F461554

General Info

Members Datasets Scaffolds Average Seq Length
542 501 174 358

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_111022_c1|nmdc:mga0rr50_111022_c1_861_1934
Length 357
Sequence MIMRKSELNRRARLRVGRRTMLAGMAALAGTTVLGFPAIRVRAAQTLKVGTYGGYFKDSFDQHIYPDFTKETGIEVESIAEPTGEAWLVQLDQAARGGVAPADISMMAQVTRLKGQSAKLWAPLDESKLPNTKNLYDHFVARYDDQKIAALGAVSWYITLVTNTKVYPTPPNSWKELWNPANKGKIGLLALASNSFLLEITSKTWFGGTDLLGSQEGIEKALAKLAEVKPNVALWYRDEGQFQHDVTGLAASQGQPVRSTFPQEGGVLDSGSWCVSKASKALDEAHAFINYMCRPDIQAKLSRNVGTAPTVKRELLDLNPKEFAAVASDIPPIIPRYDLYATRDDWLNQKWTELIAG

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
6 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
7 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
8 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
9 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
10 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
11 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
12 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
13 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
14 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
15 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
16 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
17 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
18 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
19 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
20 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
21 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
22 2516143018 Ensifer sp. BR816 Isolate Nodule
23 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
24 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
25 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
26 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
27 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
28 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
29 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
30 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
31 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
32 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
33 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
34 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
35 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
36 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
37 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
38 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
39 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
40 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
41 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
42 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
43 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
44 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
45 2643221557 Ensifer sp. Root558 Isolate Unclassified
46 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
47 2643221607 Rhizobium sp. Root73 Isolate Unclassified
48 2643221610 Ensifer sp. Root74 Isolate Unclassified
49 2643221618 Ensifer sp. Root231 Isolate Unclassified
50 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
51 2643221626 Ensifer sp. Root31 Isolate Unclassified
52 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
53 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
54 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
55 2643221655 Ensifer sp. Root1252 Isolate Unclassified
56 2643221659 Ensifer sp. Root127 Isolate Unclassified
57 2643221668 Ensifer sp. Root423 Isolate Unclassified
58 2643221675 Ensifer sp. Root1298 Isolate Unclassified
59 2643221680 Ensifer sp. Root1312 Isolate Unclassified
60 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
61 2643221688 Rhizobium sp. Root482 Isolate Unclassified
62 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
63 2643221698 Ensifer sp. Root142 Isolate Unclassified
64 2643221712 Ensifer sp. Root258 Isolate Unclassified
65 2643221718 Rhizobium sp. Root268 Isolate Unclassified
66 2643221719 Rhizobium sp. Root274 Isolate Unclassified
67 2643221723 Ensifer sp. Root278 Isolate Unclassified
68 2643221726 Ensifer sp. Root954 Isolate Unclassified
69 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
70 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
71 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
72 2738543024 Aminobacter sp. AP02 Isolate Unclassified
73 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
74 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
75 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
76 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
77 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
78 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
79 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
80 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
81 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
82 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
83 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
84 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
85 2791355260 Rhizobium sp. L9 Isolate Nodule
86 2791355264 Rhizobium sp. S9 Isolate Nodule
87 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
88 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
89 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
90 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
91 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
92 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
93 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
94 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
95 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
96 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
97 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
98 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
99 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
100 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
101 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
102 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
103 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
104 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
105 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
106 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
107 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
108 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
109 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
110 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
111 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
112 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
113 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
114 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
115 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
116 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
117 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
118 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
119 2844163670 Ensifer sp. 1H6 Isolate Unclassified
120 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
121 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
122 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
123 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
124 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
125 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
126 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
127 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
128 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
129 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
130 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
131 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
132 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
133 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
134 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
135 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
136 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
137 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
138 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
139 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
140 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
141 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
142 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
143 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
144 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
145 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
146 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
147 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
148 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
149 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
150 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
151 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
152 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
153 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
154 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
155 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
156 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
157 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
158 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
159 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
160 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
161 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
162 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
163 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
164 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
165 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
166 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
167 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
168 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
169 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
170 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
171 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
172 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
173 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
174 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
175 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
176 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
177 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
178 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
179 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
180 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
181 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
182 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
183 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
184 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
185 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
186 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
187 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
188 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
189 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
190 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
191 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
192 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
193 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
194 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
195 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
196 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
197 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
198 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
199 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
200 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
201 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
202 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
203 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
204 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
205 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
206 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
207 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
208 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
209 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
210 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
211 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
212 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
213 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
214 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
215 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
216 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
217 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
218 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
219 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
220 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
221 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
222 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
223 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
224 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
225 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
226 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
227 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
228 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
229 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
230 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
231 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
232 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
233 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
234 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
235 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
236 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
237 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
238 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
239 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
240 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
241 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
242 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
243 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
244 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
245 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
246 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
247 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
248 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
249 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
250 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
251 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
252 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
253 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
254 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
255 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
256 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
257 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
258 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
259 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
260 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
261 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
262 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
263 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
264 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
265 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
266 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
267 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
268 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
269 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
270 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
271 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
272 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
273 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
274 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
275 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
276 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
277 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
278 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
279 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
280 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
281 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
282 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
283 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
284 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
285 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
286 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
287 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
288 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
289 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
290 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
291 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
292 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
293 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
294 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
295 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
296 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
297 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
298 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
299 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
300 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
301 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
302 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
303 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
304 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
305 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
306 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
307 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
308 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
309 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
310 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
311 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
