F461561

General Info

Members Datasets Scaffolds Average Seq Length
542 346 1084 421

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2671180195|2671839553
Length 485
Sequence ATILRSEDHRSNMVASVATLAQEYEHSRQAVGRMTLMPPGRPSRPRHGARPGGSAPDLGNLARMALLVAKFGGSSVADADXIKRVAERIVETRRAGNDVVVVVSAMGDTTDDLLDLAEQVSPVPPARELDMLLTAGERISMALLAMAITKLGAEARSFTGSQAGVITDSVHGKARIIDVTPGRIRTALDEGAIAIVAGFQGVSQDTKDITTLGRGGSDTTAVALAAALNADACEIYTDVDGVYTADPRIVPDARRIDRISYEEMLEMAACGAKVLMLRCVEYARRYSVPVHVRSSFSSKPGTWVTETQEAQLVEQAIIRGVAHDLSEAKVTVVGCPDKPGVAAAVFRAVADADVNLDMIVQVGSVAGSGRTDISFTLPKTDGKTALEALEKVHSQIGFDRTLYDDHIGKLSLIGAGMKSHPGVSARFFGSLADAGVNVEIISTSEIRISVVVRDTDLPVAVRAVHSAFELGDPDESAVVYAGTGR

Samples

Sample ID Description Type Environment
1 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
102 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
103 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
126 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
127 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
130 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
131 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
132 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
133 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
134 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
135 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
244 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
245 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
246 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
247 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
248 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
249 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
250 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
251 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
252 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
253 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
256 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
257 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
258 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
264 2671180195 Frankia sp. CcI49 Isolate Nodule
265 2506783011 Frankia datiscae Dg1 Isolate Nodule
266 2508501039 Frankia saprophytica CN3 Isolate Nodule
267 2517572101 Frankia sp. DC12 Isolate Nodule
268 2527291627 Frankia casuarinae Thr Isolate Nodule
269 2527291629 Frankia sp. BMG5.23 Isolate Nodule
270 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
271 2576861822 Frankia sp. CeD Isolate Nodule
272 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
273 2619618881 Frankia sp. ACN1ag Isolate Unclassified
274 2619619003 Frankia sp. CpI1-P Isolate Nodule
275 2626541554 Frankia sp. AvcI.1 Isolate Nodule
276 2643221549 Agromyces sp. Root1464 Isolate Unclassified
277 2643221679 Angustibacter sp. Root456 Isolate Unclassified
278 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
279 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
280 2684623036 Frankia sp. CgIM4 Isolate Nodule
281 2687453737 Frankia sp. BMG5.36 Isolate Nodule
282 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
283 2710264753 Frankia sp. KB5 Isolate Nodule
284 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
285 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
286 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
