F461557

General Info

Members Datasets Scaffolds Average Seq Length
542 243 1084 328

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_003256|Ga0500618_003256_1096_2145
Length 336
Sequence MSNNEFEPPESLPNSQAAKPESAAAPVQTRGAAKEEKKPGWERDVLEKLALFAVKEQRARRRWSIFFRIVGLFVLVFGVWAIFNYGKTETQPLGTHTALVEIKGTIESEGQGSAGVVIPALDKAFAAQDSVGVILKINSPGGSPVQAGMINDEITRLRKAYPKKPIYVVVEADKIYVDKASLIGSVGVLMDGFGFTGLMDKLGVERRLLTAGENKSFLDPFSPQSARQKEYAQAMLNEIHQQFIEVVRQGRGARLKETPETFSGLIWTGSKAIEAGLADGYGTVDSVARDVIKAEDVVDYTQSENLSERVLKKFGVAVGSGIARFMTGGNQQLQLR

Samples

Sample ID Description Type Environment
1 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
130 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
131 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
153 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
154 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
155 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
203 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
204 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
205 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
228 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
229 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
230 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
234 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
235 2643221638 Duganella sp. Root336D2 Isolate Unclassified
236 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
237 2857553236 Duganella sp. R-74557 Isolate Unclassified
238 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
239 2904424332 Duganella sp. 1411 Isolate Rhizosphere
240 2919476304 Duganella sp. 3397 Isolate Unclassified
241 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
242 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
243 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 0.18
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.13
Nodule 0.37
Rhizoplane 2.95
Rhizosphere 76.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500618_003256 3300053125 Bacteria 5646
2 JGI25154J39366_1000625 3300002738 Bacteria 16782
3 JGI25158J39367_1004675 3300002739 Bacteria 2046
4 JGI25152J39213_1000108 3300002773 Bacteria 58108
5 JGI25152J39213_1004916 3300002773 Bacteria 4058
6 JGI25150J39212_1004167 3300002774 Bacteria 3258
7 JGI25150J39212_1004171 3300002774 Bacteria 3256
8 JGI25159J45721_1001197 3300002987 Bacteria 11051
9 JGI25159J45721_1010989 3300002987 Bacteria 2256
10 JGI25159J45721_1017494 3300002987 Bacteria 1480
11 JGI25153J46596_10011588 3300003215 Bacteria 3882
12 JGI25161J50226_1002336 3300003374 Bacteria 4921
13 JGI25161J50226_1006005 3300003374 Bacteria 2256
14 Ga0055525_1000246 3300003759 Bacteria 54885
15 Ga0055526_1000302 3300003771 Bacteria 41148
16 Ga0055526_1000505 3300003771 Bacteria 31041
17 Ga0055526_1017124 3300003771 Bacteria 2790
18 Ga0055526_1021931 3300003771 Bacteria 2197
19 Ga0055537_1000109 3300003773 Bacteria 62298
20 Ga0055537_1008512 3300003773 Bacteria 2360
21 Ga0055524_1000007 3300003775 Bacteria 298766
22 Ga0055524_1000487 3300003775 Bacteria 31220
23 Ga0055524_1001549 3300003775 Bacteria 12966
24 Ga0055524_1005395 3300003775 Bacteria 5717
25 Ga0055524_1020804 3300003775 Bacteria 2197
26 Ga0055534_1000280 3300003784 Bacteria 34767
27 Ga0055534_1005041 3300003784 Bacteria 3646
28 Ga0055534_1009014 3300003784 Bacteria 2205
29 Ga0055528_1000025 3300003790 Bacteria 130730
30 Ga0055528_1007466 3300003790 Bacteria 4830
31 Ga0055530_10016914 3300003791 Bacteria 2303
32 Ga0055530_10017365 3300003791 Bacteria 2259
33 Ga0055530_10017838 3300003791 Bacteria 2209
34 Ga0055531_10022484 3300003794 Bacteria 2400
35 Ga0055543_1004867 3300004625 Bacteria 3553
36 Ga0055543_1008367 3300004625 Bacteria 2294
37 Ga0065165_1000094 3300005262 Bacteria 146099
38 Ga0065165_1014179 3300005262 Bacteria 3110
39 Ga0065165_1020831 3300005262 Bacteria 2294
40 Ga0070658_10148617 3300005327 Bacteria 1960
41 Ga0070690_100053914 3300005330 Bacteria 2573
42 Ga0070670_100181892 3300005331 Bacteria 1825
43 Ga0070677_10004126 3300005333 Bacteria 4716
44 Ga0068869_100094542 3300005334 Bacteria 2254
45 Ga0070666_10097403 3300005335 Bacteria 2025
46 Ga0070680_100039585 3300005336 Bacteria 3814
47 Ga0068868_100027090 3300005338 Bacteria 4371
48 Ga0070660_100016092 3300005339 Bacteria 5421
49 Ga0070689_100076428 3300005340 Bacteria 2623
50 Ga0070661_100107370 3300005344 Bacteria 2082
51 Ga0070671_100035086 3300005355 Bacteria 4155
52 Ga0070674_100016107 3300005356 Bacteria 4683
53 Ga0070673_100037088 3300005364 Bacteria 3711
54 Ga0070688_100022542 3300005365 Bacteria 3693
55 Ga0070659_100004937 3300005366 Bacteria 9541
56 Ga0070701_10028227 3300005438 Bacteria 2757
57 Ga0070705_100063036 3300005440 Bacteria 2210
58 Ga0070700_100033087 3300005441 Bacteria 3112
59 Ga0070678_100340490 3300005456 Bacteria 1286
60 Ga0070662_100110799 3300005457 Bacteria 2091
61 Ga0068867_100017000 3300005459 Bacteria 5168
62 Ga0070672_100356647 3300005543 Bacteria 1247
63 Ga0070686_100038361 3300005544 Bacteria 2978
64 Ga0070686_100053116 3300005544 Bacteria 2586
65 Ga0070665_100053788 3300005548 Bacteria 4038
66 Ga0070664_100354973 3300005564 Bacteria 1334