312 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
313 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
314 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
315 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
316 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
317 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
318 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
319 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
320 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
321 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
322 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
323 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
324 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
325 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
326 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
327 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
328 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
329 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
330 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
331 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
332 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
333 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
334 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
335 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
336 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
337 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
338 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
339 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
340 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
341 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
342 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
343 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
344 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
345 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
346 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
347 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
348 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
349 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
350 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
351 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
352 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
353 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
354 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
355 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
356 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
357 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
358 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
359 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
360 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
361 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
362 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
363 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
364 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
365 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
366 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
367 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
368 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
369 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
370 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
371 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
372 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
373 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
374 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
375 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
376 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
377 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
378 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
379 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
380 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
381 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
382 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
383 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
384 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
386 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
387 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
388 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
389 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
390 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
391 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
398 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
399 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
401 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
402 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
403 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
404 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
405 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
406 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
407 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
408 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
409 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
411 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
412 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
413 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
414 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
415 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
416 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
417 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
418 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
419 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
420 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
421 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
422 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
423 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
424 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
425 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
426 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
427 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
428 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
429 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
430 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
431 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
432 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
433 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
434 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
435 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
436 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
437 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
438 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
439 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
440 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
441 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
442 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
443 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
444 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
445 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
446 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
447 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
448 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
449 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
461 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
462 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
463 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
464 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
465 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
466 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
467 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
468 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
471 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
472 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
473 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
474 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
475 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
476 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
477 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
478 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
479 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
480 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
481 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
482 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
483 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
484 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
485 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
486 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
487 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
488 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
489 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
490 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
491 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
492 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
493 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
494 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
495 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
496 8024501048 Rhizobium sp. H4 Isolate Nodule
497 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
498 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
499 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
500 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
501 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 31.73
Metatranscriptomes 0.37
Isolates 67.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.3
Nodule 54.06
Rhizoplane 1.48
Rhizosphere 19.56
Stem 0
Stem Tuber 0
Unclassified 16.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000008 3300002987 Bacteria 172667
2 JGI25151J46595_10003122 3300003187 Bacteria 9317
3 JGI25151J46595_10017394 3300003187 Bacteria 3119
4 JGI25160J50197_1000033 3300003354 Bacteria 172667
5 JGI25161J50226_1001629 3300003374 Bacteria 6503
6 Ga0055526_1010424 3300003771 Bacteria 4325
7 Ga0055536_1002310 3300003781 Bacteria 10795
8 Ga0055530_10026263 3300003791 Bacteria 1613
9 Ga0055531_10003421 3300003794 Bacteria 10129
10 Ga0055543_1000026 3300004625 Bacteria 136177
11 Ga0065165_1000513 3300005262 Bacteria 59506
12 Ga0065704_10131113 3300005289 Bacteria 1627
13 Ga0070689_100195145 3300005340 Bacteria 1650
14 Ga0070663_100085726 3300005455 Bacteria 2325
15 Ga0070665_100009630 3300005548 Bacteria 9772
16 Ga0070702_100209085 3300005615 Bacteria 1297
17 Ga0081455_10032972 3300005937 Bacteria 4660
18 Ga0081538_10020532 3300005981 Bacteria 4855
19 Ga0081540_1002570 3300005983 Bacteria 14730
20 Ga0075364_10070331 3300006051 Bacteria 2304
21 Ga0075433_10098307 3300006852 Bacteria 2591
22 Ga0079104_1029042 3300006946 Bacteria 1397
23 Ga0114129_10202362 3300009147 Bacteria 2689
24 Ga0105239_10499238 3300010375 Bacteria 1383
25 Ga0157373_10067011 3300013100 Bacteria 2539
26 Ga0157373_10158817 3300013100 Bacteria 1591
27 Ga0171463_1007 3300013249 Bacteria 301198
28 Ga0183363_1058 3300015690 Bacteria 33958
29 Ga0163161_10321003 3300017792 Bacteria 1224
30 Ga0214544_1000010 3300021320 Bacteria 270164
31 Ga0214542_1000023 3300021321 Bacteria 191557
32 Ga0214542_1032369 3300021321 Bacteria 1855
33 Ga0214543_1000019 3300021327 Bacteria 267908
34 Ga0214543_1001578 3300021327 Bacteria 44277
35 Ga0228711_1000017 3300022739 Bacteria 121084
36 Ga0228710_1000005 3300022740 Bacteria 233531
37 Ga0209436_100593 3300025208 Bacteria 15488
38 Ga0209130_1000017 3300025284 Bacteria 388431
39 Ga0209676_1000100 3300025292 Bacteria 229621
40 Ga0209676_1016804 3300025292 Bacteria 2622
41 Ga0209025_1000121 3300025294 Bacteria 208700
42 Ga0209025_1000153 3300025294 Bacteria 170548
43 Ga0209564_1000372 3300025295 Bacteria 83053
44 Ga0209758_1000203 3300025297 Bacteria 132184
45 Ga0209758_1013780 3300025297 Bacteria 4371
46 Ga0209758_1020283 3300025297 Bacteria 3153
47 Ga0209256_1000401 3300025299 Bacteria 68618
48 Ga0209256_1000735 3300025299 Bacteria 43205
49 Ga0207426_1000006 3300025302 Bacteria 1025969
50 Ga0209051_1001964 3300025303 Bacteria 15813
51 Ga0209257_1001793 3300025304 Bacteria 23611
52 Ga0209257_1007978 3300025304 Bacteria 6190
53 Ga0207645_10097504 3300025907 Bacteria 1894
54 Ga0207670_10143039 3300025936 Bacteria 1765
55 Ga0207678_10091031 3300026067 Bacteria 2607
56 Ga0207648_10364434 3300026089 Bacteria 1304
57 Ga0207675_100408928 3300026118 Bacteria 1338
58 Ga0207675_100463134 3300026118 Bacteria 1258
59 Ga0209281_1000082 3300027111 Bacteria 257684
60 Ga0209281_1000484 3300027111 Bacteria 55133
61 Ga0209282_1000006 3300027666 Bacteria 276998
62 Ga0268266_10006032 3300028379 Bacteria 11173
63 Ga0307515_10000017 3300028794 Bacteria 550465
64 Ga0307515_10006276 3300028794 Bacteria 23849
65 Ga0307513_10008934 3300031456 Bacteria 12738
66 Ga0307408_100129437 3300031548 Bacteria 1967
67 Ga0307408_100439665 3300031548 Bacteria 1129
68 Ga0316578_10109046 3300031728 Bacteria 1662
69 Ga0316577_10066367 3300031733 Bacteria 2015
70 Ga0315914_1000003 3300031967 Bacteria 314370
71 Ga0307414_10234649 3300032004 Bacteria 1515
72 Ga0315913_1000001 3300033430 Bacteria 284459
73 Ga0315915_1000008 3300033464 Bacteria 258517
74 Ga0316592_1031005 3300033524 Bacteria 1163
75 Ga0316574_0093568 3300035398 Bacteria 1919
76 Ga0316582_0085509 3300036647 Bacteria 2067
77 Ga0400483_083489 3300039062 Bacteria 3168
78 Ga0439436_0022785 3300041404 Bacteria 1854
79 Ga0439447_030074 3300041407 Bacteria 1371
80 Ga0439465_0003329 3300041413 Bacteria 5248
81 Ga0439465_0013227 3300041413 Bacteria 2577
82 Ga0439465_0029506 3300041413 Bacteria 1742
83 Ga0439449_0022731 3300042007 Bacteria 2348
84 Ga0450906_000790 3300042145 Bacteria 6917
85 Ga0450918_009503 3300042531 Bacteria 1704
86 Ga0495638_0000084 3300046460 Bacteria 153168
87 Ga0495605_0001482 3300046474 Bacteria 15305
88 Ga0495585_0007328 3300046492 Bacteria 6763
89 Ga0495606_0018227 3300046507 Bacteria 5273
90 Ga0495616_0048858 3300046513 Bacteria 2123
91 Ga0495620_0024749 3300046515 Bacteria 2851
92 Ga0495620_0098667 3300046515 Bacteria 1166
93 Ga0495631_0001485 3300046518 Bacteria 14214
94 Ga0495632_0045710 3300046519 Bacteria 2180
95 Ga0495648_0045433 3300046524 Bacteria 2732
96 Ga0495668_0008288 3300046616 Bacteria 6510
97 Ga0495611_0007619 3300046648 Bacteria 4595
98 Ga0495625_0002952 3300046660 Bacteria 17721
99 Ga0495672_0043343 3300047320 Bacteria 2706
100 Ga0495687_011197 3300047443 Bacteria 4841
101 Ga0495686_0050750 3300047472 Bacteria 2606
102 Ga0496101_0233664 3300048904 Bacteria 1430
103 Ga0496102_0059576 3300048905 Bacteria 3491
104 Ga0496103_0179448 3300048906 Bacteria 1361
105 Ga0496106_0149604 3300048909 Bacteria 1841
106 Ga0496108_0078024 3300048911 Bacteria 2803
107 Ga0496117_0003370 3300048920 Bacteria 18618
108 Ga0496117_0054638 3300048920 Bacteria 2796
109 Ga0496119_0102602 3300048922 Bacteria 1603
110 Ga0496120_0042145 3300048923 Bacteria 2667
111 Ga0496120_0043272 3300048923 Bacteria 2625
112 Ga0496121_0000003 3300048924 Bacteria 1191431
113 Ga0496121_0254482 3300048924 Bacteria 1216
114 Ga0496122_0000778 3300048925 Bacteria 61337
115 Ga0496122_0018240 3300048925 Bacteria 6498
116 Ga0496122_0060176 3300048925 Bacteria 2799
117 Ga0496123_0000018 3300048926 Bacteria 404553
118 Ga0496124_0001346 3300048927 Bacteria 36835
119 Ga0496124_0003732 3300048927 Bacteria 18370
120 Ga0496124_0005103 3300048927 Bacteria 14953
121 Ga0496125_0000161 3300048928 Bacteria 150707
122 Ga0496125_0000200 3300048928 Bacteria 126369
123 Ga0496126_0000212 3300048929 Bacteria 128871
124 Ga0496126_0064901 3300048929 Bacteria 3269
125 Ga0495678_037899 3300049459 Bacteria 1955
126 Ga0501318_007014 3300049534 Bacteria 1165
127 Ga0501033_0010396 3300049570 Bacteria 7136
128 Ga0501034_0280387 3300049571 Bacteria 1606
129 Ga0501036_0300161 3300049572 Bacteria 1343
130 Ga0501037_0063398 3300049573 Bacteria 2694
131 Ga0501038_0032435 3300049574 Bacteria 4609
132 Ga0501039_0030504 3300049575 Bacteria 4157
133 Ga0501042_0072564 3300049578 Bacteria 2463
134 Ga0501043_0027497 3300049579 Bacteria 4464
135 Ga0501046_0012466 3300049580 Bacteria 7236
136 Ga0501048_0006065 3300049582 Bacteria 9203
137 Ga0501067_0079688 3300049583 Bacteria 1815
138 Ga0501069_0022239 3300049585 Bacteria 3447
139 Ga0501070_0023869 3300049586 Bacteria 5125
140 Ga0501072_0123383 3300049588 Bacteria 2064
141 Ga0501072_0137749 3300049588 Bacteria 1946
142 Ga0501074_0013053 3300049590 Bacteria 6039
143 Ga0501076_0086845 3300049592 Bacteria 2514
144 Ga0501080_0015522 3300049742 Bacteria 7023
145 Ga0501080_0129810 3300049742 Bacteria 2333
146 Ga0501083_0152919 3300049744 Bacteria 1511
147 Ga0501035_0015069 3300049822 Bacteria 7133
148 Ga0501035_0067193 3300049822 Bacteria 3182
149 Ga0501044_0085807 3300049823 Bacteria 3181
150 Ga0501044_0171682 3300049823 Bacteria 2139
151 Ga0501045_0128314 3300049824 Bacteria 1885
152 nmdc:mga00v17_25897_c1 3300050491 Bacteria 3412
153 nmdc:mga00v17_6058_c1 3300050491 Bacteria 6399
154 nmdc:mga0yw44_160655_c1 3300050492 Bacteria 1471
155 nmdc:mga0yw44_28078_c1 3300050492 Bacteria 3233
156 nmdc:mga0yw44_420_c1 3300050492 Bacteria 14871
157 nmdc:mga06z11_108055_c1 3300050494 Bacteria 1537
158 nmdc:mga06z11_33569_c1 3300050494 Bacteria 2512
159 nmdc:mga0rr50_111022_c1 3300050513 Bacteria 2169
160 Ga0500578_0079942 3300053086 Bacteria 2080
161 Ga0500646_0047535 3300053090 Bacteria 1228
162 Ga0500557_023469 3300053105 Bacteria 1793
163 Ga0500569_000776 3300053109 Bacteria 5598
164 Ga0500594_0000634 3300053118 Bacteria 7511
165 Ga0500568_0000187 3300053139 Bacteria 54387
166 Ga0500568_0000559 3300053139 Bacteria 27350
167 Ga0500588_0012521 3300053146 Bacteria 2106
168 Ga0500616_0000181 3300053153 Bacteria 104316
169 Ga0500616_0000872 3300053153 Bacteria 33370
170 Ga0501084_0195402 3300054114 Bacteria 1707
171 Ga0501084_0391924 3300054114 Bacteria 1174
172 Ga0590071_008526 3300059421 Bacteria 2410
173 Ga0530510_0067829 3300061734 Bacteria 2588
174 Ga0530510_0251699 3300061734 Bacteria 1317