287 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
288 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
289 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
290 2773857922 Frankia sp. CcI49 Isolate Nodule
291 2773857924 Frankia sp. CgIS1 Isolate Nodule
292 2773857933 Frankia sp. BMG5.30 Isolate Nodule
293 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
294 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
295 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
296 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
297 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
298 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
299 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
300 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
301 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
302 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
303 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
304 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
305 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
306 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
307 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
308 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
309 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
310 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
311 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
312 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
313 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
314 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
315 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
316 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
317 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
318 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
319 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
320 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
321 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
322 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
323 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
324 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
325 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
326 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
327 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
328 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
329 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
330 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
331 637000116 Frankia casuarinae CcI3 Isolate Nodule
332 8002775197 Frankia nepalensis CN7 Isolate Nodule
333 8002784119 Frankia sp. AgB1.9 Isolate Nodule
334 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
335 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
336 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
337 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
338 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
339 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
340 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
341 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
342 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
343 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
344 8054920844 Frankia tisae Agncl-8 Isolate Nodule
345 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
346 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.66
Metatranscriptomes 2.03
Isolates 15.31

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 7.93
Nodule 4.98
Rhizoplane 8.49
Rhizosphere 69.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007423J48922_100306 3300003285 Bacteria 8247
2 Ga0070658_10000174 3300005327 Bacteria 56278
3 Ga0070658_10004590 3300005327 Bacteria 11223
4 Ga0070658_10012296 3300005327 Bacteria 6872
5 Ga0070658_10024980 3300005327 Bacteria 4792
6 Ga0070658_10072107 3300005327 Bacteria 2830
7 Ga0070658_10119594 3300005327 Bacteria 2188
8 Ga0070683_100033142 3300005329 Bacteria 4708
9 Ga0070683_100263182 3300005329 Bacteria 1641
10 Ga0070680_100002830 3300005336 Bacteria 12899
11 Ga0070660_100011981 3300005339 Bacteria 6186
12 Ga0070660_100088973 3300005339 Bacteria 2432
13 Ga0070660_100128559 3300005339 Bacteria 2026
14 Ga0070689_100047655 3300005340 Bacteria 3304
15 Ga0070689_100311337 3300005340 Bacteria 1313
16 Ga0070659_100037671 3300005366 Bacteria 3771
17 Ga0070667_100073523 3300005367 Bacteria 2915
18 Ga0070709_10002956 3300005434 Bacteria 9154
19 Ga0070714_100026166 3300005435 Bacteria 4820
20 Ga0070714_100082456 3300005435 Bacteria 2801
21 Ga0070714_100211283 3300005435 Bacteria 1779
22 Ga0070713_100080582 3300005436 Bacteria 2776
23 Ga0070713_100111324 3300005436 Bacteria 2388
24 Ga0070710_10009074 3300005437 Bacteria 4862
25 Ga0070711_100011553 3300005439 Bacteria 5490
26 Ga0070711_100022037 3300005439 Bacteria 4125
27 Ga0070705_100005403 3300005440 Bacteria 6225
28 Ga0070678_100068914 3300005456 Bacteria 2639
29 Ga0070681_10000699 3300005458 Bacteria 27854
30 Ga0070681_10003041 3300005458 Bacteria 15550
31 Ga0070681_10011606 3300005458 Bacteria 8721
32 Ga0070681_10230920 3300005458 Bacteria 1765
33 Ga0070679_100000016 3300005530 Bacteria 139454
34 Ga0070679_100000749 3300005530 Bacteria 28066
35 Ga0070672_100083110 3300005543 Bacteria 2570
36 Ga0070695_100000134 3300005545 Bacteria 34004
37 Ga0070696_100010761 3300005546 Bacteria 6127
38 Ga0068855_100007652 3300005563 Bacteria 13066
39 Ga0068855_100008356 3300005563 Bacteria 12519
40 Ga0068855_100073057 3300005563 Bacteria 3985
41 Ga0068855_100355862 3300005563 Bacteria 1612
42 Ga0068857_100018448 3300005577 Bacteria 6121
43 Ga0068859_100000044 3300005617 Bacteria 144391
44 Ga0068859_100011375 3300005617 Bacteria 8950
45 Ga0068863_100001443 3300005841 Bacteria 23590
46 Ga0068858_100000255 3300005842 Bacteria 57050
47 Ga0068858_100008444 3300005842 Bacteria 9903
48 Ga0068862_100000582 3300005844 Bacteria 38007
49 Ga0068862_100013448 3300005844 Bacteria 6774
50 Ga0068862_100103465 3300005844 Bacteria 2494
51 Ga0081538_10000017 3300005981 Bacteria 145769
52 Ga0081538_10001387 3300005981 Bacteria 24845
53 Ga0081538_10036580 3300005981 Bacteria 3200
54 Ga0081539_10004810 3300005985 Bacteria 14503
55 Ga0081539_10010140 3300005985 Bacteria 7723
56 Ga0070717_10017851 3300006028 Bacteria 5531
57 Ga0075365_10017868 3300006038 Bacteria 4350
58 Ga0075365_10030967 3300006038 Bacteria 3430
59 Ga0075365_10137124 3300006038 Bacteria 1696
60 Ga0075368_10002673 3300006042 Bacteria 5865
61 Ga0075368_10032353 3300006042 Bacteria 2031
62 Ga0075363_100003808 3300006048 Bacteria 6503
63 Ga0075363_100031723 3300006048 Bacteria 2741