67 Ga0070702_100032486 3300005615 Bacteria 2864
68 Ga0068864_100059872 3300005618 Bacteria 3296
69 Ga0068866_10024978 3300005718 Bacteria 2803
70 Ga0068870_10086995 3300005840 Bacteria 1739
71 Ga0068858_100028995 3300005842 Bacteria 5139
72 Ga0068862_100184796 3300005844 Bacteria 1872
73 Ga0075362_10025057 3300006177 Bacteria 2535
74 Ga0075362_10026544 3300006177 Bacteria 2475
75 Ga0075369_10053131 3300006186 Bacteria 1757
76 Ga0075366_10012732 3300006195 Bacteria 4779
77 Ga0097621_100130584 3300006237 Bacteria 2138
78 Ga0075370_10004370 3300006353 Bacteria 6850
79 Ga0068871_100062639 3300006358 Bacteria 3040
80 Ga0068865_100043470 3300006881 Bacteria 3070
81 Ga0075436_100023242 3300006914 Bacteria 4258
82 Ga0099826_10000003 3300006948 Bacteria 1067817
83 Ga0105244_10006042 3300009036 Bacteria 7933
84 Ga0105244_10073066 3300009036 Bacteria 1708
85 Ga0111539_10193625 3300009094 Bacteria 2372
86 Ga0105245_10174010 3300009098 Bacteria 2052
87 Ga0105242_10012102 3300009176 Bacteria 6638
88 Ga0105248_10153771 3300009177 Bacteria 2596
89 Ga0157371_10000001 3300013102 Bacteria 1162285
90 Ga0157374_10130464 3300013296 Bacteria 2432
91 Ga0157378_10039111 3300013297 Bacteria 4206
92 Ga0157378_10063511 3300013297 Bacteria 3299
93 Ga0157378_10526491 3300013297 Bacteria 1184
94 Ga0163162_10190673 3300013306 Bacteria 2177
95 Ga0157372_10162226 3300013307 Bacteria 2584
96 Ga0157375_10352518 3300013308 Bacteria 1637
97 Ga0163163_10131906 3300014325 Bacteria 2539
98 Ga0157380_10236924 3300014326 Bacteria 1643
99 Ga0157379_10051592 3300014968 Bacteria 3674
100 Ga0157376_10035735 3300014969 Bacteria 4021
101 Ga0157376_10071346 3300014969 Bacteria 2951
102 Ga0182006_1000075 3300015261 Bacteria 130239
103 Ga0182006_1000163 3300015261 Bacteria 70369
104 Ga0182006_1087260 3300015261 Bacteria 1127
105 Ga0182007_10001971 3300015262 Bacteria 10599
106 Ga0182007_10062078 3300015262 Bacteria 1225
107 Ga0182005_1000014 3300015265 Bacteria 389763
108 Ga0182005_1000020 3300015265 Bacteria 278671
109 Ga0163161_10118703 3300017792 Bacteria 1985
110 Ga0163161_10123715 3300017792 Bacteria 1946
111 Ga0213872_10000002 3300021361 Bacteria 554092
112 Ga0213872_10005140 3300021361 Bacteria 6779
113 Ga0209436_101028 3300025208 Bacteria 10691
114 Ga0209436_103915 3300025208 Bacteria 3794
115 Ga0209436_108057 3300025208 Bacteria 2136
116 Ga0209563_100007 3300025230 Bacteria 1579402
117 Ga0207425_1000001 3300025245 Bacteria 2525432
118 Ga0207425_1000255 3300025245 Bacteria 39628
119 Ga0209646_1000028 3300025246 Bacteria 387986
120 Ga0209129_1000001 3300025258 Bacteria 1452436
121 Ga0209565_1000009 3300025263 Bacteria 751701
122 Ga0209565_1003924 3300025263 Bacteria 4663
123 Ga0209565_1006684 3300025263 Bacteria 3204
124 Ga0209565_1010432 3300025263 Bacteria 2303
125 Ga0209565_1010824 3300025263 Bacteria 2248
126 Ga0209565_1021781 3300025263 Bacteria 1334
127 Ga0209673_1000036 3300025273 Bacteria 323162
128 Ga0209673_1007298 3300025273 Bacteria 5131
129 Ga0209130_1000583 3300025284 Bacteria 35520
130 Ga0209130_1001268 3300025284 Bacteria 17555
131 Ga0209675_1000013 3300025291 Bacteria 448220
132 Ga0209675_1003740 3300025291 Bacteria 7055
133 Ga0209675_1015623 3300025291 Bacteria 2245
134 Ga0209564_1000045 3300025295 Bacteria 376549
135 Ga0209564_1000122 3300025295 Bacteria 203709
136 Ga0209564_1007963 3300025295 Bacteria 5331
137 Ga0209564_1022821 3300025295 Bacteria 2195
138 Ga0209564_1042208 3300025295 Bacteria 1213
139 Ga0209758_1000055 3300025297 Bacteria 336183
140 Ga0209050_1000334 3300025298 Bacteria 93637
141 Ga0209050_1002941 3300025298 Bacteria 13325
142 Ga0209050_1014267 3300025298 Bacteria 3439
143 Ga0209256_1000005 3300025299 Bacteria 1315082
144 Ga0209256_1000358 3300025299 Bacteria 74650
145 Ga0209256_1000878 3300025299 Bacteria 37181
146 Ga0209256_1000920 3300025299 Bacteria 35969
147 Ga0209256_1001171 3300025299 Bacteria 29556
148 Ga0207426_1004986 3300025302 Bacteria 6250
149 Ga0207426_1018955 3300025302 Bacteria 2415
150 Ga0209257_1000010 3300025304 Bacteria 1158682
151 Ga0209257_1014380 3300025304 Bacteria 3404
152 Ga0207697_10003814 3300025315 Bacteria 7354
153 Ga0207655_1008272 3300025728 Bacteria 6624
154 Ga0207682_10000363 3300025893 Bacteria 20824
155 Ga0207642_10004852 3300025899 Bacteria 4354
156 Ga0207680_10031680 3300025903 Bacteria 2997
157 Ga0207645_10062035 3300025907 Bacteria 2388
158 Ga0207643_10023092 3300025908 Bacteria 3429
159 Ga0207660_10048920 3300025917 Bacteria 2994
160 Ga0207662_10007614 3300025918 Bacteria 5900
161 Ga0207657_10033043 3300025919 Bacteria 4667
162 Ga0207649_10132028 3300025920 Bacteria 1698
163 Ga0207649_10161433 3300025920 Bacteria 1553
164 Ga0207650_10278128 3300025925 Bacteria 1362
165 Ga0207659_10015172 3300025926 Bacteria 4984
166 Ga0207644_10019513 3300025931 Bacteria 4599
167 Ga0207690_10074811 3300025932 Bacteria 2347
168 Ga0207706_10054650 3300025933 Bacteria 3523
169 Ga0207686_10061296 3300025934 Bacteria 2384
170 Ga0207704_10026863 3300025938 Bacteria 3164
171 Ga0207691_10202267 3300025940 Bacteria 1728
172 Ga0207711_10104656 3300025941 Bacteria 2508
173 Ga0207689_10015061 3300025942 Bacteria 6555
174 Ga0207651_10021001 3300025960 Bacteria 3956
