23 3300037471 Ga0395905_0000208 Ga0395905_0000208_34258_35511 414
24 3300042876 Ga0451577_0000161 Ga0451577_0000161_56582_57826 414
25 3300044712 Ga0453684_0222897 Ga0453684_0222897_42_1289 415
26 3300048917 Ga0496114_0000296 Ga0496114_0000296_9798_11048 415
27 iso_pu_bacteria 2738541278 2738726334 415
28 iso_pu_bacteria 2818991444 2819588653 415
29 iso_pu_bacteria 2929154850 2929157666 415
30 3300032004 Ga0307414_10000104 Ga0307414_1000010429 416
31 3300009545 Ga0105237_10002461 Ga0105237_100024616 417
32 3300025914 Ga0207671_10000653 Ga0207671_1000065323 417
33 3300031251 Ga0265327_10021760 Ga0265327_100217603 417
34 3300031728 Ga0316578_10004211 Ga0316578_100042114 417
35 3300031733 Ga0316577_10010214 Ga0316577_100102144 417
36 3300032139 Ga0316580_10012070 Ga0316580_100120702 417
37 3300035398 Ga0316574_0088797 Ga0316574_0088797_678_1934 417
38 3300036712 Ga0316584_0062765 Ga0316584_0062765_199_1455 417
39 3300047472 Ga0495686_0000643 Ga0495686_0000643_42075_43337 417
40 3300003316 rootH1_10077283 rootH1_100772832 418
41 3300003320 rootH2_10015397 rootH2_100153974 418
42 3300003320 rootH2_10060022 rootH2_1006002210 418
43 3300003322 rootL2_10049203 rootL2_100492032 418
44 3300005327 Ga0070658_10000095 Ga0070658_1000009548 418
45 3300005327 Ga0070658_10214111 Ga0070658_102141111 418
46 3300005328 Ga0070676_10000252 Ga0070676_100002526 418
47 3300005328 Ga0070676_10061321 Ga0070676_100613212 418
48 3300005329 Ga0070683_100057007 Ga0070683_1000570071 418
49 3300005333 Ga0070677_10032680 Ga0070677_100326801 418
50 3300005334 Ga0068869_100172232 Ga0068869_1001722321 418
51 3300005338 Ga0068868_100000091 Ga0068868_10000009120 418
52 3300005338 Ga0068868_100022248 Ga0068868_1000222486 418
53 3300005341 Ga0070691_10023815 Ga0070691_100238152 418
54 3300005347 Ga0070668_100000043 Ga0070668_10000004355 418
55 3300005353 Ga0070669_100208733 Ga0070669_1002087331 418
56 3300005355 Ga0070671_100005102 Ga0070671_1000051024 418
57 3300005355 Ga0070671_100032076 Ga0070671_1000320762 418
58 3300005356 Ga0070674_100010396 Ga0070674_1000103964 418
59 3300005364 Ga0070673_100000283 Ga0070673_10000028313 418
60 3300005364 Ga0070673_100054398 Ga0070673_1000543982 418
61 3300005367 Ga0070667_100000254 Ga0070667_10000025448 418
62 3300005436 Ga0070713_100187878 Ga0070713_1001878781 418
63 3300005438 Ga0070701_10010013 Ga0070701_100100132 418
64 3300005456 Ga0070678_100029001 Ga0070678_1000290012 418
65 3300005457 Ga0070662_100015824 Ga0070662_1000158244 418
66 3300005459 Ga0068867_100004928 Ga0068867_1000049284 418
67 3300005535 Ga0070684_100133584 Ga0070684_1001335842 418
68 3300005539 Ga0068853_100000775 Ga0068853_1000007754 418
69 3300005543 Ga0070672_100000160 Ga0070672_10000016015 418
70 3300005548 Ga0070665_100000013 Ga0070665_100000013166 418
71 3300005548 Ga0070665_100000350 Ga0070665_10000035023 418
72 3300005563 Ga0068855_100021854 Ga0068855_1000218547 418
73 3300005563 Ga0068855_100023977 Ga0068855_1000239773 418
74 3300005563 Ga0068855_100028412 Ga0068855_1000284124 418
75 3300005564 Ga0070664_100071997 Ga0070664_1000719972 418
76 3300005578 Ga0068854_100014675 Ga0068854_1000146756 418
77 3300005614 Ga0068856_100042211 Ga0068856_1000422112 418
78 3300005618 Ga0068864_100001658 Ga0068864_1000016587 418
79 3300005718 Ga0068866_10053000 Ga0068866_100530002 418
80 3300005719 Ga0068861_100007548 Ga0068861_1000075482 418
81 3300005719 Ga0068861_100126826 Ga0068861_1001268261 418
82 3300005834 Ga0068851_10003603 Ga0068851_100036033 418
83 3300005842 Ga0068858_100000662 Ga0068858_1000006622 418
84 3300005842 Ga0068858_100110254 Ga0068858_1001102542 418
85 3300005843 Ga0068860_100003177 Ga0068860_10000317715 418
86 3300005843 Ga0068860_100003412 Ga0068860_10000341210 418
87 3300005843 Ga0068860_100176071 Ga0068860_1001760712 418
88 3300005843 Ga0068860_100290040 Ga0068860_1002900401 418
89 3300006237 Ga0097621_100003063 Ga0097621_1000030634 418
90 3300006237 Ga0097621_100025640 Ga0097621_1000256405 418
91 3300006237 Ga0097621_100169834 Ga0097621_1001698342 418
92 3300006358 Ga0068871_100023419 Ga0068871_1000234192 418
93 3300009093 Ga0105240_10000165 Ga0105240_10000165113 418