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041407 Ga0439447_030074 Ga0439447_030074_11_1030 339
2 3300046524 Ga0495648_0045433 Ga0495648_0045433_1690_2709 339
3 3300050513 nmdc:mga0rr50_111022_c1 nmdc:mga0rr50_111022_c1_861_1934 345
4 3300048925 Ga0496122_0060176 Ga0496122_0060176_1004_2104 346
5 3300031728 Ga0316578_10109046 Ga0316578_101090463 351
6 3300033524 Ga0316592_1031005 Ga0316592_10310051 351
7 3300035398 Ga0316574_0093568 Ga0316574_0093568_628_1704 351
8 iso_pu_bacteria 2582581866 2585397495 351
9 3300061734 Ga0530510_0067829 Ga0530510_0067829_1421_2530 353
10 3300039062 Ga0400483_083489 Ga0400483_083489_608_1693 354
11 iso_pu_bacteria 2508501122 2509107984 355
12 iso_pu_bacteria 2509276019 2509376840 355
13 iso_pu_bacteria 2510065057 2510304137 355
14 iso_pu_bacteria 2511231052 2511502574 355
15 iso_pu_bacteria 2512047086 2512533943 355
16 iso_pu_bacteria 2512875026 2512970298 355
17 iso_pu_bacteria 2513237086 2513583205 355
18 iso_pu_bacteria 2513237089 2513601362 355
19 iso_pu_bacteria 2513237091 2513621020 355
20 iso_pu_bacteria 2513237140 2513881743 355
21 iso_pu_bacteria 2513237143 2513904887 355
22 iso_pu_bacteria 2513237156 2513986625 355
23 iso_pu_bacteria 2513237160 2514003191 355
24 iso_pu_bacteria 2515154107 2515609357 355
25 iso_pu_bacteria 2516143018 2516206004 355
26 iso_pu_bacteria 2516653046 2516893949 355
27 iso_pu_bacteria 2517487022 2517570664 355
28 iso_pu_bacteria 2524023207 2524448231 355
29 iso_pu_bacteria 2551306084 2551675339 355
30 iso_pu_bacteria 2551306084 2551676749 355
31 iso_pu_bacteria 2551306085 2551689377 355
32 iso_pu_bacteria 2551306086 2551695493 355
33 iso_pu_bacteria 2551306089 2551711098 355
34 iso_pu_bacteria 2551306090 2551722021 355
35 iso_pu_bacteria 2551306091 2551724392 355
36 iso_pu_bacteria 2551306092 2551734084 355
37 iso_pu_bacteria 2558860100 2558865803 355
38 iso_pu_bacteria 2599185352 2600196915 355
39 iso_pu_bacteria 2615840624 2616296922 355
40 iso_pu_bacteria 2643221557 2643804457 355
41 iso_pu_bacteria 2643221610 2644065228 355
42 iso_pu_bacteria 2643221618 2644105519 355
43 iso_pu_bacteria 2643221626 2644146522 355
44 iso_pu_bacteria 2643221655 2644308270 355
45 iso_pu_bacteria 2643221659 2644334097 355
46 iso_pu_bacteria 2643221668 2644377637 355
47 iso_pu_bacteria 2643221675 2644418166 355
48 iso_pu_bacteria 2643221680 2644451422 355
49 iso_pu_bacteria 2643221698 2644541691 355
50 iso_pu_bacteria 2643221712 2644615552 355
51 iso_pu_bacteria 2643221723 2644672706 355
52 iso_pu_bacteria 2643221726 2644691598 355
53 iso_pu_bacteria 2657244999 2657684805 355
54 iso_pu_bacteria 2690316117 2692315107 355
55 iso_pu_bacteria 2751185821 2753463280 355
56 iso_pu_bacteria 2791355082 2792581594 355
57 iso_pu_bacteria 2791355091 2792620414 355
58 iso_pu_bacteria 2791355092 2792625772 355
59 iso_pu_bacteria 2791355094 2792641840 355
60 iso_pu_bacteria 2791355260 2793322854 355
61 iso_pu_bacteria 2791355264 2793349212 355
62 iso_pu_bacteria 2802428858 2802716655 355
63 iso_pu_bacteria 2802428859 2802725466 355
64 iso_pu_bacteria 2802428860 2802730442 355
65 iso_pu_bacteria 2802428861 2802737586 355
66 iso_pu_bacteria 2802428862 2802743024 355
67 iso_pu_bacteria 2802428863 2802750448 355
68 iso_pu_bacteria 2802429268 2804753064 355
69 iso_pu_bacteria 2802429605 2805931854 355
70 iso_pu_bacteria 2838022645 2838027052 355
71 iso_pu_bacteria 2838042994 2838047163 355
72 iso_pu_bacteria 2838074704 2838080573 355
73 iso_pu_bacteria 2838668709 2838674485 355
74 iso_pu_bacteria 2838701080 2838706826 355
75 iso_pu_bacteria 2842146304 2842151528 355
76 iso_pu_bacteria 2842198810 2842202656 355
77 iso_pu_bacteria 2842205361 2842207934 355
78 iso_pu_bacteria 2842250916 2842256679 355
79 iso_pu_bacteria 2842278818 2842281271 355
80 iso_pu_bacteria 2842285085 2842290515 355
81 iso_pu_bacteria 2842317721 2842324304 355
82 iso_pu_bacteria 2842402390 2842408353 355
83 iso_pu_bacteria 2842409023 2842415062 355
84 iso_pu_bacteria 2842415677 2842421657 355
85 iso_pu_bacteria 2842489311 2842495696 355
86 iso_pu_bacteria 2842495871 2842501166 355
87 iso_pu_bacteria 2844163670 2844166434 355
88 iso_pu_bacteria 2847417321 2847419832 355
89 iso_pu_bacteria 2848992105 2848994848 355
90 iso_pu_bacteria 2850079185 2850081844 355
91 iso_pu_bacteria 2855825444 2855826671 355
92 iso_pu_bacteria 2855839649 2855842065 355
93 iso_pu_bacteria 2855872281 2855877348 355
94 iso_pu_bacteria 2858800743 2858802739 355
95 iso_pu_bacteria 2896384573 2896391279 355
96 iso_pu_bacteria 2913295892 2913301723 355
97 iso_pu_bacteria 2915980308 2915981207 355
98 iso_pu_bacteria 2915986958 2915988395 355
99 iso_pu_bacteria 2915993759 2915998579 355
100 iso_pu_bacteria 2916000859 2916005655 355
101 iso_pu_bacteria 2916007675 2916013509 355
102 iso_pu_bacteria 2916014648 2916021452 355
103 iso_pu_bacteria 2916021584 2916026854 355
104 iso_pu_bacteria 2916028427 2916033022 355
105 iso_pu_bacteria 2916035215 2916039293 355
106 iso_pu_bacteria 2916041962 2916046514 355
107 iso_pu_bacteria 2916048683 2916050490 355
108 iso_pu_bacteria 2916055098 2916055965 355
109 iso_pu_bacteria 2916061851 2916062068 355
110 iso_pu_bacteria 2916068649 2916075714 355
111 iso_pu_bacteria 2916076590 2916077203 355
112 iso_pu_bacteria 2920760137 2920761118 355
113 iso_pu_bacteria 2920822456 2920825694 355
114 iso_pu_bacteria 2921201388 2921205460 355
115 iso_pu_bacteria 2921208531 2921213961 355
116 iso_pu_bacteria 2921237296 2921239327 355
117 iso_pu_bacteria 2921244191 2921249937 355
118 iso_pu_bacteria 2921250672 2921251714 355