64 Ga0075364_10019192 3300006051 Bacteria 4289
65 Ga0070715_10001332 3300006163 Bacteria 7111
66 Ga0070716_100004048 3300006173 Bacteria 6958
67 Ga0070712_100034576 3300006175 Bacteria 3426
68 Ga0070712_100043165 3300006175 Bacteria 3103
69 Ga0075367_10001582 3300006178 Bacteria 9864
70 Ga0075367_10009455 3300006178 Bacteria 5095
71 Ga0075367_10017877 3300006178 Bacteria 3900
72 Ga0075369_10011603 3300006186 Bacteria 3469
73 Ga0075370_10006461 3300006353 Bacteria 5899
74 Ga0075370_10036037 3300006353 Bacteria 2777
75 Ga0075370_10095760 3300006353 Bacteria 1715
76 Ga0075430_100038892 3300006846 Bacteria 4028
77 Ga0075431_100048291 3300006847 Bacteria 4390
78 Ga0075429_100055300 3300006880 Bacteria 3453
79 Ga0097620_100000044 3300006931 Bacteria 144391
80 Ga0097620_100011376 3300006931 Bacteria 8950
81 Ga0105251_10030714 3300009011 Bacteria 2695
82 Ga0105240_10023346 3300009093 Bacteria 8182
83 Ga0105245_10150458 3300009098 Bacteria 2200
84 Ga0105247_10000156 3300009101 Bacteria 67016
85 Ga0105247_10001530 3300009101 Bacteria 16511
86 Ga0114129_10052080 3300009147 Bacteria 5745
87 Ga0105243_10070242 3300009148 Bacteria 2827
88 Ga0105242_10185755 3300009176 Bacteria 1837
89 Ga0105248_10001239 3300009177 Bacteria 28520
90 Ga0105248_10001256 3300009177 Bacteria 28350
91 Ga0105237_10044093 3300009545 Bacteria 4491
92 Ga0105249_10034245 3300009553 Bacteria 4601
93 Ga0105246_10054973 3300011119 Bacteria 2746
94 Ga0157370_10017076 3300013104 Bacteria 7331
95 Ga0157370_10138838 3300013104 Bacteria 2264
96 Ga0157369_10008413 3300013105 Bacteria 11832
97 Ga0157369_10108634 3300013105 Bacteria 2950
98 Ga0157369_10114550 3300013105 Bacteria 2863
99 Ga0157372_10044925 3300013307 Bacteria 4897
100 Ga0157372_10117532 3300013307 Bacteria 3050
101 Ga0157375_10264183 3300013308 Bacteria 1883
102 Ga0197907_10154638 3300020069 Bacteria 2733
103 Ga0206356_10327712 3300020070 Bacteria 2880
104 Ga0206351_10027356 3300020077 Bacteria 1953
105 Ga0206354_10758654 3300020081 Bacteria 6706
106 Ga0206353_10289478 3300020082 Bacteria 4186
107 Ga0206353_10717049 3300020082 Bacteria 3676
108 Ga0206353_11386822 3300020082 Bacteria 5192
109 Ga0154015_1259439 3300020610 Bacteria 3002
110 Ga0224712_10005920 3300022467 Bacteria 3448
111 Ga0224712_10021589 3300022467 Bacteria 2206
112 Ga0207426_1018149 3300025302 Bacteria 2484
113 Ga0207710_10000072 3300025900 Bacteria 150638
114 Ga0207710_10000170 3300025900 Bacteria 67024
115 Ga0207685_10014475 3300025905 Bacteria 2471
116 Ga0207699_10006297 3300025906 Bacteria 5732
117 Ga0207699_10047529 3300025906 Bacteria 2517
118 Ga0207705_10000240 3300025909 Bacteria 54242
119 Ga0207705_10006072 3300025909 Bacteria 8988
120 Ga0207705_10070766 3300025909 Bacteria 2528
121 Ga0207705_10188434 3300025909 Bacteria 1559
122 Ga0207684_10070794 3300025910 Bacteria 2964
123 Ga0207707_10000185 3300025912 Bacteria 65663
124 Ga0207707_10029329 3300025912 Bacteria 4808
125 Ga0207693_10003613 3300025915 Bacteria 13207
126 Ga0207693_10022966 3300025915 Bacteria 4953
127 Ga0207663_10006305 3300025916 Bacteria 6057
128 Ga0207660_10005140 3300025917 Bacteria 8508
129 Ga0207660_10005507 3300025917 Bacteria 8224
130 Ga0207660_10039249 3300025917 Bacteria 3309
131 Ga0207660_10192844 3300025917 Bacteria 1588
132 Ga0207657_10022088 3300025919 Bacteria 5971
133 Ga0207657_10030196 3300025919 Bacteria 4923