175 Ga0207668_10124592 3300025972 Bacteria 1957
176 Ga0207668_10339079 3300025972 Bacteria 1253
177 Ga0207703_10027157 3300026035 Bacteria 4508
178 Ga0207708_10011580 3300026075 Bacteria 6573
179 Ga0207641_10346196 3300026088 Bacteria 1415
180 Ga0207648_10014362 3300026089 Bacteria 7321
181 Ga0207676_10076033 3300026095 Bacteria 2711
182 Ga0207676_10081490 3300026095 Bacteria 2629
183 Ga0207675_100010097 3300026118 Bacteria 8851
184 Ga0207683_10021816 3300026121 Bacteria 5491
185 Ga0207698_10059432 3300026142 Bacteria 2968
186 Ga0209282_1000002 3300027666 Bacteria 1067825
187 Ga0268266_10136185 3300028379 Bacteria 2200
188 Ga0268264_10062576 3300028381 Bacteria 3125
189 Ga0316177_1019740 3300030731 Bacteria 1307
190 Ga0316180_1107837 3300030736 Bacteria 3133
191 Ga0316182_1198101 3300030745 Bacteria 1572
192 Ga0316182_1220741 3300030745 Bacteria 2103
193 Ga0307408_100012017 3300031548 Bacteria 5732
194 Ga0307408_100050835 3300031548 Bacteria 2982
195 Ga0307408_100098726 3300031548 Bacteria 2220
196 Ga0307518_10079346 3300031838 Bacteria 2370
197 Ga0307414_10029524 3300032004 Bacteria 3569
198 Ga0373931_0134429 3300035691 Bacteria 1427
199 Ga0395900_0000435 3300037418 Bacteria 60001
200 Ga0395900_0173152 3300037418 Bacteria 2196
201 Ga0395898_0186499 3300037466 Bacteria 1982
202 Ga0395905_0230110 3300037471 Bacteria 1733
203 Ga0395901_0101043 3300038443 Bacteria 3026
204 Ga0436361_0071273 3300039447 Bacteria 3208
205 Ga0436361_0684212 3300039447 Bacteria 74853
206 Ga0439448_0003818 3300042005 Bacteria 4210
207 Ga0451577_0026746 3300042876 Bacteria 5225
208 Ga0466969_0075349 3300044656 Bacteria 1617
209 Ga0466965_0009094 3300044683 Bacteria 4609
210 Ga0466966_0037541 3300044684 Bacteria 3123
211 Ga0466961_0035771 3300044693 Bacteria 3188
212 Ga0453684_0019207 3300044712 Bacteria 10420
213 Ga0466971_0039653 3300044719 Bacteria 2113
214 Ga0466957_0031481 3300044842 Bacteria 3170
215 Ga0466957_0090482 3300044842 Bacteria 1916
216 Ga0466957_0132930 3300044842 Bacteria 1596
217 Ga0466959_0025459 3300045049 Bacteria 4384
218 Ga0466959_0122264 3300045049 Bacteria 1849
219 Ga0451576_0018577 3300045051 Bacteria 7612
220 Ga0495617_000008 3300046452 Bacteria 340369
221 Ga0495617_000185 3300046452 Bacteria 39459
222 Ga0495627_000005 3300046453 Bacteria 630805
223 Ga0495627_000245 3300046453 Bacteria 57165
224 Ga0495627_011676 3300046453 Bacteria 3144
225 Ga0495627_056549 3300046453 Bacteria 1169
226 Ga0495590_0000017 3300046457 Bacteria 216944
227 Ga0495590_0000229 3300046457 Bacteria 30769
228 Ga0495591_000099 3300046458 Bacteria 99689
229 Ga0495591_007806 3300046458 Bacteria 4475
230 Ga0495638_0000066 3300046460 Bacteria 168673
231 Ga0495638_0007573 3300046460 Bacteria 7767
232 Ga0495638_0020289 3300046460 Bacteria 4391
233 Ga0495638_0093985 3300046460 Bacteria 1802
234 Ga0495650_0000015 3300046471 Bacteria 557595
235 Ga0495650_0002536 3300046471 Bacteria 14567
236 Ga0495650_0019836 3300046471 Bacteria 3295
237 Ga0495582_0093600 3300046473 Bacteria 1677
238 Ga0495605_0000202 3300046474 Bacteria 73353
239 Ga0495605_0011182 3300046474 Bacteria 5015
240 Ga0495605_0027231 3300046474 Bacteria 2962
241 Ga0495605_0029916 3300046474 Bacteria 2797
242 Ga0495605_0031562 3300046474 Bacteria 2705
243 Ga0495605_0064451 3300046474 Bacteria 1745
244 Ga0495584_0000043 3300046491 Bacteria 90007
245 Ga0495584_0000304 3300046491 Bacteria 34788
246 Ga0495584_0000321 3300046491 Bacteria 33487
247 Ga0495584_0002221 3300046491 Bacteria 11081
248 Ga0495584_0002286 3300046491 Bacteria 10929
249 Ga0495584_0004027 3300046491 Bacteria 7926
250 Ga0495584_0013066 3300046491 Bacteria 4235
251 Ga0495584_0013434 3300046491 Bacteria 4181
252 Ga0495585_0000224 3300046492 Bacteria 58217
253 Ga0495585_0000310 3300046492 Bacteria 48335
254 Ga0495585_0006856 3300046492 Bacteria 7024
255 Ga0495585_0007772 3300046492 Bacteria 6531
256 Ga0495585_0008478 3300046492 Bacteria 6227
257 Ga0495585_0014285 3300046492 Bacteria 4630
258 Ga0495585_0014917 3300046492 Bacteria 4519
259 Ga0495585_0017529 3300046492 Bacteria 4137
260 Ga0495585_0042837 3300046492 Bacteria 2533
261 Ga0495585_0056148 3300046492 Bacteria 2175
262 Ga0495585_0144216 3300046492 Bacteria 1245
263 Ga0495594_0001597 3300046499 Bacteria 11788
264 Ga0495594_0044410 3300046499 Bacteria 2437
265 Ga0495596_0000232 3300046500 Bacteria 37712
266 Ga0495596_0001237 3300046500 Bacteria 14880
267 Ga0495596_0008242 3300046500 Bacteria 4645
268 Ga0495596_0011232 3300046500 Bacteria 3869
269 Ga0495596_0030894 3300046500 Bacteria 2142
270 Ga0495607_0003286 3300046501 Bacteria 12420
271 Ga0495607_0003314 3300046501 Bacteria 12365
272 Ga0495607_0006566 3300046501 Bacteria 8172
273 Ga0495607_0008401 3300046501 Bacteria 7059
274 Ga0495607_0012255 3300046501 Bacteria 5668
275 Ga0495607_0021580 3300046501 Bacteria 4050
276 Ga0495607_0042558 3300046501 Bacteria 2691
277 Ga0495583_0000079 3300046506 Bacteria 169681
278 Ga0495583_0000104 3300046506 Bacteria 142553
279 Ga0495583_0000366 3300046506 Bacteria 70369
280 Ga0495583_0001031 3300046506 Bacteria 31591
281 Ga0495583_0001224 3300046506 Bacteria 27316
282 Ga0495583_0001553 3300046506 Bacteria 22732
283 Ga0495583_0005565 3300046506 Bacteria 8509