119 iso_pu_bacteria 2921257292 2921258896 355
120 iso_pu_bacteria 2921263974 2921270268 355
121 iso_pu_bacteria 2921282425 2921287203 355
122 iso_pu_bacteria 2921289301 2921292039 355
123 iso_pu_bacteria 2921296804 2921302397 355
124 iso_pu_bacteria 2924144063 2924144910 355
125 iso_pu_bacteria 2924150972 2924156129 355
126 iso_pu_bacteria 2924158325 2924159954 355
127 iso_pu_bacteria 2924165586 2924169494 355
128 iso_pu_bacteria 2924172951 2924173559 355
129 iso_pu_bacteria 2924179722 2924183794 355
130 iso_pu_bacteria 2924186466 2924193158 355
131 iso_pu_bacteria 2924193448 2924195081 355
132 iso_pu_bacteria 2924200457 2924201607 355
133 iso_pu_bacteria 2924207177 2924208220 355
134 iso_pu_bacteria 2924214083 2924219181 355
135 iso_pu_bacteria 2924221636 2924223579 355
136 iso_pu_bacteria 2924228884 2924235206 355
137 iso_pu_bacteria 2936996657 2937001210 355
138 iso_pu_bacteria 2937002841 2937003920 355
139 iso_pu_bacteria 2937009748 2937010770 355
140 iso_pu_bacteria 2937016420 2937021809 355
141 iso_pu_bacteria 2937023124 2937027397 355
142 iso_pu_bacteria 2937029754 2937035696 355
143 iso_pu_bacteria 2937036028 2937039359 355
144 iso_pu_bacteria 2937042894 2937042916 355
145 iso_pu_bacteria 2937049772 2937050347 355
146 iso_pu_bacteria 2937056579 2937062864 355
147 iso_pu_bacteria 2937063883 2937064555 355
148 iso_pu_bacteria 2937071275 2937073248 355
149 iso_pu_bacteria 2937078374 2937080758 355
150 iso_pu_bacteria 2937084907 2937090615 355
151 iso_pu_bacteria 2937091812 2937097370 355
152 iso_pu_bacteria 2937098957 2937101085 355
153 iso_pu_bacteria 2937106411 2937112218 355
154 iso_pu_bacteria 2937113482 2937117618 355
155 iso_pu_bacteria 2937119839 2937124449 355
156 iso_pu_bacteria 2937126314 2937131507 355
157 iso_pu_bacteria 2941499720 2941504535 355
158 iso_pu_bacteria 2957375807 2957380629 355
159 iso_pu_bacteria 2957382221 2957382579 355
160 iso_pu_bacteria 2957388812 2957389443 355
161 iso_pu_bacteria 2957395598 2957401959 355
162 iso_pu_bacteria 2957402308 2957408381 355
163 iso_pu_bacteria 2957408893 2957410165 355
164 iso_pu_bacteria 2957415311 2957420053 355
165 iso_pu_bacteria 2957422303 2957428481 355
166 iso_pu_bacteria 2957430029 2957431011 355
167 iso_pu_bacteria 2957437181 2957440116 355
168 iso_pu_bacteria 2957443900 2957450633 355
169 iso_pu_bacteria 2957450854 2957452254 355
170 iso_pu_bacteria 2957457609 2957462670 355
171 iso_pu_bacteria 2957464669 2957465625 355
172 iso_pu_bacteria 2957471148 2957475701 355
173 iso_pu_bacteria 2957478035 2957478969 355
174 iso_pu_bacteria 2957484790 2957488896 355
175 iso_pu_bacteria 2957491536 2957497929 355
176 iso_pu_bacteria 2957498199 2957501753 355
177 iso_pu_bacteria 2957505466 2957509906 355
178 iso_pu_bacteria 2960584000 2960589113 355
179 iso_pu_bacteria 2960591022 2960591871 355
180 iso_pu_bacteria 2960597568 2960602045 355
181 iso_pu_bacteria 2960603979 2960607922 355
182 iso_pu_bacteria 2960610863 2960614804 355
183 iso_pu_bacteria 2960617483 2960618059 355
184 iso_pu_bacteria 2960624210 2960630038 355
185 iso_pu_bacteria 2960631154 2960634072 355
186 iso_pu_bacteria 2960637947 2960642589 355
187 iso_pu_bacteria 2960645483 2960651174 355
188 iso_pu_bacteria 2960652885 2960659483 355
189 iso_pu_bacteria 2960660292 2960667188 355
190 iso_pu_bacteria 2960667422 2960673698 355
191 iso_pu_bacteria 2960674078 2960674809 355
192 iso_pu_bacteria 2960680706 2960680744 355
193 iso_pu_bacteria 2960687367 2960692230 355
194 iso_pu_bacteria 2960693952 2960696526 355
195 iso_pu_bacteria 2964607997 2964614893 355
196 iso_pu_bacteria 2964615318 2964617113 355
197 iso_pu_bacteria 2964621998 2964627182 355
198 iso_pu_bacteria 2964628898 2964632871 355
199 iso_pu_bacteria 2964636051 2964636803 355
200 iso_pu_bacteria 2964643177 2964646311 355
201 iso_pu_bacteria 2964649959 2964651187 355
202 iso_pu_bacteria 2964656573 2964662760 355
203 iso_pu_bacteria 2964663802 2964669261 355
204 iso_pu_bacteria 2964670856 2964675521 355
205 iso_pu_bacteria 2964678106 2964682439 355
206 iso_pu_bacteria 2964685014 2964689389 355
207 iso_pu_bacteria 2964691889 2964693929 355
208 iso_pu_bacteria 2964698721 2964704791 355
209 iso_pu_bacteria 2964705432 2964706438 355
210 iso_pu_bacteria 2964712639 2964716447 355
211 iso_pu_bacteria 2964719344 2964721265 355
212 iso_pu_bacteria 2967664464 2967670274 355
213 iso_pu_bacteria 2967671571 2967676221 355
214 iso_pu_bacteria 2967678726 2967685884 355
215 iso_pu_bacteria 2967686174 2967691015 355
216 iso_pu_bacteria 2967693043 2967698998 355
217 iso_pu_bacteria 2967706974 2967711616 355
218 iso_pu_bacteria 2967714385 2967720447 355
219 iso_pu_bacteria 2967721400 2967724382 355
220 iso_pu_bacteria 2967728569 2967732355 355
221 iso_pu_bacteria 2967735183 2967739924 355
222 iso_pu_bacteria 2967742019 2967745851 355
223 iso_pu_bacteria 2967748971 2967749368 355
224 iso_pu_bacteria 2967755722 2967759594 355
225 iso_pu_bacteria 2967762386 2967767194 355
226 iso_pu_bacteria 2967769361 2967770514 355
227 iso_pu_bacteria 2967775926 2967776888 355
228 iso_pu_bacteria 2970019648 2970025807 355
229 iso_pu_bacteria 2970026789 2970027523 355
230 iso_pu_bacteria 2970033650 2970036044 355
231 iso_pu_bacteria 2970040964 2970046129 355
232 iso_pu_bacteria 2970047711 2970048410 355
233 iso_pu_bacteria 2970054988 2970056287 355
234 iso_pu_bacteria 2970061556 2970065986 355
235 iso_pu_bacteria 2970068827 2970071053 355
236 iso_pu_bacteria 2970076120 2970082479 355
237 iso_pu_bacteria 2970082768 2970088316 355
238 iso_pu_bacteria 2970088815 2970094211 355
239 iso_pu_bacteria 2970095765 2970100760 355