134 Ga0207657_10123951 3300025919 Bacteria 2123
135 Ga0207652_10001048 3300025921 Bacteria 25276
136 Ga0207652_10007036 3300025921 Bacteria 9066
137 Ga0207652_10103586 3300025921 Bacteria 2516
138 Ga0207687_10111156 3300025927 Bacteria 2034
139 Ga0207700_10009973 3300025928 Bacteria 5967
140 Ga0207664_10004815 3300025929 Bacteria 9176
141 Ga0207664_10006516 3300025929 Bacteria 8033
142 Ga0207664_10188453 3300025929 Bacteria 1774
143 Ga0207690_10029359 3300025932 Bacteria 3495
144 Ga0207709_10065711 3300025935 Bacteria 2282
145 Ga0207665_10000968 3300025939 Bacteria 19437
146 Ga0207711_10000278 3300025941 Bacteria 55354
147 Ga0207711_10002402 3300025941 Bacteria 16722
148 Ga0207661_10024811 3300025944 Bacteria 4550
149 Ga0207661_10037345 3300025944 Bacteria 3799
150 Ga0207667_10026468 3300025949 Bacteria 6337
151 Ga0207667_10049149 3300025949 Bacteria 4457
152 Ga0207712_10004148 3300025961 Bacteria 9151
153 Ga0207658_10067315 3300025986 Bacteria 2697
154 Ga0207703_10000002 3300026035 Bacteria 600711
155 Ga0207703_10006834 3300026035 Bacteria 9084
156 Ga0207641_10015913 3300026088 Bacteria 6159
157 Ga0207648_10047995 3300026089 Bacteria 3740
158 Ga0207683_10049255 3300026121 Bacteria 3688
159 Ga0207683_10308519 3300026121 Bacteria 1448
160 Ga0209813_10001982 3300027866 Bacteria 4632
161 Ga0268266_10100020 3300028379 Bacteria 2554
162 Ga0268265_10000205 3300028380 Bacteria 68729
163 Ga0268264_10370608 3300028381 Bacteria 1368
164 Ga0265334_10001378 3300028573 Bacteria 11712
165 Ga0307517_10024886 3300028786 Bacteria 7348
166 Ga0307515_10000965 3300028794 Bacteria 65641
167 Ga0307515_10038522 3300028794 Bacteria 7643
168 Ga0307515_10069559 3300028794 Bacteria 4808
169 Ga0265338_10171387 3300028800 Bacteria 1664
170 Ga0307511_10035903 3300030521 Bacteria 4319
171 Ga0307511_10082388 3300030521 Bacteria 2250
172 Ga0307512_10043560 3300030522 Bacteria 3700
173 Ga0316183_1137558 3300030742 Bacteria 1865
174 Ga0265325_10019113 3300031241 Bacteria 3792
175 Ga0265340_10001123 3300031247 Bacteria 15296
176 Ga0265340_10023513 3300031247 Bacteria 3141
177 Ga0307513_10000002 3300031456 Bacteria 842612
178 Ga0307513_10022809 3300031456 Bacteria 7345
179 Ga0265313_10015478 3300031595 Bacteria 4436
180 Ga0307508_10059555 3300031616 Bacteria 3377
181 Ga0265342_10111742 3300031712 Bacteria 1546
182 Ga0307516_10076934 3300031730 Bacteria 3187
183 Ga0307516_10120094 3300031730 Bacteria 2420
184 Ga0307405_10010198 3300031731 Bacteria 4855
185 Ga0307410_10183116 3300031852 Bacteria 1587
186 Ga0307406_10047471 3300031901 Bacteria 2706
187 Ga0307412_10025143 3300031911 Bacteria 3684
188 Ga0307412_10098541 3300031911 Bacteria 2062
189 Ga0307412_10138684 3300031911 Bacteria 1778
190 Ga0307416_100028947 3300032002 Bacteria 4130
191 Ga0307415_100047140 3300032126 Bacteria 2900
192 Ga0307415_100068458 3300032126 Bacteria 2485
193 Ga0307415_100136391 3300032126 Bacteria 1867
194 Ga0373931_0013664 3300035691 Bacteria 3958
195 Ga0373947_0017870 3300035725 Bacteria 4080
196 Ga0395899_0011162 3300037312 Bacteria 6883
197 Ga0395899_0142717 3300037312 Bacteria 1703
198 Ga0395900_0015041 3300037418 Bacteria 7888
199 Ga0395900_0037428 3300037418 Bacteria 5003
200 Ga0395900_0091206 3300037418 Bacteria 3131
201 Ga0395900_0365267 3300037418 Bacteria 1414
202 Ga0395898_0011193 3300037466 Bacteria 9340