284 Ga0495583_0029362 3300046506 Bacteria 2691
285 Ga0495583_0085798 3300046506 Bacteria 1362
286 Ga0495583_0112950 3300046506 Bacteria 1149
287 Ga0495606_0000767 3300046507 Bacteria 49266
288 Ga0495606_0001209 3300046507 Bacteria 36268
289 Ga0495606_0005659 3300046507 Bacteria 11843
290 Ga0495606_0014353 3300046507 Bacteria 6191
291 Ga0495606_0014456 3300046507 Bacteria 6158
292 Ga0495606_0026674 3300046507 Bacteria 4114
293 Ga0495606_0035142 3300046507 Bacteria 3430
294 Ga0495610_0001471 3300046512 Bacteria 20781
295 Ga0495610_0009091 3300046512 Bacteria 6329
296 Ga0495610_0057420 3300046512 Bacteria 1866
297 Ga0495616_0000049 3300046513 Bacteria 108079
298 Ga0495616_0000169 3300046513 Bacteria 56134
299 Ga0495616_0005640 3300046513 Bacteria 7663
300 Ga0495616_0007422 3300046513 Bacteria 6561
301 Ga0495616_0015074 3300046513 Bacteria 4302
302 Ga0495616_0022124 3300046513 Bacteria 3435
303 Ga0495616_0026495 3300046513 Bacteria 3084
304 Ga0495616_0027245 3300046513 Bacteria 3034
305 Ga0495616_0027384 3300046513 Bacteria 3024
306 Ga0495631_0000234 3300046518 Bacteria 38074
307 Ga0495631_0002922 3300046518 Bacteria 9468
308 Ga0495631_0005507 3300046518 Bacteria 6618
309 Ga0495631_0007496 3300046518 Bacteria 5546
310 Ga0495631_0008591 3300046518 Bacteria 5142
311 Ga0495631_0009390 3300046518 Bacteria 4886
312 Ga0495631_0033383 3300046518 Bacteria 2312
313 Ga0495631_0089245 3300046518 Bacteria 1327
314 Ga0495632_0000139 3300046519 Bacteria 74242
315 Ga0495632_0000240 3300046519 Bacteria 54574
316 Ga0495632_0001498 3300046519 Bacteria 19316
317 Ga0495632_0001992 3300046519 Bacteria 16178
318 Ga0495632_0014754 3300046519 Bacteria 4408
319 Ga0495632_0034105 3300046519 Bacteria 2607
320 Ga0495637_0000026 3300046520 Bacteria 158526
321 Ga0495643_0000224 3300046522 Bacteria 86728
322 Ga0495643_0000613 3300046522 Bacteria 42548
323 Ga0495643_0007117 3300046522 Bacteria 7259
324 Ga0495643_0049723 3300046522 Bacteria 2260
325 Ga0495644_0006385 3300046523 Bacteria 4574
326 Ga0495644_0017956 3300046523 Bacteria 2702
327 Ga0495644_0063209 3300046523 Bacteria 1391
328 Ga0495648_0000055 3300046524 Bacteria 158686
329 Ga0495648_0000474 3300046524 Bacteria 43183
330 Ga0495648_0000844 3300046524 Bacteria 32306
331 Ga0495648_0003964 3300046524 Bacteria 12811
332 Ga0495648_0014577 3300046524 Bacteria 5746
333 Ga0495648_0020275 3300046524 Bacteria 4641
334 Ga0495648_0030099 3300046524 Bacteria 3595
335 Ga0495648_0036688 3300046524 Bacteria 3158
336 Ga0495648_0041685 3300046524 Bacteria 2896
337 Ga0495663_0011248 3300046525 Bacteria 2490
338 Ga0495663_0039968 3300046525 Bacteria 1422
339 Ga0495663_0047650 3300046525 Bacteria 1320
340 Ga0495666_0029781 3300046526 Bacteria 2685
341 Ga0495642_0000058 3300046528 Bacteria 66850
342 Ga0495642_0000105 3300046528 Bacteria 47078
343 Ga0495642_0000693 3300046528 Bacteria 16716
344 Ga0495642_0002824 3300046528 Bacteria 6946
345 Ga0495642_0004555 3300046528 Bacteria 5370
346 Ga0495642_0005781 3300046528 Bacteria 4743
347 Ga0495642_0018882 3300046528 Bacteria 2699
348 Ga0495642_0024586 3300046528 Bacteria 2383
349 Ga0495642_0038310 3300046528 Bacteria 1942
350 Ga0495642_0099683 3300046528 Bacteria 1235
351 Ga0495642_0148639 3300046528 Bacteria 1013
352 Ga0495654_0008823 3300046530 Bacteria 5544
353 Ga0495654_0014363 3300046530 Bacteria 4214
354 Ga0495654_0014753 3300046530 Bacteria 4154
355 Ga0495654_0023975 3300046530 Bacteria 3156
356 Ga0495654_0046153 3300046530 Bacteria 2147
357 Ga0495640_0034301 3300046533 Bacteria 3600
358 Ga0495609_0000257 3300046538 Bacteria 50114
359 Ga0495609_0001372 3300046538 Bacteria 16353
360 Ga0495609_0002528 3300046538 Bacteria 11216
361 Ga0495609_0002694 3300046538 Bacteria 10726
362 Ga0495609_0006076 3300046538 Bacteria 6217
363 Ga0495609_0013233 3300046538 Bacteria 3901
364 Ga0495609_0041425 3300046538 Bacteria 2070
365 Ga0495621_0035130 3300046539 Bacteria 1735
366 Ga0495597_0000031 3300046542 Bacteria 133296
367 Ga0495597_0000346 3300046542 Bacteria 41442
368 Ga0495597_0000722 3300046542 Bacteria 26357
369 Ga0495597_0001803 3300046542 Bacteria 14677
370 Ga0495597_0013211 3300046542 Bacteria 3962
371 Ga0495597_0039995 3300046542 Bacteria 2096
372 Ga0495597_0087569 3300046542 Bacteria 1325
373 Ga0495622_0002914 3300046557 Bacteria 8164
374 Ga0495622_0002968 3300046557 Bacteria 8065
375 Ga0495622_0018766 3300046557 Bacteria 3221
376 Ga0495622_0083822 3300046557 Bacteria 1466
377 Ga0495633_0000230 3300046558 Bacteria 68204
378 Ga0495633_0006084 3300046558 Bacteria 7231
379 Ga0495633_0011346 3300046558 Bacteria 4809
380 Ga0495633_0011495 3300046558 Bacteria 4768
381 Ga0495633_0015990 3300046558 Bacteria 3882
382 Ga0495633_0024792 3300046558 Bacteria 2959
383 Ga0495668_0000168 3300046616 Bacteria 97230
384 Ga0495668_0000319 3300046616 Bacteria 66006
385 Ga0495668_0005379 3300046616 Bacteria 8708
386 Ga0495668_0011292 3300046616 Bacteria 5358
387 Ga0495668_0025212 3300046616 Bacteria 3380
388 Ga0495668_0033515 3300046616 Bacteria 2885
389 Ga0495668_0041716 3300046616 Bacteria 2555
390 Ga0495668_0096222 3300046616 Bacteria 1620
391 Ga0495668_0179282 3300046616 Bacteria 1160
392 Ga0495668_0208731 3300046616 Bacteria 1069