240 iso_pu_bacteria 2970102677 2970104431 355
241 iso_pu_bacteria 2970109326 2970115021 355
242 iso_pu_bacteria 2970116247 2970120619 355
243 iso_pu_bacteria 2970122695 2970123405 355
244 iso_pu_bacteria 2970129317 2970135911 355
245 iso_pu_bacteria 2970136068 2970140864 355
246 iso_pu_bacteria 2970143518 2970144792 355
247 iso_pu_bacteria 2970149975 2970154912 355
248 iso_pu_bacteria 2970156795 2970161328 355
249 iso_pu_bacteria 2970164137 2970168335 355
250 iso_pu_bacteria 2970170962 2970173866 355
251 iso_pu_bacteria 2970177841 2970181047 355
252 iso_pu_bacteria 2970184632 2970186304 355
253 iso_pu_bacteria 2970191845 2970196089 355
254 iso_pu_bacteria 2977516862 2977519371 355
255 iso_pu_bacteria 2977523885 2977530462 355
256 iso_pu_bacteria 2977530762 2977536333 355
257 iso_pu_bacteria 2977537788 2977543277 355
258 iso_pu_bacteria 2977544691 2977545694 355
259 iso_pu_bacteria 2977551784 2977553085 355
260 iso_pu_bacteria 2977558990 2977565231 355
261 iso_pu_bacteria 2977565890 2977567008 355
262 iso_pu_bacteria 2977572785 2977574026 355
263 iso_pu_bacteria 2977579622 2977585886 355
264 iso_pu_bacteria 643692032 643826728 355
265 iso_pu_bacteria 648276728 648738768 355
266 iso_pu_bacteria 8003992118 8003994506 355
267 iso_pu_bacteria 8003999396 8004002202 355
268 iso_pu_bacteria 8005289223 8005292551 355
269 iso_pu_bacteria 8005301065 8005304318 355
270 iso_pu_bacteria 8005688590 8005690740 355
271 iso_pu_bacteria 8018127388 8018131053 355
272 iso_pu_bacteria 8024501048 8024503508 355
273 iso_pu_bacteria 8049293176 8049295678 355
274 3300031733 Ga0316577_10066367 Ga0316577_100663672 356
275 3300036647 Ga0316582_0085509 Ga0316582_0085509_74_1216 356
276 iso_pu_bacteria 2897803580 2897809624 356
277 3300006852 Ga0075433_10098307 Ga0075433_100983072 357
278 3300013249 Ga0171463_1007 Ga0171463_1007258 357
279 3300048906 Ga0496103_0179448 Ga0496103_0179448_106_1182 357
280 3300049588 Ga0501072_0137749 Ga0501072_0137749_582_1793 357
281 3300049592 Ga0501076_0086845 Ga0501076_0086845_284_1495 357
282 3300049742 Ga0501080_0129810 Ga0501080_0129810_638_1849 357
283 3300059421 Ga0590071_008526 Ga0590071_008526_1002_2078 357
284 iso_pu_bacteria 2510461069 2510842167 358
285 iso_pu_bacteria 2510917026 2511171362 358
286 iso_pu_bacteria 2513237144 2513911592 358
287 iso_pu_bacteria 2513237146 2513927791 358
288 iso_pu_bacteria 2513237159 2513997490 358
289 iso_pu_bacteria 2513237305 2514418725 358
290 iso_pu_bacteria 2513237351 2514585953 358
291 iso_pu_bacteria 2582581283 2585167632 358
292 iso_pu_bacteria 2582581306 2585265866 358
293 iso_pu_bacteria 2582581865 2585390056 358
294 iso_pu_bacteria 2582581866 2585395261 358
295 iso_pu_bacteria 2582581866 2585397520 358
296 iso_pu_bacteria 2585427633 2585992613 358
297 iso_pu_bacteria 2585427634 2586003374 358
298 iso_pu_bacteria 2599185170 2599416776 358
299 iso_pu_bacteria 2643221550 2643772301 358
300 iso_pu_bacteria 2643221564 2643836567 358
301 iso_pu_bacteria 2643221607 2644052124 358
302 iso_pu_bacteria 2643221623 2644133728 358
303 iso_pu_bacteria 2643221636 2644204917 358
304 iso_pu_bacteria 2643221637 2644208631 358
305 iso_pu_bacteria 2643221653 2644299407 358
306 iso_pu_bacteria 2643221686 2644484867 358
307 iso_pu_bacteria 2643221688 2644494160 358
308 iso_pu_bacteria 2643221689 2644500573 358
309 iso_pu_bacteria 2643221718 2644652161 358
310 iso_pu_bacteria 2643221719 2644657635 358
311 iso_pu_bacteria 2721755686 2723572973 358
312 iso_pu_bacteria 2738543024 2739307662 358
313 iso_pu_bacteria 2738543031 2739351054 358
314 iso_pu_bacteria 2765235802 2765468613 358
315 iso_pu_bacteria 2767802442 2770198879 358
316 iso_pu_bacteria 2775506902 2776272894 358
317 iso_pu_bacteria 2775506904 2776282263 358
318 iso_pu_bacteria 2775507049 2776914780 358
319 iso_pu_bacteria 2791355123 2792747067 358
320 iso_pu_bacteria 2818991272 2819243980 358
321 iso_pu_bacteria 2838035591 2838036890 358
322 iso_pu_bacteria 2838661181 2838662072 358
323 iso_pu_bacteria 2839993093 2839996566 358
324 iso_pu_bacteria 2840764183 2840770319 358
325 iso_pu_bacteria 2842521101 2842522269 358
326 iso_pu_bacteria 2847670302 2847673290 358
327 iso_pu_bacteria 2854896431 2854897894 358
328 iso_pu_bacteria 2854916844 2854920663 358
329 iso_pu_bacteria 2856314179 2856319241 358
330 iso_pu_bacteria 2856349417 2856350172 358
331 iso_pu_bacteria 2871488783 2871491206 358
332 iso_pu_bacteria 2874123672 2874124164 358
333 iso_pu_bacteria 2874168670 2874172328 358
334 iso_pu_bacteria 2878035449 2878039630 358
335 iso_pu_bacteria 2878753008 2878755625 358
336 iso_pu_bacteria 2881155292 2881159108 358
337 iso_pu_bacteria 2881845957 2881846486 358
338 iso_pu_bacteria 2881853255 2881853683 358
339 iso_pu_bacteria 2881861095 2881862357 358
340 iso_pu_bacteria 2882632389 2882634659 358
341 iso_pu_bacteria 2882912400 2882915336 358
342 iso_pu_bacteria 2885318864 2885320997 358
343 iso_pu_bacteria 2885342637 2885350502 358
344 iso_pu_bacteria 2885350715 2885357891 358
345 iso_pu_bacteria 2889790730 2889795537 358
346 iso_pu_bacteria 2889914905 2889916098 358
347 iso_pu_bacteria 2891373044 2891376919 358
348 iso_pu_bacteria 2894652903 2894656798 358
349 iso_pu_bacteria 2903492973 2903498910 358
350 iso_pu_bacteria 2904578770 2904582517 358
351 iso_pu_bacteria 2906414383 2906419313 358
352 iso_pu_bacteria 2919119836 2919123996 358
353 iso_pu_bacteria 2919171160 2919174402 358
354 iso_pu_bacteria 2924762789 2924766701 358
355 iso_pu_bacteria 2924784321 2924785605 358
356 iso_pu_bacteria 2929138655 2929141496 358