94 3300009093 Ga0105240_10000288 Ga0105240_1000028827 418
95 3300009093 Ga0105240_10000289 Ga0105240_1000028979 418
96 3300009093 Ga0105240_10033896 Ga0105240_100338963 418
97 3300009093 Ga0105240_10034751 Ga0105240_100347512 418
98 3300009093 Ga0105240_10067828 Ga0105240_100678282 418
99 3300009093 Ga0105240_10076357 Ga0105240_100763574 418
100 3300009094 Ga0111539_10068994 Ga0111539_100689944 418
101 3300009147 Ga0114129_10004929 Ga0114129_100049294 418
102 3300009147 Ga0114129_10031046 Ga0114129_100310464 418
103 3300009174 Ga0105241_10001610 Ga0105241_1000161010 418
104 3300009177 Ga0105248_10050581 Ga0105248_100505812 418
105 3300009545 Ga0105237_10000340 Ga0105237_1000034016 418
106 3300009545 Ga0105237_10005667 Ga0105237_1000566710 418
107 3300009545 Ga0105237_10008015 Ga0105237_100080155 418
108 3300009545 Ga0105237_10008332 Ga0105237_100083325 418
109 3300009545 Ga0105237_10056300 Ga0105237_100563005 418
110 3300009545 Ga0105237_10075770 Ga0105237_100757703 418
111 3300009545 Ga0105237_10186517 Ga0105237_101865172 418
112 3300009551 Ga0105238_10001478 Ga0105238_1000147822 418
113 3300009551 Ga0105238_10008668 Ga0105238_100086684 418
114 3300009551 Ga0105238_10069611 Ga0105238_100696114 418
115 3300009551 Ga0105238_10079785 Ga0105238_100797853 418
116 3300009553 Ga0105249_10010031 Ga0105249_100100316 418
117 3300010375 Ga0105239_10000299 Ga0105239_1000029918 418
118 3300010375 Ga0105239_10010274 Ga0105239_100102748 418
119 3300010375 Ga0105239_10021788 Ga0105239_100217886 418
120 3300010375 Ga0105239_10024438 Ga0105239_100244383 418
121 3300010375 Ga0105239_10026185 Ga0105239_100261854 418
122 3300010375 Ga0105239_10043151 Ga0105239_100431515 418
123 3300013100 Ga0157373_10105117 Ga0157373_101051172 418
124 3300013100 Ga0157373_10120433 Ga0157373_101204331 418
125 3300013104 Ga0157370_10019758 Ga0157370_100197585 418
126 3300013104 Ga0157370_10171780 Ga0157370_101717802 418
127 3300013104 Ga0157370_10272176 Ga0157370_102721761 418
128 3300013296 Ga0157374_10000007 Ga0157374_10000007215 418
129 3300013296 Ga0157374_10000084 Ga0157374_1000008423 418
130 3300013296 Ga0157374_10065071 Ga0157374_100650712 418
131 3300013296 Ga0157374_10091978 Ga0157374_100919782 418
132 3300013297 Ga0157378_10001872 Ga0157378_1000187215 418
133 3300013297 Ga0157378_10004531 Ga0157378_100045315 418
134 3300013297 Ga0157378_10020677 Ga0157378_100206771 418
135 3300013306 Ga0163162_10000113 Ga0163162_1000011343 418
136 3300013306 Ga0163162_10000798 Ga0163162_1000079824 418
137 3300013306 Ga0163162_10001528 Ga0163162_1000152819 418
138 3300013306 Ga0163162_10011055 Ga0163162_100110551 418
139 3300013306 Ga0163162_10013875 Ga0163162_100138753 418
140 3300013306 Ga0163162_10106249 Ga0163162_101062493 418
141 3300013307 Ga0157372_10004516 Ga0157372_100045168 418
142 3300013307 Ga0157372_10007391 Ga0157372_100073914 418
143 3300013307 Ga0157372_10011150 Ga0157372_100111506 418
144 3300013307 Ga0157372_10044093 Ga0157372_100440934 418
145 3300013308 Ga0157375_10000565 Ga0157375_1000056510 418
146 3300013308 Ga0157375_10003545 Ga0157375_100035456 418
147 3300014325 Ga0163163_10000306 Ga0163163_100003068 418
148 3300014325 Ga0163163_10103108 Ga0163163_101031081 418
149 3300014326 Ga0157380_10001396 Ga0157380_100013962 418
150 3300014326 Ga0157380_10031980 Ga0157380_100319805 418
151 3300014968 Ga0157379_10000245 Ga0157379_1000024522 418
152 3300014968 Ga0157379_10010385 Ga0157379_100103859 418
153 3300014969 Ga0157376_10001301 Ga0157376_1000130112 418
154 3300014969 Ga0157376_10003267 Ga0157376_100032679 418
155 3300014969 Ga0157376_10018158 Ga0157376_100181582 418
156 3300017792 Ga0163161_10001839 Ga0163161_100018396 418
157 3300017792 Ga0163161_10047481 Ga0163161_100474812 418
158 3300020078 Ga0206352_10476274 Ga0206352_104762741 418
159 3300025246 Ga0209646_1000727 Ga0209646_10007275 418
160 3300025302 Ga0207426_1000002 Ga0207426_1000002317 418
161 3300025321 Ga0207656_10000709 Ga0207656_100007097 418
162 3300025893 Ga0207682_10025161 Ga0207682_100251612 418
163 3300025907 Ga0207645_10000378 Ga0207645_100003785 418
164 3300025909 Ga0207705_10101490 Ga0207705_101014901 418