393 Ga0495611_0002428 3300046648 Bacteria 8532
394 Ga0495611_0017644 3300046648 Bacteria 3055
395 Ga0495611_0034009 3300046648 Bacteria 2251
396 Ga0495611_0072713 3300046648 Bacteria 1573
397 Ga0495625_0000562 3300046660 Bacteria 54473
398 Ga0495625_0001266 3300046660 Bacteria 31745
399 Ga0495625_0007149 3300046660 Bacteria 9801
400 Ga0495625_0030616 3300046660 Bacteria 4013
401 Ga0495625_0135208 3300046660 Bacteria 1667
402 Ga0495659_0001625 3300046664 Bacteria 7545
403 Ga0495661_0000190 3300046665 Bacteria 71131
404 Ga0495661_0000610 3300046665 Bacteria 36400
405 Ga0495661_0003165 3300046665 Bacteria 12320
406 Ga0495661_0004682 3300046665 Bacteria 9828
407 Ga0495661_0009017 3300046665 Bacteria 6864
408 Ga0495661_0030039 3300046665 Bacteria 3462
409 Ga0495661_0033864 3300046665 Bacteria 3219
410 Ga0495661_0040990 3300046665 Bacteria 2868
411 Ga0495661_0041733 3300046665 Bacteria 2835
412 Ga0495661_0103954 3300046665 Bacteria 1593
413 Ga0495669_0000112 3300046684 Bacteria 52782
414 Ga0495669_0005175 3300046684 Bacteria 5426
415 Ga0495669_0009098 3300046684 Bacteria 4186
416 Ga0495669_0010837 3300046684 Bacteria 3859
417 Ga0495669_0012444 3300046684 Bacteria 3622
418 Ga0495670_0004483 3300046691 Bacteria 6846
419 Ga0495670_0009216 3300046691 Bacteria 4855
420 Ga0495670_0018566 3300046691 Bacteria 3424
421 Ga0495670_0038514 3300046691 Bacteria 2383
422 Ga0495670_0153671 3300046691 Bacteria 1207
423 Ga0495671_0000405 3300046692 Bacteria 34951
424 Ga0495671_0016968 3300046692 Bacteria 3878
425 Ga0495671_0033252 3300046692 Bacteria 2628
426 Ga0495671_0035890 3300046692 Bacteria 2515
427 Ga0495671_0133119 3300046692 Bacteria 1212
428 Ga0495649_0000463 3300046694 Bacteria 34901
429 Ga0495649_0009769 3300046694 Bacteria 5683
430 Ga0495589_0000129 3300046794 Bacteria 69672
431 Ga0495589_0007387 3300046794 Bacteria 5754
432 Ga0495589_0015733 3300046794 Bacteria 3889
433 Ga0495660_0000416 3300046810 Bacteria 36277
434 Ga0495660_0006179 3300046810 Bacteria 7108
435 Ga0495660_0016598 3300046810 Bacteria 4245
436 Ga0495660_0021358 3300046810 Bacteria 3707
437 Ga0495660_0027048 3300046810 Bacteria 3246
438 Ga0495660_0034552 3300046810 Bacteria 2828
439 Ga0495604_0023567 3300047317 Bacteria 4911
440 Ga0495604_0053532 3300047317 Bacteria 3118
441 Ga0495636_0015555 3300047318 Bacteria 3032
442 Ga0495672_0000050 3300047320 Bacteria 240336
443 Ga0495672_0000186 3300047320 Bacteria 89947
444 Ga0495672_0022609 3300047320 Bacteria 4085
445 Ga0495676_0177776 3300047321 Bacteria 1493
446 Ga0495683_0000365 3300047323 Bacteria 37314
447 Ga0495683_0001455 3300047323 Bacteria 15522
448 Ga0495687_000425 3300047443 Bacteria 52066
449 Ga0495687_001484 3300047443 Bacteria 21443
450 Ga0495687_003587 3300047443 Bacteria 11129
451 Ga0495687_003700 3300047443 Bacteria 10871
452 Ga0495687_006823 3300047443 Bacteria 6889
453 Ga0495687_008758 3300047443 Bacteria 5748
454 Ga0495687_075909 3300047443 Bacteria 1332
455 Ga0495677_0000080 3300047445 Bacteria 48921
456 Ga0495677_0000276 3300047445 Bacteria 22535
457 Ga0495677_0002345 3300047445 Bacteria 7447
458 Ga0495677_0004361 3300047445 Bacteria 5437
459 Ga0495677_0020081 3300047445 Bacteria 2421
460 Ga0495679_002531 3300047446 Bacteria 9234
461 Ga0495679_004395 3300047446 Bacteria 6524
462 Ga0495679_017422 3300047446 Bacteria 2571
463 Ga0495679_021269 3300047446 Bacteria 2244
464 Ga0495685_002134 3300047447 Bacteria 6142
465 Ga0495685_003505 3300047447 Bacteria 5008
466 Ga0495681_0000247 3300047470 Bacteria 44236
467 Ga0495681_0001214 3300047470 Bacteria 19614
468 Ga0495681_0005547 3300047470 Bacteria 8428
469 Ga0495681_0007025 3300047470 Bacteria 7272
470 Ga0495681_0007149 3300047470 Bacteria 7185
471 Ga0495681_0009745 3300047470 Bacteria 5885
472 Ga0495681_0010818 3300047470 Bacteria 5492
473 Ga0495681_0011453 3300047470 Bacteria 5281
474 Ga0495681_0027153 3300047470 Bacteria 2967
475 Ga0495686_0000438 3300047472 Bacteria 64190
476 Ga0495686_0004156 3300047472 Bacteria 12046
477 Ga0495686_0006723 3300047472 Bacteria 8744
478 Ga0495686_0012215 3300047472 Bacteria 6016
479 Ga0495686_0021759 3300047472 Bacteria 4252
480 Ga0495626_0001439 3300048091 Bacteria 18932
481 Ga0495626_0007601 3300048091 Bacteria 6010
482 Ga0495626_0008519 3300048091 Bacteria 5610
483 Ga0495626_0009657 3300048091 Bacteria 5203
484 Ga0495626_0012202 3300048091 Bacteria 4514
485 Ga0495626_0012750 3300048091 Bacteria 4394
486 Ga0495626_0036925 3300048091 Bacteria 2325
487 Ga0496100_0256825 3300048903 Bacteria 1294
488 Ga0496102_0000194 3300048905 Bacteria 83095
489 Ga0496102_0000303 3300048905 Bacteria 62809
490 Ga0496102_0012374 3300048905 Bacteria 7382
491 Ga0496103_0011765 3300048906 Bacteria 5192
492 Ga0496105_0088859 3300048908 Bacteria 2553
493 Ga0496105_0093957 3300048908 Bacteria 2477
494 Ga0496106_0278074 3300048909 Bacteria 1341
495 Ga0496108_0496588 3300048911 Bacteria 1066
496 Ga0496110_0000262 3300048913 Bacteria 34117
497 Ga0496111_0025582 3300048914 Bacteria 4165
498 Ga0496111_0155665 3300048914 Bacteria 1696
499 Ga0496113_0007577 3300048916 Bacteria 7001
500 Ga0496113_0010103 3300048916 Bacteria 6227
501 Ga0496115_0275603 3300048918 Bacteria 1381
502 Ga0496116_0007201 3300048919 Bacteria 9935