203 Ga0395898_0027543 3300037466 Bacteria 5702
204 Ga0395898_0050587 3300037466 Bacteria 4066
205 Ga0395898_0113444 3300037466 Bacteria 2597
206 Ga0395898_0137819 3300037466 Bacteria 2336
207 Ga0395905_0153452 3300037471 Bacteria 2166
208 Ga0395901_0006329 3300038443 Bacteria 11991
209 Ga0395901_0014408 3300038443 Bacteria 8048
210 Ga0395901_0023031 3300038443 Bacteria 6383
211 Ga0395901_0024910 3300038443 Bacteria 6143
212 Ga0395901_0083700 3300038443 Bacteria 3335
213 Ga0395901_0095144 3300038443 Bacteria 3121
214 Ga0395901_0160636 3300038443 Bacteria 2360
215 Ga0436360_0848307 3300039438 Bacteria 6654
216 Ga0439439_0000735 3300041406 Bacteria 5883
217 Ga0439461_0001842 3300041410 Bacteria 3336
218 Ga0451837_0079567 3300041494 Bacteria 2154
219 Ga0451853_0100757 3300041512 Bacteria 5898
220 Ga0439449_0002513 3300042007 Bacteria 7163
221 Ga0439449_0063764 3300042007 Bacteria 1359
222 Ga0439457_004183 3300042014 Bacteria 3807
223 Ga0450920_010690 3300042122 Bacteria 1705
224 Ga0450894_000343 3300042131 Bacteria 8221
225 Ga0450899_000348 3300042135 Bacteria 5113
226 Ga0439446_0001632 3300042156 Bacteria 5181
227 Ga0450908_001928 3300042184 Bacteria 4060
228 Ga0439434_0010336 3300042435 Bacteria 2751
229 Ga0466969_0009667 3300044656 Bacteria 5112
230 Ga0466972_0030107 3300044658 Bacteria 2672
231 Ga0466966_0010587 3300044684 Bacteria 6131
232 Ga0466966_0060870 3300044684 Bacteria 2382
233 Ga0466961_0010946 3300044693 Bacteria 5795
234 Ga0466961_0066782 3300044693 Bacteria 2284
235 Ga0466961_0160387 3300044693 Bacteria 1402
236 Ga0466963_0000081 3300044694 Bacteria 32755
237 Ga0466963_0031402 3300044694 Bacteria 3433
238 Ga0466963_0114406 3300044694 Bacteria 1853
239 Ga0466964_0037806 3300044706 Bacteria 1939
240 Ga0466971_0044829 3300044719 Bacteria 1986
241 Ga0466968_0032535 3300044735 Bacteria 2170
242 Ga0466970_0035649 3300044765 Bacteria 2635
243 Ga0466970_0047232 3300044765 Bacteria 2294
244 Ga0466970_0097883 3300044765 Bacteria 1596
245 Ga0466957_0010698 3300044842 Bacteria 5275
246 Ga0466957_0050970 3300044842 Bacteria 2519
247 Ga0466957_0104247 3300044842 Bacteria 1791
248 Ga0466960_0015007 3300044901 Bacteria 3332
249 Ga0466960_0027833 3300044901 Bacteria 2582
250 Ga0466960_0041408 3300044901 Bacteria 2182
251 Ga0466959_0013654 3300045049 Bacteria 5892
252 Ga0466959_0018421 3300045049 Bacteria 5125
253 Ga0466959_0042821 3300045049 Bacteria 3339
254 Ga0466959_0106466 3300045049 Bacteria 2005
255 Ga0451576_0260405 3300045051 Bacteria 1813
256 Ga0466958_0004438 3300045836 Bacteria 7409
257 Ga0466958_0019262 3300045836 Bacteria 3971
258 Ga0466958_0027753 3300045836 Bacteria 3351
259 Ga0466967_0007539 3300045976 Bacteria 7859
260 Ga0466967_0028901 3300045976 Bacteria 4634
261 Ga0466967_0039345 3300045976 Bacteria 4064
262 Ga0466967_0417145 3300045976 Bacteria 1308
263 Ga0495592_0108372 3300046454 Bacteria 1969
264 Ga0495603_0036241 3300046455 Bacteria 2962
265 Ga0495629_0041283 3300046459 Bacteria 3247
266 Ga0495629_0073339 3300046459 Bacteria 2390
267 Ga0495638_0047747 3300046460 Bacteria 2683
268 Ga0495641_0040716 3300046461 Bacteria 2160
269 Ga0495653_0053957 3300046463 Bacteria 3073
270 Ga0495580_0045845 3300046472 Bacteria 3104
271 Ga0495582_0000017 3300046473 Bacteria 100348
272 Ga0495582_0126930 3300046473 Bacteria 1440
273 Ga0495585_0041174 3300046492 Bacteria 2591