165 3300025911 Ga0207654_10060779 Ga0207654_100607792 418
166 3300025912 Ga0207707_10241094 Ga0207707_102410941 418
167 3300025913 Ga0207695_10000130 Ga0207695_1000013013 418
168 3300025913 Ga0207695_10000247 Ga0207695_10000247117 418
169 3300025913 Ga0207695_10001063 Ga0207695_1000106323 418
170 3300025913 Ga0207695_10025256 Ga0207695_100252564 418
171 3300025914 Ga0207671_10000456 Ga0207671_1000045628 418
172 3300025914 Ga0207671_10008037 Ga0207671_100080372 418
173 3300025914 Ga0207671_10011923 Ga0207671_100119232 418
174 3300025914 Ga0207671_10035339 Ga0207671_100353392 418
175 3300025914 Ga0207671_10082489 Ga0207671_100824892 418
176 3300025914 Ga0207671_10091590 Ga0207671_100915902 418
177 3300025918 Ga0207662_10005928 Ga0207662_100059284 418
178 3300025926 Ga0207659_10104225 Ga0207659_101042252 418
179 3300025931 Ga0207644_10012863 Ga0207644_100128635 418
180 3300025934 Ga0207686_10036405 Ga0207686_100364051 418
181 3300025937 Ga0207669_10007669 Ga0207669_100076693 418
182 3300025937 Ga0207669_10044083 Ga0207669_100440832 418
183 3300025940 Ga0207691_10010582 Ga0207691_100105827 418
184 3300025941 Ga0207711_10040585 Ga0207711_100405852 418
185 3300025942 Ga0207689_10074631 Ga0207689_100746313 418
186 3300025942 Ga0207689_10091162 Ga0207689_100911622 418
187 3300025944 Ga0207661_10022714 Ga0207661_100227145 418
188 3300025945 Ga0207679_10058779 Ga0207679_100587792 418
189 3300025949 Ga0207667_10000876 Ga0207667_1000087637 418
190 3300025949 Ga0207667_10014139 Ga0207667_100141393 418
191 3300025949 Ga0207667_10065810 Ga0207667_100658105 418
192 3300025949 Ga0207667_10167305 Ga0207667_101673052 418
193 3300025960 Ga0207651_10001142 Ga0207651_100011429 418
194 3300025972 Ga0207668_10000821 Ga0207668_100008215 418
195 3300025986 Ga0207658_10000176 Ga0207658_1000017655 418
196 3300025986 Ga0207658_10059670 Ga0207658_100596702 418
197 3300026023 Ga0207677_10002439 Ga0207677_100024395 418
198 3300026023 Ga0207677_10170519 Ga0207677_101705191 418
199 3300026035 Ga0207703_10015388 Ga0207703_100153882 418
200 3300026035 Ga0207703_10141168 Ga0207703_101411681 418
201 3300026041 Ga0207639_10002156 Ga0207639_100021562 418
202 3300026041 Ga0207639_10023922 Ga0207639_100239225 418
203 3300026041 Ga0207639_10295631 Ga0207639_102956311 418
204 3300026078 Ga0207702_10031921 Ga0207702_100319213 418
205 3300026089 Ga0207648_10003650 Ga0207648_1000365015 418
206 3300026089 Ga0207648_10210911 Ga0207648_102109111 418
207 3300026095 Ga0207676_10002713 Ga0207676_100027137 418
208 3300026116 Ga0207674_10279698 Ga0207674_102796981 418
209 3300026118 Ga0207675_100014076 Ga0207675_1000140762 418
210 3300026118 Ga0207675_100178128 Ga0207675_1001781281 418
211 3300026121 Ga0207683_10075011 Ga0207683_100750112 418
212 3300026142 Ga0207698_10002781 Ga0207698_100027816 418
213 3300028379 Ga0268266_10000024 Ga0268266_10000024235 418
214 3300028379 Ga0268266_10010154 Ga0268266_100101546 418
215 3300028381 Ga0268264_10001731 Ga0268264_100017317 418
216 3300028381 Ga0268264_10002252 Ga0268264_100022524 418
217 3300028786 Ga0307517_10002335 Ga0307517_1000233518 418
218 3300031456 Ga0307513_10039327 Ga0307513_100393276 418
219 3300031730 Ga0307516_10167432 Ga0307516_101674322 418
220 3300031903 Ga0307407_10014107 Ga0307407_100141072 418
221 3300033180 Ga0307510_10013038 Ga0307510_100130385 418
222 3300035695 Ga0373927_0010011 Ga0373927_0010011_435_1691 418
223 3300036401 Ga0373937_0319720 Ga0373937_0319720_139_1395 418
224 3300042007 Ga0439449_0003552 Ga0439449_0003552_3922_5178 418
225 3300042014 Ga0439457_005643 Ga0439457_005643_386_1642 418
226 3300044658 Ga0466972_0000013 Ga0466972_0000013_116606_117967 418
227 3300044658 Ga0466972_0012242 Ga0466972_0012242_2528_3784 418
228 3300044658 Ga0466972_0019471 Ga0466972_0019471_2127_3383 418
229 3300044706 Ga0466964_0026864 Ga0466964_0026864_448_1704 418
230 3300044765 Ga0466970_0097727 Ga0466970_0097727_150_1406 418
231 3300044842 Ga0466957_0008353 Ga0466957_0008353_463_1719 418
232 3300044842 Ga0466957_0010389 Ga0466957_0010389_3701_4957 418
233 3300046476 Ga0495662_0028681 Ga0495662_0028681_799_2055 418