503 Ga0496117_0000001 3300048920 Bacteria 2526244
504 Ga0496118_0000008 3300048921 Bacteria 644537
505 Ga0496121_0019733 3300048924 Bacteria 6722
506 Ga0496121_0031223 3300048924 Bacteria 4871
507 Ga0496122_0000248 3300048925 Bacteria 121158
508 Ga0496122_0006607 3300048925 Bacteria 13232
509 Ga0496122_0025314 3300048925 Bacteria 5156
510 Ga0496123_0000122 3300048926 Bacteria 158966
511 Ga0496123_0002551 3300048926 Bacteria 22201
512 Ga0496123_0010306 3300048926 Bacteria 8291
513 Ga0496124_0017133 3300048927 Bacteria 6848
514 Ga0496124_0159976 3300048927 Bacteria 1756
515 Ga0496124_0240243 3300048927 Bacteria 1347
516 Ga0496125_0003268 3300048928 Bacteria 19942
517 Ga0496125_0096906 3300048928 Bacteria 2188
518 Ga0496125_0165378 3300048928 Bacteria 1496
519 Ga0501310_006263 3300049130 Bacteria 1245
520 Ga0495678_000016 3300049459 Bacteria 303426
521 Ga0495678_000196 3300049459 Bacteria 70932
522 Ga0495678_000487 3300049459 Bacteria 39369
523 Ga0495678_000577 3300049459 Bacteria 34773
524 Ga0495678_027395 3300049459 Bacteria 2417
525 Ga0495682_0003277 3300049460 Bacteria 7247
526 Ga0495682_0020666 3300049460 Bacteria 2470
527 Ga0501269_000086 3300049766 Bacteria 28992
528 Ga0501279_001838 3300049775 Bacteria 2798
529 nmdc:mga08y16_148089_c1 3300050511 Bacteria 2440
530 nmdc:mga08x19_17370_c1 3300050514 Bacteria 4402
531 Ga0500618_000431 3300053125 Bacteria 27850
532 2601670914 2600255292 Bacteria 6300551
533 2643788281 2643221554 Bacteria 6603920
534 2644213790 2643221638 Bacteria 6579467
535 2857547686 2857547612 Bacteria 6179999
536 2857553788 2857553236 Bacteria 6166726
537 2885083726 2885080285 Bacteria 6355622
538 2904430524 2904424332 Bacteria 7633521
539 2919480412 2919476304 Bacteria 5888696
540 2932412294 2932410948 Bacteria 6312192
541 2932419809 2932416698 Bacteria 6315112
542 8047678208 8047673197 Bacteria 7395230
543 Ga0500618_003256
544 JGI25154J39366_1000625
545 JGI25158J39367_1004675
546 JGI25152J39213_1000108
547 JGI25152J39213_1004916
548 JGI25150J39212_1004167
549 JGI25150J39212_1004171
550 JGI25159J45721_1001197
551 JGI25159J45721_1010989
552 JGI25159J45721_1017494
553 JGI25153J46596_10011588
554 JGI25161J50226_1002336
555 JGI25161J50226_1006005
556 Ga0055525_1000246
557 Ga0055526_1000302
558 Ga0055526_1000505
559 Ga0055526_1017124
560 Ga0055526_1021931
561 Ga0055537_1000109
562 Ga0055537_1008512
563 Ga0055524_1000007
564 Ga0055524_1000487
565 Ga0055524_1001549
566 Ga0055524_1005395
567 Ga0055524_1020804
568 Ga0055534_1000280
569 Ga0055534_1005041
570 Ga0055534_1009014
571 Ga0055528_1000025
572 Ga0055528_1007466
573 Ga0055530_10016914
574 Ga0055530_10017365
575 Ga0055530_10017838
576 Ga0055531_10022484
577 Ga0055543_1004867
578 Ga0055543_1008367
579 Ga0065165_1000094
580 Ga0065165_1014179
581 Ga0065165_1020831
582 Ga0070658_10148617
583 Ga0070690_100053914
584 Ga0070670_100181892
585 Ga0070677_10004126
586 Ga0068869_100094542
587 Ga0070666_10097403
588 Ga0070680_100039585
589 Ga0068868_100027090
590 Ga0070660_100016092
591 Ga0070689_100076428
592 Ga0070661_100107370
593 Ga0070671_100035086
594 Ga0070674_100016107
595 Ga0070673_100037088
596 Ga0070688_100022542
597 Ga0070659_100004937
598 Ga0070701_10028227
599 Ga0070705_100063036
600 Ga0070700_100033087
601 Ga0070678_100340490
602 Ga0070662_100110799
603 Ga0068867_100017000
604 Ga0070672_100356647
605 Ga0070686_100038361
606 Ga0070686_100053116
607 Ga0070665_100053788
608 Ga0070664_100354973
609 Ga0070702_100032486
610 Ga0068864_100059872
611 Ga0068866_10024978
612 Ga0068870_10086995
613 Ga0068858_100028995
614 Ga0068862_100184796
615 Ga0075362_10025057
616 Ga0075362_10026544
617 Ga0075369_10053131
618 Ga0075366_10012732
619 Ga0097621_100130584
620 Ga0075370_10004370
621 Ga0068871_100062639
622 Ga0068865_100043470
623 Ga0075436_100023242
624 Ga0099826_10000003
625 Ga0105244_10006042
626 Ga0105244_10073066
627 Ga0111539_10193625
628 Ga0105245_10174010
629 Ga0105242_10012102
630 Ga0105248_10153771
631 Ga0157371_10000001
632 Ga0157374_10130464
633 Ga0157378_10039111
634 Ga0157378_10063511
635 Ga0157378_10526491
636 Ga0163162_10190673
637 Ga0157372_10162226
638 Ga0157375_10352518
639 Ga0163163_10131906
640 Ga0157380_10236924
641 Ga0157379_10051592
642 Ga0157376_10035735
643 Ga0157376_10071346
644 Ga0182006_1000075
645 Ga0182006_1000163
646 Ga0182006_1087260
647 Ga0182007_10001971
648 Ga0182007_10062078
649 Ga0182005_1000014
650 Ga0182005_1000020
651 Ga0163161_10118703
652 Ga0163161_10123715
653 Ga0213872_10000002
654 Ga0213872_10005140
655 Ga0209436_101028
656 Ga0209436_103915
657 Ga0209436_108057
658 Ga0209563_100007
659 Ga0207425_1000001
660 Ga0207425_1000255
661 Ga0209646_1000028
662 Ga0209129_1000001
663 Ga0209565_1000009
664 Ga0209565_1003924
665 Ga0209565_1006684
666 Ga0209565_1010432
667 Ga0209565_1010824
668 Ga0209565_1021781
669 Ga0209673_1000036
670 Ga0209673_1007298
671 Ga0209130_1000583
672 Ga0209130_1001268
673 Ga0209675_1000013
674 Ga0209675_1003740
675 Ga0209675_1015623
676 Ga0209564_1000045
677 Ga0209564_1000122
678 Ga0209564_1007963
679 Ga0209564_1022821
680 Ga0209564_1042208
681 Ga0209758_1000055
682 Ga0209050_1000334
683 Ga0209050_1002941
684 Ga0209050_1014267
685 Ga0209256_1000005