357 iso_pu_bacteria 2933016740 2933019341 358
358 iso_pu_bacteria 2937822353 2937826294 358
359 iso_pu_bacteria 2937843397 2937848104 358
360 iso_pu_bacteria 2961127735 2961130485 358
361 iso_pu_bacteria 2961170736 2961176441 358
362 iso_pu_bacteria 2967996073 2967998834 358
363 iso_pu_bacteria 2968003550 2968007595 358
364 iso_pu_bacteria 2970503327 2970509112 358
365 iso_pu_bacteria 2977821940 2977824863 358
366 iso_pu_bacteria 2977828996 2977831393 358
367 iso_pu_bacteria 2979808191 2979813791 358
368 iso_pu_bacteria 2987666974 2987667629 358
369 iso_pu_bacteria 2989349275 2989352305 358
370 iso_pu_bacteria 2989771324 2989772844 358
371 iso_pu_bacteria 2989776772 2989780519 358
372 iso_pu_bacteria 2996310559 2996316043 358
373 iso_pu_bacteria 3000135777 3000137208 358
374 iso_pu_bacteria 3002141150 3002145533 358
375 iso_pu_bacteria 3003930520 3003935308 358
376 iso_pu_bacteria 3005409236 3005413396 358
377 iso_pu_bacteria 8002285264 8002290826 358
378 iso_pu_bacteria 8004374579 8004377226 358
379 iso_pu_bacteria 8045864390 8045867842 358
380 iso_pu_bacteria 8054558443 8054560375 358
381 iso_pu_bacteria 8056875544 8056876363 358
382 3300002987 JGI25159J45721_1000008 JGI25159J45721_100000839 359
383 3300003187 JGI25151J46595_10003122 JGI25151J46595_100031228 359
384 3300003187 JGI25151J46595_10017394 JGI25151J46595_100173942 359
385 3300003354 JGI25160J50197_1000033 JGI25160J50197_1000033136 359
386 3300003374 JGI25161J50226_1001629 JGI25161J50226_10016292 359
387 3300003771 Ga0055526_1010424 Ga0055526_10104244 359
388 3300003781 Ga0055536_1002310 Ga0055536_100231011 359
389 3300003791 Ga0055530_10026263 Ga0055530_100262631 359
390 3300003794 Ga0055531_10003421 Ga0055531_100034214 359
391 3300004625 Ga0055543_1000026 Ga0055543_10000264 359
392 3300005262 Ga0065165_1000513 Ga0065165_100051340 359
393 3300005289 Ga0065704_10131113 Ga0065704_101311132 359
394 3300005340 Ga0070689_100195145 Ga0070689_1001951452 359
395 3300005455 Ga0070663_100085726 Ga0070663_1000857262 359
396 3300005548 Ga0070665_100009630 Ga0070665_1000096308 359
397 3300005615 Ga0070702_100209085 Ga0070702_1002090851 359
398 3300005937 Ga0081455_10032972 Ga0081455_100329725 359
399 3300005981 Ga0081538_10020532 Ga0081538_100205324 359
400 3300005983 Ga0081540_1002570 Ga0081540_100257013 359
401 3300006051 Ga0075364_10070331 Ga0075364_100703312 359
402 3300006946 Ga0079104_1029042 Ga0079104_10290421 359
403 3300009147 Ga0114129_10202362 Ga0114129_102023622 359
404 3300010375 Ga0105239_10499238 Ga0105239_104992381 359
405 3300013100 Ga0157373_10067011 Ga0157373_100670112 359
406 3300013100 Ga0157373_10158817 Ga0157373_101588172 359
407 3300015690 Ga0183363_1058 Ga0183363_105819 359
408 3300017792 Ga0163161_10321003 Ga0163161_103210031 359
409 3300021320 Ga0214544_1000010 Ga0214544_1000010182 359
410 3300021321 Ga0214542_1000023 Ga0214542_100002369 359
411 3300021321 Ga0214542_1032369 Ga0214542_10323692 359
412 3300021327 Ga0214543_1000019 Ga0214543_1000019144 359
413 3300021327 Ga0214543_1001578 Ga0214543_100157819 359
414 3300022739 Ga0228711_1000017 Ga0228711_100001732 359
415 3300022740 Ga0228710_1000005 Ga0228710_1000005221 359
416 3300025208 Ga0209436_100593 Ga0209436_1005932 359
417 3300025284 Ga0209130_1000017 Ga0209130_100001741 359
418 3300025292 Ga0209676_1000100 Ga0209676_1000100168 359
419 3300025292 Ga0209676_1016804 Ga0209676_10168042 359
420 3300025294 Ga0209025_1000121 Ga0209025_1000121159 359
421 3300025294 Ga0209025_1000153 Ga0209025_1000153136 359
422 3300025295 Ga0209564_1000372 Ga0209564_100037226 359
423 3300025297 Ga0209758_1000203 Ga0209758_1000203102 359
424 3300025297 Ga0209758_1013780 Ga0209758_10137805 359
425 3300025297 Ga0209758_1020283 Ga0209758_10202833 359
426 3300025299 Ga0209256_1000401 Ga0209256_100040151 359
427 3300025299 Ga0209256_1000735 Ga0209256_100073513 359
428 3300025302 Ga0207426_1000006 Ga0207426_100000640 359
429 3300025303 Ga0209051_1001964 Ga0209051_10019644 359
430 3300025304 Ga0209257_1001793 Ga0209257_100179311 359
431 3300025304 Ga0209257_1007978 Ga0209257_10079782 359
432 3300025907 Ga0207645_10097504 Ga0207645_100975042 359
433 3300025936 Ga0207670_10143039 Ga0207670_101430392 359
434 3300026067 Ga0207678_10091031 Ga0207678_100910312 359
435 3300026089 Ga0207648_10364434 Ga0207648_103644341 359
436 3300026118 Ga0207675_100408928 Ga0207675_1004089281 359
437 3300026118 Ga0207675_100463134 Ga0207675_1004631341 359
438 3300027111 Ga0209281_1000082 Ga0209281_1000082169 359
439 3300027111 Ga0209281_1000484 Ga0209281_10004849 359
440 3300027666 Ga0209282_1000006 Ga0209282_1000006191 359
441 3300028379 Ga0268266_10006032 Ga0268266_100060324 359
442 3300028794 Ga0307515_10000017 Ga0307515_10000017292 359
443 3300028794 Ga0307515_10006276 Ga0307515_1000627625 359
444 3300031456 Ga0307513_10008934 Ga0307513_100089342 359
445 3300031548 Ga0307408_100129437 Ga0307408_1001294371 359
446 3300031548 Ga0307408_100439665 Ga0307408_1004396651 359
447 3300031967 Ga0315914_1000003 Ga0315914_1000003246 359
448 3300032004 Ga0307414_10234649 Ga0307414_102346492 359
449 3300033430 Ga0315913_1000001 Ga0315913_1000001197 359
450 3300033464 Ga0315915_1000008 Ga0315915_100000890 359
451 3300041404 Ga0439436_0022785 Ga0439436_0022785_636_1796 359
452 3300041413 Ga0439465_0003329 Ga0439465_0003329_3689_4771 359
453 3300041413 Ga0439465_0013227 Ga0439465_0013227_1113_2225 359
454 3300041413 Ga0439465_0029506 Ga0439465_0029506_387_1547 359
455 3300042007 Ga0439449_0022731 Ga0439449_0022731_373_1455 359
456 3300042145 Ga0450906_000790 Ga0450906_000790_5087_6247 359