234 3300046507 Ga0495606_0008820 Ga0495606_0008820_3233_4489 418
235 3300046517 Ga0495630_0153039 Ga0495630_0153039_127_1383 418
236 3300046524 Ga0495648_0001379 Ga0495648_0001379_18159_19415 418
237 3300046616 Ga0495668_0001191 Ga0495668_0001191_19254_20510 418
238 3300046648 Ga0495611_0000089 Ga0495611_0000089_6400_7656 418
239 3300047315 Ga0495581_0058057 Ga0495581_0058057_898_2154 418
240 3300047319 Ga0495674_0164895 Ga0495674_0164895_144_1400 418
241 3300047443 Ga0495687_000014 Ga0495687_000014_105801_107057 418
242 3300047472 Ga0495686_0000034 Ga0495686_0000034_245215_246471 418
243 3300048904 Ga0496101_0047453 Ga0496101_0047453_28_1284 418
244 3300048907 Ga0496104_0169058 Ga0496104_0169058_141_1397 418
245 3300048918 Ga0496115_0094735 Ga0496115_0094735_808_2064 418
246 3300049569 Ga0501032_0014723 Ga0501032_0014723_671_1927 418
247 3300049570 Ga0501033_0037062 Ga0501033_0037062_1842_3098 418
248 3300049571 Ga0501034_0019915 Ga0501034_0019915_5055_6311 418
249 3300049571 Ga0501034_0029020 Ga0501034_0029020_612_1868 418
250 3300049573 Ga0501037_0014324 Ga0501037_0014324_976_2232 418
251 3300049579 Ga0501043_0051405 Ga0501043_0051405_757_2205 418
252 3300049579 Ga0501043_0123510 Ga0501043_0123510_32_1288 418
253 3300049581 Ga0501047_0049632 Ga0501047_0049632_41_1297 418
254 3300049581 Ga0501047_0081864 Ga0501047_0081864_1281_2537 418
255 3300049705 Ga0501225_0014593 Ga0501225_0014593_487_1743 418
256 3300049822 Ga0501035_0165835 Ga0501035_0165835_643_1899 418
257 3300049823 Ga0501044_0005324 Ga0501044_0005324_9392_10648 418
258 3300049823 Ga0501044_0211989 Ga0501044_0211989_304_1560 418
259 3300050507 nmdc:mga05p37_3343_c1 nmdc:mga05p37_3343_c1_15586_16842 418
260 3300050511 nmdc:mga08y16_219620_c1 nmdc:mga08y16_219620_c1_277_1569 418
261 3300053086 Ga0500578_0000155 Ga0500578_0000155_11647_12903 418
262 3300053086 Ga0500578_0013905 Ga0500578_0013905_3062_4318 418
263 3300053090 Ga0500646_0024319 Ga0500646_0024319_172_1428 418
264 3300053092 Ga0500583_0000043 Ga0500583_0000043_61434_62690 418
265 3300053092 Ga0500583_0000795 Ga0500583_0000795_731_1987 418
266 3300053093 Ga0500651_0101859 Ga0500651_0101859_239_1495 418
267 3300053104 Ga0500556_0057293 Ga0500556_0057293_26_1282 418
268 3300053111 Ga0500572_005910 Ga0500572_005910_566_1822 418
269 3300053131 Ga0500652_026545 Ga0500652_026545_157_1413 418
270 3300053139 Ga0500568_0004937 Ga0500568_0004937_3347_4603 418
271 3300053147 Ga0500589_003010 Ga0500589_003010_3964_5220 418
272 3300053156 Ga0500622_0000711 Ga0500622_0000711_14932_16188 418
273 3300003203 JGI25406J46586_10002443 JGI25406J46586_100024437 419
274 3300003320 rootH2_10004251 rootH2_100042517 419
275 3300003320 rootH2_10100492 rootH2_101004928 419
276 3300003323 rootH1_10010378 rootH1_1001037823 419
277 3300005289 Ga0065704_10099338 Ga0065704_100993382 419
278 3300005289 Ga0065704_10119336 Ga0065704_101193362 419
279 3300005290 Ga0065712_10001125 Ga0065712_100011254 419
280 3300005329 Ga0070683_100008690 Ga0070683_1000086901 419
281 3300005329 Ga0070683_100045191 Ga0070683_1000451914 419
282 3300005329 Ga0070683_100199335 Ga0070683_1001993351 419
283 3300005330 Ga0070690_100073297 Ga0070690_1000732972 419
284 3300005334 Ga0068869_100001288 Ga0068869_10000128810 419
285 3300005334 Ga0068869_100019691 Ga0068869_1000196913 419
286 3300005334 Ga0068869_100036058 Ga0068869_1000360582 419
287 3300005338 Ga0068868_100014538 Ga0068868_1000145383 419
288 3300005338 Ga0068868_100020279 Ga0068868_1000202795 419
289 3300005338 Ga0068868_100043518 Ga0068868_1000435183 419
290 3300005340 Ga0070689_100003775 Ga0070689_1000037753 419
291 3300005340 Ga0070689_100082320 Ga0070689_1000823201 419
292 3300005344 Ga0070661_100004533 Ga0070661_1000045338 419
293 3300005344 Ga0070661_100063212 Ga0070661_1000632123 419
294 3300005344 Ga0070661_100074356 Ga0070661_1000743562 419
295 3300005347 Ga0070668_100132293 Ga0070668_1001322932 419
296 3300005353 Ga0070669_100001290 Ga0070669_10000129014 419
297 3300005354 Ga0070675_100001568 Ga0070675_1000015684 419
298 3300005354 Ga0070675_100074307 Ga0070675_1000743074 419
299 3300005355 Ga0070671_100038329 Ga0070671_1000383294 419