686 Ga0209256_1000358
687 Ga0209256_1000878
688 Ga0209256_1000920
689 Ga0209256_1001171
690 Ga0207426_1004986
691 Ga0207426_1018955
692 Ga0209257_1000010
693 Ga0209257_1014380
694 Ga0207697_10003814
695 Ga0207655_1008272
696 Ga0207682_10000363
697 Ga0207642_10004852
698 Ga0207680_10031680
699 Ga0207645_10062035
700 Ga0207643_10023092
701 Ga0207660_10048920
702 Ga0207662_10007614
703 Ga0207657_10033043
704 Ga0207649_10132028
705 Ga0207649_10161433
706 Ga0207650_10278128
707 Ga0207659_10015172
708 Ga0207644_10019513
709 Ga0207690_10074811
710 Ga0207706_10054650
711 Ga0207686_10061296
712 Ga0207704_10026863
713 Ga0207691_10202267
714 Ga0207711_10104656
715 Ga0207689_10015061
716 Ga0207651_10021001
717 Ga0207668_10124592
718 Ga0207668_10339079
719 Ga0207703_10027157
720 Ga0207708_10011580
721 Ga0207641_10346196
722 Ga0207648_10014362
723 Ga0207676_10076033
724 Ga0207676_10081490
725 Ga0207675_100010097
726 Ga0207683_10021816
727 Ga0207698_10059432
728 Ga0209282_1000002
729 Ga0268266_10136185
730 Ga0268264_10062576
731 Ga0316177_1019740
732 Ga0316180_1107837
733 Ga0316182_1198101
734 Ga0316182_1220741
735 Ga0307408_100012017
736 Ga0307408_100050835
737 Ga0307408_100098726
738 Ga0307518_10079346
739 Ga0307414_10029524
740 Ga0373931_0134429
741 Ga0395900_0000435
742 Ga0395900_0173152
743 Ga0395898_0186499
744 Ga0395905_0230110
745 Ga0395901_0101043
746 Ga0436361_0071273
747 Ga0436361_0684212
748 Ga0439448_0003818
749 Ga0451577_0026746
750 Ga0466969_0075349
751 Ga0466965_0009094
752 Ga0466966_0037541
753 Ga0466961_0035771
754 Ga0453684_0019207
755 Ga0466971_0039653
756 Ga0466957_0031481
757 Ga0466957_0090482
758 Ga0466957_0132930
759 Ga0466959_0025459
760 Ga0466959_0122264
761 Ga0451576_0018577
762 Ga0495617_000008
763 Ga0495617_000185
764 Ga0495627_000005
765 Ga0495627_000245
766 Ga0495627_011676
767 Ga0495627_056549
768 Ga0495590_0000017
769 Ga0495590_0000229
770 Ga0495591_000099
771 Ga0495591_007806
772 Ga0495638_0000066
773 Ga0495638_0007573
774 Ga0495638_0020289
775 Ga0495638_0093985
776 Ga0495650_0000015
777 Ga0495650_0002536
778 Ga0495650_0019836
779 Ga0495582_0093600
780 Ga0495605_0000202
781 Ga0495605_0011182
782 Ga0495605_0027231
783 Ga0495605_0029916
784 Ga0495605_0031562
785 Ga0495605_0064451
786 Ga0495584_0000043
787 Ga0495584_0000304
788 Ga0495584_0000321
789 Ga0495584_0002221
790 Ga0495584_0002286
791 Ga0495584_0004027
792 Ga0495584_0013066
793 Ga0495584_0013434
794 Ga0495585_0000224
795 Ga0495585_0000310
796 Ga0495585_0006856
797 Ga0495585_0007772
798 Ga0495585_0008478
799 Ga0495585_0014285
800 Ga0495585_0014917
801 Ga0495585_0017529
802 Ga0495585_0042837
803 Ga0495585_0056148
804 Ga0495585_0144216
805 Ga0495594_0001597
806 Ga0495594_0044410
807 Ga0495596_0000232
808 Ga0495596_0001237
809 Ga0495596_0008242
810 Ga0495596_0011232
811 Ga0495596_0030894
812 Ga0495607_0003286
813 Ga0495607_0003314
814 Ga0495607_0006566
815 Ga0495607_0008401
816 Ga0495607_0012255
817 Ga0495607_0021580
818 Ga0495607_0042558
819 Ga0495583_0000079
820 Ga0495583_0000104
821 Ga0495583_0000366
822 Ga0495583_0001031
823 Ga0495583_0001224
824 Ga0495583_0001553
825 Ga0495583_0005565
826 Ga0495583_0029362
827 Ga0495583_0085798
828 Ga0495583_0112950
829 Ga0495606_0000767
830 Ga0495606_0001209
831 Ga0495606_0005659
832 Ga0495606_0014353
833 Ga0495606_0014456
834 Ga0495606_0026674
835 Ga0495606_0035142
836 Ga0495610_0001471
837 Ga0495610_0009091
838 Ga0495610_0057420
839 Ga0495616_0000049
840 Ga0495616_0000169
841 Ga0495616_0005640
842 Ga0495616_0007422
843 Ga0495616_0015074
844 Ga0495616_0022124
845 Ga0495616_0026495
846 Ga0495616_0027245
847 Ga0495616_0027384
848 Ga0495631_0000234
849 Ga0495631_0002922
850 Ga0495631_0005507
851 Ga0495631_0007496
852 Ga0495631_0008591
853 Ga0495631_0009390
854 Ga0495631_0033383
855 Ga0495631_0089245
856 Ga0495632_0000139
857 Ga0495632_0000240
858 Ga0495632_0001498
859 Ga0495632_0001992
860 Ga0495632_0014754
861 Ga0495632_0034105
862 Ga0495637_0000026
863 Ga0495643_0000224
864 Ga0495643_0000613
865 Ga0495643_0007117
866 Ga0495643_0049723
867 Ga0495644_0006385
868 Ga0495644_0017956
869 Ga0495644_0063209
870 Ga0495648_0000055
871 Ga0495648_0000474
872 Ga0495648_0000844
873 Ga0495648_0003964
874 Ga0495648_0014577
875 Ga0495648_0020275
876 Ga0495648_0030099
877 Ga0495648_0036688
878 Ga0495648_0041685
879 Ga0495663_0011248
880 Ga0495663_0039968
881 Ga0495663_0047650
882 Ga0495666_0029781
883 Ga0495642_0000058
884 Ga0495642_0000105
885 Ga0495642_0000693
886 Ga0495642_0002824
887 Ga0495642_0004555
888 Ga0495642_0005781
889 Ga0495642_0018882
890 Ga0495642_0024586
891 Ga0495642_0038310
892 Ga0495642_0099683
893 Ga0495642_0148639
894 Ga0495654_0008823
895 Ga0495654_0014363
896 Ga0495654_0014753
897 Ga0495654_0023975
898 Ga0495654_0046153
899 Ga0495640_0034301
900 Ga0495609_0000257
901 Ga0495609_0001372
902 Ga0495609_0002528
903 Ga0495609_0002694
904 Ga0495609_0006076
905 Ga0495609_0013233
906 Ga0495609_0041425
907 Ga0495621_0035130
908 Ga0495597_0000031
909 Ga0495597_0000346
910 Ga0495597_0000722
911 Ga0495597_0001803
912 Ga0495597_0013211
913 Ga0495597_0039995
914 Ga0495597_0087569
915 Ga0495622_0002914
916 Ga0495622_0002968
917 Ga0495622_0018766
918 Ga0495622_0083822