457 3300042531 Ga0450918_009503 Ga0450918_009503_535_1623 359
458 3300046460 Ga0495638_0000084 Ga0495638_0000084_36860_37948 359
459 3300046474 Ga0495605_0001482 Ga0495605_0001482_12871_13959 359
460 3300046492 Ga0495585_0007328 Ga0495585_0007328_3043_4131 359
461 3300046507 Ga0495606_0018227 Ga0495606_0018227_48_1136 359
462 3300046513 Ga0495616_0048858 Ga0495616_0048858_154_1242 359
463 3300046515 Ga0495620_0024749 Ga0495620_0024749_739_1827 359
464 3300046515 Ga0495620_0098667 Ga0495620_0098667_59_1147 359
465 3300046518 Ga0495631_0001485 Ga0495631_0001485_4965_6053 359
466 3300046519 Ga0495632_0045710 Ga0495632_0045710_464_1552 359
467 3300046616 Ga0495668_0008288 Ga0495668_0008288_3618_4706 359
468 3300046648 Ga0495611_0007619 Ga0495611_0007619_1632_2720 359
469 3300046660 Ga0495625_0002952 Ga0495625_0002952_13772_14860 359
470 3300047320 Ga0495672_0043343 Ga0495672_0043343_1272_2360 359
471 3300047443 Ga0495687_011197 Ga0495687_011197_1954_3042 359
472 3300047472 Ga0495686_0050750 Ga0495686_0050750_261_1397 359
473 3300048904 Ga0496101_0233664 Ga0496101_0233664_159_1247 359
474 3300048905 Ga0496102_0059576 Ga0496102_0059576_1806_2921 359
475 3300048909 Ga0496106_0149604 Ga0496106_0149604_572_1687 359
476 3300048911 Ga0496108_0078024 Ga0496108_0078024_1091_2206 359
477 3300048920 Ga0496117_0003370 Ga0496117_0003370_243_1331 359
478 3300048920 Ga0496117_0054638 Ga0496117_0054638_463_1551 359
479 3300048922 Ga0496119_0102602 Ga0496119_0102602_451_1539 359
480 3300048923 Ga0496120_0042145 Ga0496120_0042145_603_1691 359
481 3300048923 Ga0496120_0043272 Ga0496120_0043272_1472_2560 359
482 3300048924 Ga0496121_0000003 Ga0496121_0000003_1125937_1127025 359
483 3300048924 Ga0496121_0254482 Ga0496121_0254482_17_1105 359
484 3300048925 Ga0496122_0000778 Ga0496122_0000778_6372_7460 359
485 3300048925 Ga0496122_0018240 Ga0496122_0018240_4608_5696 359
486 3300048926 Ga0496123_0000018 Ga0496123_0000018_61148_62236 359
487 3300048927 Ga0496124_0001346 Ga0496124_0001346_7892_8980 359
488 3300048927 Ga0496124_0003732 Ga0496124_0003732_11737_12828 359
489 3300048927 Ga0496124_0005103 Ga0496124_0005103_3938_5026 359
490 3300048928 Ga0496125_0000161 Ga0496125_0000161_55178_56266 359
491 3300048928 Ga0496125_0000200 Ga0496125_0000200_63145_64233 359
492 3300048929 Ga0496126_0000212 Ga0496126_0000212_48722_49810 359
493 3300048929 Ga0496126_0064901 Ga0496126_0064901_1068_2162 359
494 3300049459 Ga0495678_037899 Ga0495678_037899_849_1937 359
495 3300049534 Ga0501318_007014 Ga0501318_007014_43_1155 359
496 3300049570 Ga0501033_0010396 Ga0501033_0010396_5381_6469 359
497 3300049571 Ga0501034_0280387 Ga0501034_0280387_434_1528 359
498 3300049572 Ga0501036_0300161 Ga0501036_0300161_68_1162 359
499 3300049573 Ga0501037_0063398 Ga0501037_0063398_477_1571 359
500 3300049574 Ga0501038_0032435 Ga0501038_0032435_668_1756 359
501 3300049575 Ga0501039_0030504 Ga0501039_0030504_375_1463 359
502 3300049578 Ga0501042_0072564 Ga0501042_0072564_694_1782 359
503 3300049579 Ga0501043_0027497 Ga0501043_0027497_2578_3672 359
504 3300049580 Ga0501046_0012466 Ga0501046_0012466_6027_7115 359
505 3300049582 Ga0501048_0006065 Ga0501048_0006065_5407_6495 359
506 3300049583 Ga0501067_0079688 Ga0501067_0079688_308_1396 359
507 3300049585 Ga0501069_0022239 Ga0501069_0022239_1244_2332 359
508 3300049586 Ga0501070_0023869 Ga0501070_0023869_1870_2958 359
509 3300049588 Ga0501072_0123383 Ga0501072_0123383_837_1925 359
510 3300049590 Ga0501074_0013053 Ga0501074_0013053_2794_3882 359
511 3300049742 Ga0501080_0015522 Ga0501080_0015522_5752_6840 359
512 3300049744 Ga0501083_0152919 Ga0501083_0152919_359_1447 359
513 3300049822 Ga0501035_0015069 Ga0501035_0015069_2094_3182 359
514 3300049822 Ga0501035_0067193 Ga0501035_0067193_1427_2515 359
515 3300049823 Ga0501044_0085807 Ga0501044_0085807_667_1755 359
516 3300049823 Ga0501044_0171682 Ga0501044_0171682_722_1816 359
517 3300049824 Ga0501045_0128314 Ga0501045_0128314_772_1860 359
518 3300050491 nmdc:mga00v17_25897_c1 nmdc:mga00v17_25897_c1_337_1419 359
519 3300050491 nmdc:mga00v17_6058_c1 nmdc:mga00v17_6058_c1_4364_5452 359
520 3300050492 nmdc:mga0yw44_160655_c1 nmdc:mga0yw44_160655_c1_74_1162 359
521 3300050492 nmdc:mga0yw44_28078_c1 nmdc:mga0yw44_28078_c1_1602_2690 359
522 3300050492 nmdc:mga0yw44_420_c1 nmdc:mga0yw44_420_c1_9193_10281 359
523 3300050494 nmdc:mga06z11_108055_c1 nmdc:mga06z11_108055_c1_391_1479 359
524 3300050494 nmdc:mga06z11_33569_c1 nmdc:mga06z11_33569_c1_1206_2294 359
525 3300053086 Ga0500578_0079942 Ga0500578_0079942_248_1336 359
526 3300053090 Ga0500646_0047535 Ga0500646_0047535_115_1203 359
527 3300053105 Ga0500557_023469 Ga0500557_023469_112_1200 359
528 3300053109 Ga0500569_000776 Ga0500569_000776_181_1269 359
529 3300053118 Ga0500594_0000634 Ga0500594_0000634_3799_4887 359
530 3300053139 Ga0500568_0000187 Ga0500568_0000187_36841_37929 359
531 3300053139 Ga0500568_0000559 Ga0500568_0000559_17537_18625 359
532 3300053146 Ga0500588_0012521 Ga0500588_0012521_158_1246 359
533 3300053153 Ga0500616_0000181 Ga0500616_0000181_86680_87768 359
534 3300053153 Ga0500616_0000872 Ga0500616_0000872_16596_17684 359
535 3300054114 Ga0501084_0195402 Ga0501084_0195402_357_1469 359
536 3300054114 Ga0501084_0391924 Ga0501084_0391924_14_1150 359
537 3300061734 Ga0530510_0251699 Ga0530510_0251699_19_1155 359
538 iso_pu_bacteria 2597490356 2599106498 359
539 iso_pu_bacteria 2842333319 2842334821 359
540 iso_pu_bacteria 2846952575 2846958141 359
541 iso_pu_bacteria 2848858292 2848864657 359
542 iso_pu_bacteria 8054002106 8054006442 359