300 3300005355 Ga0070671_100086070 Ga0070671_1000860703 419
301 3300005364 Ga0070673_100010965 Ga0070673_1000109655 419
302 3300005365 Ga0070688_100007499 Ga0070688_1000074995 419
303 3300005365 Ga0070688_100036312 Ga0070688_1000363122 419
304 3300005366 Ga0070659_100068688 Ga0070659_1000686883 419
305 3300005366 Ga0070659_100127904 Ga0070659_1001279041 419
306 3300005367 Ga0070667_100036575 Ga0070667_1000365752 419
307 3300005441 Ga0070700_100079782 Ga0070700_1000797822 419
308 3300005456 Ga0070678_100009678 Ga0070678_1000096782 419
309 3300005456 Ga0070678_100016467 Ga0070678_1000164673 419
310 3300005457 Ga0070662_100147322 Ga0070662_1001473221 419
311 3300005458 Ga0070681_10226055 Ga0070681_102260551 419
312 3300005459 Ga0068867_100006379 Ga0068867_1000063794 419
313 3300005459 Ga0068867_100013641 Ga0068867_1000136411 419
314 3300005466 Ga0070685_10045641 Ga0070685_100456413 419
315 3300005471 Ga0070698_100000392 Ga0070698_1000003922 419
316 3300005471 Ga0070698_100018803 Ga0070698_10001880310 419
317 3300005535 Ga0070684_100001451 Ga0070684_10000145112 419
318 3300005535 Ga0070684_100015304 Ga0070684_1000153042 419
319 3300005535 Ga0070684_100187380 Ga0070684_1001873801 419
320 3300005539 Ga0068853_100001183 Ga0068853_10000118311 419
321 3300005543 Ga0070672_100031030 Ga0070672_1000310302 419
322 3300005548 Ga0070665_100041482 Ga0070665_1000414823 419
323 3300005564 Ga0070664_100007172 Ga0070664_1000071726 419
324 3300005564 Ga0070664_100111932 Ga0070664_1001119322 419
325 3300005577 Ga0068857_100029027 Ga0068857_1000290274 419
326 3300005578 Ga0068854_100099345 Ga0068854_1000993452 419
327 3300005616 Ga0068852_100001112 Ga0068852_1000011122 419
328 3300005616 Ga0068852_100087125 Ga0068852_1000871252 419
329 3300005616 Ga0068852_100120225 Ga0068852_1001202253 419
330 3300005617 Ga0068859_100013629 Ga0068859_1000136296 419
331 3300005617 Ga0068859_100050546 Ga0068859_1000505463 419
332 3300005618 Ga0068864_100002233 Ga0068864_10000223315 419
333 3300005618 Ga0068864_100049539 Ga0068864_1000495393 419
334 3300005618 Ga0068864_100058315 Ga0068864_1000583154 419
335 3300005718 Ga0068866_10055609 Ga0068866_100556092 419
336 3300005841 Ga0068863_100009683 Ga0068863_1000096831 419
337 3300005843 Ga0068860_100016858 Ga0068860_1000168582 419
338 3300005843 Ga0068860_100098808 Ga0068860_1000988083 419
339 3300005843 Ga0068860_100124190 Ga0068860_1001241902 419
340 3300005843 Ga0068860_100268600 Ga0068860_1002686002 419
341 3300005844 Ga0068862_100005117 Ga0068862_1000051174 419
342 3300005985 Ga0081539_10000523 Ga0081539_1000052354 419
343 3300006195 Ga0075366_10048280 Ga0075366_100482802 419
344 3300006195 Ga0075366_10089759 Ga0075366_100897592 419
345 3300006237 Ga0097621_100040839 Ga0097621_1000408391 419
346 3300006358 Ga0068871_100075229 Ga0068871_1000752293 419
347 3300006880 Ga0075429_100002343 Ga0075429_10000234313 419
348 3300006881 Ga0068865_100098352 Ga0068865_1000983521 419
349 3300006931 Ga0097620_100013629 Ga0097620_1000136296 419
350 3300006931 Ga0097620_100050542 Ga0097620_1000505423 419
351 3300009094 Ga0111539_10104927 Ga0111539_101049273 419
352 3300009094 Ga0111539_10174847 Ga0111539_101748471 419
353 3300009101 Ga0105247_10003123 Ga0105247_1000312310 419
354 3300009147 Ga0114129_10040254 Ga0114129_100402544 419
355 3300009174 Ga0105241_10093784 Ga0105241_100937841 419
356 3300009176 Ga0105242_10008487 Ga0105242_100084871 419
357 3300009176 Ga0105242_10016344 Ga0105242_100163443 419
358 3300009176 Ga0105242_10082120 Ga0105242_100821202 419
359 3300009177 Ga0105248_10110092 Ga0105248_101100922 419
360 3300009553 Ga0105249_10000651 Ga0105249_1000065113 419
361 3300009553 Ga0105249_10000793 Ga0105249_1000079316 419
362 3300009553 Ga0105249_10000820 Ga0105249_1000082020 419
363 3300009553 Ga0105249_10025615 Ga0105249_100256152 419
364 3300009553 Ga0105249_10059211 Ga0105249_100592111 419
365 3300009553 Ga0105249_10077985 Ga0105249_100779852 419
366 3300011119 Ga0105246_10024929 Ga0105246_100249293 419
367 3300011119 Ga0105246_10113710 Ga0105246_101137101 419
368 3300013100 Ga0157373_10029609 Ga0157373_100296093 419