919 Ga0495633_0000230
920 Ga0495633_0006084
921 Ga0495633_0011346
922 Ga0495633_0011495
923 Ga0495633_0015990
924 Ga0495633_0024792
925 Ga0495668_0000168
926 Ga0495668_0000319
927 Ga0495668_0005379
928 Ga0495668_0011292
929 Ga0495668_0025212
930 Ga0495668_0033515
931 Ga0495668_0041716
932 Ga0495668_0096222
933 Ga0495668_0179282
934 Ga0495668_0208731
935 Ga0495611_0002428
936 Ga0495611_0017644
937 Ga0495611_0034009
938 Ga0495611_0072713
939 Ga0495625_0000562
940 Ga0495625_0001266
941 Ga0495625_0007149
942 Ga0495625_0030616
943 Ga0495625_0135208
944 Ga0495659_0001625
945 Ga0495661_0000190
946 Ga0495661_0000610
947 Ga0495661_0003165
948 Ga0495661_0004682
949 Ga0495661_0009017
950 Ga0495661_0030039
951 Ga0495661_0033864
952 Ga0495661_0040990
953 Ga0495661_0041733
954 Ga0495661_0103954
955 Ga0495669_0000112
956 Ga0495669_0005175
957 Ga0495669_0009098
958 Ga0495669_0010837
959 Ga0495669_0012444
960 Ga0495670_0004483
961 Ga0495670_0009216
962 Ga0495670_0018566
963 Ga0495670_0038514
964 Ga0495670_0153671
965 Ga0495671_0000405
966 Ga0495671_0016968
967 Ga0495671_0033252
968 Ga0495671_0035890
969 Ga0495671_0133119
970 Ga0495649_0000463
971 Ga0495649_0009769
972 Ga0495589_0000129
973 Ga0495589_0007387
974 Ga0495589_0015733
975 Ga0495660_0000416
976 Ga0495660_0006179
977 Ga0495660_0016598
978 Ga0495660_0021358
979 Ga0495660_0027048
980 Ga0495660_0034552
981 Ga0495604_0023567
982 Ga0495604_0053532
983 Ga0495636_0015555
984 Ga0495672_0000050
985 Ga0495672_0000186
986 Ga0495672_0022609
987 Ga0495676_0177776
988 Ga0495683_0000365
989 Ga0495683_0001455
990 Ga0495687_000425
991 Ga0495687_001484
992 Ga0495687_003587
993 Ga0495687_003700
994 Ga0495687_006823
995 Ga0495687_008758
996 Ga0495687_075909
997 Ga0495677_0000080
998 Ga0495677_0000276
999 Ga0495677_0002345
1000 Ga0495677_0004361
1001 Ga0495677_0020081
1002 Ga0495679_002531
1003 Ga0495679_004395
1004 Ga0495679_017422
1005 Ga0495679_021269
1006 Ga0495685_002134
1007 Ga0495685_003505
1008 Ga0495681_0000247
1009 Ga0495681_0001214
1010 Ga0495681_0005547
1011 Ga0495681_0007025
1012 Ga0495681_0007149
1013 Ga0495681_0009745
1014 Ga0495681_0010818
1015 Ga0495681_0011453
1016 Ga0495681_0027153
1017 Ga0495686_0000438
1018 Ga0495686_0004156
1019 Ga0495686_0006723
1020 Ga0495686_0012215
1021 Ga0495686_0021759
1022 Ga0495626_0001439
1023 Ga0495626_0007601
1024 Ga0495626_0008519
1025 Ga0495626_0009657
1026 Ga0495626_0012202
1027 Ga0495626_0012750
1028 Ga0495626_0036925
1029 Ga0496100_0256825
1030 Ga0496102_0000194
1031 Ga0496102_0000303
1032 Ga0496102_0012374
1033 Ga0496103_0011765
1034 Ga0496105_0088859
1035 Ga0496105_0093957
1036 Ga0496106_0278074
1037 Ga0496108_0496588
1038 Ga0496110_0000262
1039 Ga0496111_0025582
1040 Ga0496111_0155665
1041 Ga0496113_0007577
1042 Ga0496113_0010103
1043 Ga0496115_0275603
1044 Ga0496116_0007201
1045 Ga0496117_0000001
1046 Ga0496118_0000008
1047 Ga0496121_0019733
1048 Ga0496121_0031223
1049 Ga0496122_0000248
1050 Ga0496122_0006607
1051 Ga0496122_0025314
1052 Ga0496123_0000122
1053 Ga0496123_0002551
1054 Ga0496123_0010306
1055 Ga0496124_0017133
1056 Ga0496124_0159976
1057 Ga0496124_0240243
1058 Ga0496125_0003268
1059 Ga0496125_0096906
1060 Ga0496125_0165378
1061 Ga0501310_006263
1062 Ga0495678_000016
1063 Ga0495678_000196
1064 Ga0495678_000487
1065 Ga0495678_000577
1066 Ga0495678_027395
1067 Ga0495682_0003277
1068 Ga0495682_0020666
1069 Ga0501269_000086
1070 Ga0501279_001838
1071 nmdc:mga08y16_148089_c1
1072 nmdc:mga08x19_17370_c1
1073 Ga0500618_000431
1074 2601670914
1075 2643788281
1076 2644213790
1077 2857547686
1078 2857553788
1079 2885083726
1080 2904430524
1081 2919480412
1082 2932412294
1083 2932419809
1084 8047678208

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01343

Peptidase_S49

Peptidase family S49

162

298

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ybu-assembly1.cif.gz_C human propionyl-coenzyme a carboxylase 0.7713 101 187
4fb8-assembly1.cif.gz_A crystal structure of apo acyl-coa carboxylase 0.7668 101 193
2ce3-assembly1.cif.gz_G crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis 0.735 90 287
7p81-assembly2.cif.gz_b crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) 0.7334 90 287
3hln-assembly2.cif.gz_1 crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds 0.7296 90 287
ID Description Score Start End Superfamily
af_Q8WW27_38_226_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.7956 142 161 3.40.140.10
3bezC03 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7756 78 304 3.90.226.10
4kwbC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7712 86 319 3.90.226.10
4kwbC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7626 86 319 3.90.226.10
3bezC03 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7578 78 304 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7J7B0F9-F1-model_v4 deleted 0.8168 109 211
AF-A0A1B6NVY5-F1-model_v4 Signal peptide peptidase SppA, 36K type 0.774 57 192 GO:0006508
GO:0008236
AF-A0A451CI57-F1-model_v4 Protease-4 0.7478 97 305 GO:0006508
GO:0008236
AF-A0A6S5RP93-F1-model_v4 Peptidase 0.7391 97 311 GO:0006508
GO:0008236
AF-A0A2R3IKT6-F1-model_v4 Signal peptide peptidase SppA, 36K type (EC 3.4.-.-) 0.7377 76 306 GO:0006508
GO:0008236

Map