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

243

327

0.89

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

64

248

0.77

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

53

299

0.76

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

101

338

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pu5-assembly1.cif.gz_A the crystal structure of a putative extracellular solute-binding protein from bordetella parapertussis 0.8769 31 357
3pu5-assembly1.cif.gz_A the crystal structure of a putative extracellular solute-binding protein from bordetella parapertussis 0.8692 31 357
4eq7-assembly1.cif.gz_A structure of atu4243-gaba receptor 0.8532 33 357
4edp-assembly2.cif.gz_B 1.85 angstrom resolution crystal structure of an abc transporter from clostridium perfringens atcc 13124 0.8414 37 357
6dgv-assembly1.cif.gz_A igabasnfr fluorescent gaba sensor precursor 0.8335 33 313
ID Description Score Start End Superfamily
1potA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8768 145 269 3.40.190.10
4r6yA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8662 33 327 3.40.190.10
1atgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8561 35 111 3.40.190.10
5tu0A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.844 31 313 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8417 35 320 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7U1E8P0-F1-model_v4 deleted 0.9568 91 359
AF-A0A7U1E8P0-F1-model_v4 deleted 0.9499 91 359
AF-A0A7C1NQ11-F1-model_v4 Extracellular solute-binding protein 0.9179 1 359 GO:0015846
GO:0015888
GO:0019808
GO:0030288
GO:0030975
GO:0030976
AF-A0A7C1NQ11-F1-model_v4 Extracellular solute-binding protein 0.9154 1 359 GO:0015846
GO:0015888
GO:0019808
GO:0030288
GO:0030975
GO:0030976
AF-A0A3A0E922-F1-model_v4 Polyamine ABC transporter substrate-binding protein 0.8961 51 358 GO:0015888
GO:0030288
GO:0030975
GO:0030976

Feature Viewer

pLDDT pTM Quality
89.57 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map