369 3300013102 Ga0157371_10012607 Ga0157371_100126072 419
370 3300013102 Ga0157371_10021535 Ga0157371_100215352 419
371 3300013104 Ga0157370_10085476 Ga0157370_100854761 419
372 3300013105 Ga0157369_10090507 Ga0157369_100905073 419
373 3300013296 Ga0157374_10000411 Ga0157374_1000041126 419
374 3300013296 Ga0157374_10035513 Ga0157374_100355134 419
375 3300013296 Ga0157374_10040433 Ga0157374_100404331 419
376 3300013296 Ga0157374_10046446 Ga0157374_100464463 419
377 3300013296 Ga0157374_10078294 Ga0157374_100782943 419
378 3300013296 Ga0157374_10118575 Ga0157374_101185753 419
379 3300013296 Ga0157374_10233483 Ga0157374_102334831 419
380 3300013297 Ga0157378_10035023 Ga0157378_100350234 419
381 3300013297 Ga0157378_10058554 Ga0157378_100585542 419
382 3300013297 Ga0157378_10063749 Ga0157378_100637491 419
383 3300013306 Ga0163162_10007598 Ga0163162_100075981 419
384 3300013306 Ga0163162_10122178 Ga0163162_101221781 419
385 3300013306 Ga0163162_10122376 Ga0163162_101223762 419
386 3300013307 Ga0157372_10009637 Ga0157372_100096378 419
387 3300013307 Ga0157372_10082979 Ga0157372_100829792 419
388 3300013307 Ga0157372_10130098 Ga0157372_101300983 419
389 3300013307 Ga0157372_10134205 Ga0157372_101342051 419
390 3300013307 Ga0157372_10158798 Ga0157372_101587982 419
391 3300013307 Ga0157372_10174220 Ga0157372_101742202 419
392 3300013307 Ga0157372_10298707 Ga0157372_102987072 419
393 3300013308 Ga0157375_10018067 Ga0157375_100180677 419
394 3300013308 Ga0157375_10086647 Ga0157375_100866472 419
395 3300013308 Ga0157375_10124418 Ga0157375_101244183 419
396 3300013308 Ga0157375_10149322 Ga0157375_101493222 419
397 3300014325 Ga0163163_10000261 Ga0163163_1000026152 419
398 3300014325 Ga0163163_10001534 Ga0163163_100015345 419
399 3300014326 Ga0157380_10019868 Ga0157380_100198683 419
400 3300014326 Ga0157380_10161341 Ga0157380_101613412 419
401 3300014745 Ga0157377_10007191 Ga0157377_100071913 419
402 3300014968 Ga0157379_10007467 Ga0157379_100074672 419
403 3300014968 Ga0157379_10046961 Ga0157379_100469612 419
404 3300017792 Ga0163161_10015534 Ga0163161_100155345 419
405 3300017792 Ga0163161_10077809 Ga0163161_100778092 419
406 3300017792 Ga0163161_10088856 Ga0163161_100888563 419
407 3300021384 Ga0213876_10003289 Ga0213876_100032893 419
408 3300025321 Ga0207656_10073784 Ga0207656_100737841 419
409 3300025893 Ga0207682_10030993 Ga0207682_100309931 419
410 3300025899 Ga0207642_10025660 Ga0207642_100256602 419
411 3300025899 Ga0207642_10089703 Ga0207642_100897031 419
412 3300025900 Ga0207710_10000906 Ga0207710_1000090615 419
413 3300025901 Ga0207688_10013278 Ga0207688_100132783 419
414 3300025903 Ga0207680_10016637 Ga0207680_100166373 419
415 3300025904 Ga0207647_10000054 Ga0207647_1000005467 419
416 3300025907 Ga0207645_10000278 Ga0207645_1000027819 419
417 3300025907 Ga0207645_10030209 Ga0207645_100302093 419
418 3300025907 Ga0207645_10064816 Ga0207645_100648162 419
419 3300025908 Ga0207643_10002813 Ga0207643_100028137 419
420 3300025918 Ga0207662_10038858 Ga0207662_100388583 419
421 3300025919 Ga0207657_10003973 Ga0207657_1000397313 419
422 3300025920 Ga0207649_10013994 Ga0207649_100139941 419
423 3300025921 Ga0207652_10316774 Ga0207652_103167742 419
424 3300025925 Ga0207650_10041637 Ga0207650_100416372 419
425 3300025925 Ga0207650_10093314 Ga0207650_100933142 419
426 3300025926 Ga0207659_10052222 Ga0207659_100522222 419
427 3300025926 Ga0207659_10064231 Ga0207659_100642312 419
428 3300025932 Ga0207690_10093907 Ga0207690_100939072 419
429 3300025933 Ga0207706_10003195 Ga0207706_100031951 419
430 3300025933 Ga0207706_10015689 Ga0207706_100156897 419
431 3300025933 Ga0207706_10035893 Ga0207706_100358936 419
432 3300025936 Ga0207670_10099850 Ga0207670_100998502 419
433 3300025938 Ga0207704_10082999 Ga0207704_100829992 419
434 3300025940 Ga0207691_10057424 Ga0207691_100574244 419
435 3300025940 Ga0207691_10075257 Ga0207691_100752571 419
436 3300025942 Ga0207689_10002097 Ga0207689_100020975 419
437 3300025942 Ga0207689_10002261 Ga0207689_1000226113 419
438 3300025942 Ga0207689_10006534 Ga0207689_100065347 419
439 3300025942 Ga0207689_10053967 Ga0207689_100539672 419
440 3300025942 Ga0207689_10056212 Ga0207689_100562122 419
441 3300025942 Ga0207689_10068591 Ga0207689_100685911 419
442 3300025942 Ga0207689_10074059 Ga0207689_100740592 419
443 3300025942 Ga0207689_10112919 Ga0207689_101129192 419
444 3300025944 Ga0207661_10004373 Ga0207661_1000437310 419
445 3300025945 Ga0207679_10001000 Ga0207679_1000100026 419
446 3300025945 Ga0207679_10006064 Ga0207679_100060647 419
447 3300025945 Ga0207679_10008382 Ga0207679_100083821 419
448 3300025945 Ga0207679_10154822 Ga0207679_101548221 419
449 3300025945 Ga0207679_10206669 Ga0207679_102066691 419
450 3300025949 Ga0207667_10226312 Ga0207667_102263122 419
451 3300025960 Ga0207651_10172148 Ga0207651_101721481 419
452 3300025960 Ga0207651_10209065 Ga0207651_102090651 419
453 3300025961 Ga0207712_10001144 Ga0207712_1000114417 419
454 3300025961 Ga0207712_10002226 Ga0207712_100022263 419
455 3300025961 Ga0207712_10003360 Ga0207712_100033602 419
456 3300025961 Ga0207712_10189079 Ga0207712_101890792 419
457 3300025981 Ga0207640_10056771 Ga0207640_100567713 419
458 3300025986 Ga0207658_10036627 Ga0207658_100366273 419
459 3300026023 Ga0207677_10112793 Ga0207677_101127931 419
460 3300026035 Ga0207703_10108540 Ga0207703_101085402 419
461 3300026041 Ga0207639_10128706 Ga0207639_101287062 419
462 3300026075 Ga0207708_10074080 Ga0207708_100740802 419
463 3300026088 Ga0207641_10001688 Ga0207641_100016884 419
464 3300026088 Ga0207641_10046151 Ga0207641_100461513 419
465 3300026089 Ga0207648_10000559 Ga0207648_1000055921 419
466 3300026089 Ga0207648_10001588 Ga0207648_1000158820 419
467 3300026095 Ga0207676_10002891 Ga0207676_100028916 419
468 3300026095 Ga0207676_10251495 Ga0207676_102514952 419
469 3300026116 Ga0207674_10027837 Ga0207674_100278376 419
470 3300026116 Ga0207674_10142782 Ga0207674_101427822 419
471 3300026118 Ga0207675_100000304 Ga0207675_10000030429 419
472 3300026118 Ga0207675_100024456 Ga0207675_1000244563 419
473 3300026118 Ga0207675_100114633 Ga0207675_1001146332 419
474 3300026121 Ga0207683_10002440 Ga0207683_100024406 419
475 3300026121 Ga0207683_10004324 Ga0207683_1000432412 419
476 3300026121 Ga0207683_10131401 Ga0207683_101314012 419
477 3300026142 Ga0207698_10020311 Ga0207698_100203113 419
478 3300026142 Ga0207698_10128842 Ga0207698_101288422 419
479 3300027907 Ga0207428_10112997 Ga0207428_101129972 419
480 3300028381 Ga0268264_10144514 Ga0268264_101445141 419
481 3300028381 Ga0268264_10198412 Ga0268264_101984121 419
482 3300028381 Ga0268264_10293829 Ga0268264_102938291 419
483 3300030521 Ga0307511_10003820 Ga0307511_100038209 419
484 3300031251 Ga0265327_10000030 Ga0265327_10000030146 419
485 3300036401 Ga0373937_0018980 Ga0373937_0018980_3248_4549 419
486 3300037418 Ga0395900_0064108 Ga0395900_0064108_1426_2685 419
487 3300037471 Ga0395905_0018145 Ga0395905_0018145_1877_3136 419
488 3300037471 Ga0395905_0040566 Ga0395905_0040566_231_1490 419
489 3300039437 Ga0436365_0103853 Ga0436365_0103853_44296_45555 419
490 3300039437 Ga0436365_0671234 Ga0436365_0671234_831_2093 419
491 3300039437 Ga0436365_1331410 Ga0436365_1331410_88_1389 419
492 3300042435 Ga0439434_0040474 Ga0439434_0040474_80_1354 419
493 3300042876 Ga0451577_0302155 Ga0451577_0302155_162_1421 419
494 3300044656 Ga0466969_0001097 Ga0466969_0001097_8718_10148 419
495 3300044658 Ga0466972_0000003 Ga0466972_0000003_26637_27896 419
496 3300044684 Ga0466966_0000045 Ga0466966_0000045_37527_38789 419
497 3300044693 Ga0466961_0126809 Ga0466961_0126809_103_1365 419
498 3300044712 Ga0453684_0072226 Ga0453684_0072226_830_2131 419
499 3300044712 Ga0453684_0114669 Ga0453684_0114669_1265_2524 419
500 3300044901 Ga0466960_0109696 Ga0466960_0109696_68_1330 419
501 3300045049 Ga0466959_0000023 Ga0466959_0000023_43702_44964 419
502 3300045051 Ga0451576_0186228 Ga0451576_0186228_62_1363 419
503 3300046517 Ga0495630_0091061 Ga0495630_0091061_928_2229 419
504 3300046537 Ga0495598_0021199 Ga0495598_0021199_324_1625 419
505 3300046642 Ga0495634_0045674 Ga0495634_0045674_479_1780 419
506 3300046648 Ga0495611_0031855 Ga0495611_0031855_942_2243 419
507 3300047471 Ga0495684_0079664 Ga0495684_0079664_705_2006 419
508 3300047472 Ga0495686_0017423 Ga0495686_0017423_2672_3973 419
509 3300048914 Ga0496111_0162693 Ga0496111_0162693_264_1565 419
510 3300049569 Ga0501032_0034134 Ga0501032_0034134_1309_2631 419
511 3300049570 Ga0501033_0153187 Ga0501033_0153187_51_1310 419
512 3300049571 Ga0501034_0008720 Ga0501034_0008720_2512_3834 419
513 3300049572 Ga0501036_0039245 Ga0501036_0039245_2187_3509 419
514 3300049572 Ga0501036_0048666 Ga0501036_0048666_44_1315 419
515 3300049573 Ga0501037_0031685 Ga0501037_0031685_188_1459 419
516 3300049574 Ga0501038_0079387 Ga0501038_0079387_142_1464 419
517 3300049575 Ga0501039_0065083 Ga0501039_0065083_472_1743 419
518 3300049579 Ga0501043_0013717 Ga0501043_0013717_2355_3677 419
519 3300049580 Ga0501046_0004460 Ga0501046_0004460_1850_3172 419
520 3300049582 Ga0501048_0024772 Ga0501048_0024772_2498_3820 419
521 3300049586 Ga0501070_0016632 Ga0501070_0016632_2641_3963 419
522 3300049589 Ga0501073_0021509 Ga0501073_0021509_3272_4594 419
523 3300049590 Ga0501074_0011049 Ga0501074_0011049_5176_6498 419
524 3300049703 Ga0501219_000038 Ga0501219_000038_8643_9905 419
525 3300049742 Ga0501080_0056751 Ga0501080_0056751_473_1795 419
526 3300049744 Ga0501083_0023770 Ga0501083_0023770_2559_3881 419
527 3300049823 Ga0501044_0014176 Ga0501044_0014176_1559_2881 419
528 3300049823 Ga0501044_0042120 Ga0501044_0042120_1895_3346 419
529 3300050005 Ga0501284_00117 Ga0501284_00117_1825_3087 419
530 3300050493 nmdc:mga0k408_3745_c1 nmdc:mga0k408_3745_c1_5544_6845 419
531 3300050493 nmdc:mga0k408_46741_c1 nmdc:mga0k408_46741_c1_1051_2352 419
532 3300050493 nmdc:mga0k408_85211_c1 nmdc:mga0k408_85211_c1_360_1631 419
533 3300050507 nmdc:mga05p37_74163_c1 nmdc:mga05p37_74163_c1_1143_2444 419
534 3300050508 nmdc:mga09592_3240_c1 nmdc:mga09592_3240_c1_1059_2360 419
535 3300050509 nmdc:mga0qj67_5946_c1 nmdc:mga0qj67_5946_c1_1229_2530 419
536 3300050510 nmdc:mga06r32_9171_c1 nmdc:mga06r32_9171_c1_2621_3922 419
537 3300050511 nmdc:mga08y16_175013_c1 nmdc:mga08y16_175013_c1_111_1412 419
538 3300050511 nmdc:mga08y16_235721_c1 nmdc:mga08y16_235721_c1_105_1406 419
539 3300053108 Ga0500562_000029 Ga0500562_000029_53977_55239 419
540 3300053139 Ga0500568_0000344 Ga0500568_0000344_20447_21709 419
541 3300053156 Ga0500622_0001004 Ga0500622_0001004_9199_10458 419
542 3300053727 Ga0500611_000033 Ga0500611_000033_11016_12317 419

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

108

459

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u7h-assembly3.cif.gz_E cysteate acyl-acp transferase from alistipes finegoldii 0.9515 1 407
7u7h-assembly2.cif.gz_F-2 cysteate acyl-acp transferase from alistipes finegoldii 0.951 1 407
7u7h-assembly2.cif.gz_C cysteate acyl-acp transferase from alistipes finegoldii 0.9417 1 407
7u7h-assembly3.cif.gz_D cysteate acyl-acp transferase from alistipes finegoldii 0.9416 1 405
7u7h-assembly2.cif.gz_C cysteate acyl-acp transferase from alistipes finegoldii 0.9304 1 407
ID Description Score Start End Superfamily
3a2bA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9423 306 401 3.90.1150.10
af_Q8ILT9_206_445_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.937 53 297 3.40.640.10
af_Q8ILT9_206_445_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9296 53 297 3.40.640.10
af_Q2G0M8_60_294_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9289 64 298 3.40.640.10
af_Q2G0M8_295_394_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9287 306 403 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A3M1NG27-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9883 193 407 GO:0008483
GO:0009058
GO:0030170
AF-A0A3D3K1I7-F1-model_v4 8-amino-7-oxononanoate synthase 0.9865 168 411 GO:0009058
GO:0016740
GO:0030170
AF-A0A519L1Z1-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9784 252 408 GO:0008483
GO:0009058
GO:0030170
AF-A0A3D6CIU5-F1-model_v4 8-amino-7-oxononanoate synthase 0.9753 281 411 GO:0009058
GO:0030170
AF-A0A3B0V194-F1-model_v4 2-amino-3-ketobutyrate coenzyme A ligase (EC 2.3.1.29) 0.975 59 411 GO:0008890
GO:0009058
GO:0016874
GO:0030170

Feature Viewer

pLDDT pTM Quality
87.47 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map