274 Ga0495585_0052679 3300046492 Bacteria 2253
275 Ga0495608_0011282 3300046511 Bacteria 6222
276 Ga0495608_0103590 3300046511 Bacteria 1834
277 Ga0495630_0037793 3300046517 Bacteria 3610
278 Ga0495643_0013758 3300046522 Bacteria 4831
279 Ga0495648_0030362 3300046524 Bacteria 3574
280 Ga0495652_0060443 3300046529 Bacteria 3202
281 Ga0495665_0003912 3300046531 Bacteria 8061
282 Ga0495640_0102780 3300046533 Bacteria 1875
283 Ga0495586_0016132 3300046535 Bacteria 3974
284 Ga0495645_0026719 3300046543 Bacteria 4191
285 Ga0495625_0017175 3300046660 Bacteria 5667
286 Ga0495658_0002599 3300046683 Bacteria 9075
287 Ga0495658_0006079 3300046683 Bacteria 5930
288 Ga0495658_0070718 3300046683 Bacteria 2026
289 Ga0495658_0082859 3300046683 Bacteria 1885
290 Ga0495658_0145870 3300046683 Bacteria 1450
291 Ga0495613_0025541 3300046689 Bacteria 4401
292 Ga0495670_0019119 3300046691 Bacteria 3376
293 Ga0495589_0030983 3300046794 Bacteria 2693
294 Ga0495660_0033359 3300046810 Bacteria 2887
295 Ga0495581_0003120 3300047315 Bacteria 9487
296 Ga0495675_0029951 3300047444 Bacteria 3472
297 Ga0495685_006233 3300047447 Bacteria 3900
298 Ga0495681_0002008 3300047470 Bacteria 14874
299 Ga0495686_0022937 3300047472 Bacteria 4124
300 Ga0495686_0065542 3300047472 Bacteria 2245
301 Ga0495593_0039592 3300047673 Bacteria 2541
302 Ga0496100_0035880 3300048903 Bacteria 3123
303 Ga0496100_0053075 3300048903 Bacteria 2638
304 Ga0496101_0149301 3300048904 Bacteria 1787
305 Ga0496102_0020851 3300048905 Bacteria 5793
306 Ga0496102_0033417 3300048905 Bacteria 4622
307 Ga0496102_0081665 3300048905 Bacteria 2980
308 Ga0496102_0179950 3300048905 Bacteria 1992
309 Ga0496103_0014332 3300048906 Bacteria 4708
310 Ga0496103_0026275 3300048906 Bacteria 3525
311 Ga0496103_0035073 3300048906 Bacteria 3070
312 Ga0496104_0005629 3300048907 Bacteria 10975
313 Ga0496104_0021152 3300048907 Bacteria 5970
314 Ga0496104_0030725 3300048907 Bacteria 4993
315 Ga0496104_0050791 3300048907 Bacteria 3912
316 Ga0496105_0013069 3300048908 Bacteria 6582
317 Ga0496105_0024142 3300048908 Bacteria 4937
318 Ga0496105_0078763 3300048908 Bacteria 2721
319 Ga0496105_0147382 3300048908 Bacteria 1935
320 Ga0496105_0187719 3300048908 Bacteria 1691
321 Ga0496106_0042595 3300048909 Bacteria 3404
322 Ga0496107_0008280 3300048910 Bacteria 7193
323 Ga0496108_0007995 3300048911 Bacteria 8579
324 Ga0496108_0017314 3300048911 Bacteria 5894
325 Ga0496108_0120787 3300048911 Bacteria 2247
326 Ga0496108_0170294 3300048911 Bacteria 1884
327 Ga0496108_0207655 3300048911 Bacteria 1700
328 Ga0496109_0059766 3300048912 Bacteria 3483
329 Ga0496109_0210365 3300048912 Bacteria 1829
330 Ga0496110_0086690 3300048913 Bacteria 2796
331 Ga0496110_0174724 3300048913 Bacteria 1949
332 Ga0496110_0220401 3300048913 Bacteria 1725
333 Ga0496111_0029707 3300048914 Bacteria 3883
334 Ga0496112_0003408 3300048915 Bacteria 13132
335 Ga0496112_0121240 3300048915 Bacteria 2584
336 Ga0496113_0135798 3300048916 Bacteria 1932
337 Ga0496114_0007483 3300048917 Bacteria 8634
338 Ga0496114_0011309 3300048917 Bacteria 7128
339 Ga0496114_0028769 3300048917 Bacteria 4563
340 Ga0496114_0037440 3300048917 Bacteria 4012
341 Ga0496114_0059614 3300048917 Bacteria 3189
342 Ga0496114_0064535 3300048917 Bacteria 3067
343 Ga0496114_0201690 3300048917 Bacteria 1742
344 Ga0496115_0012201 3300048918 Bacteria 6461
345 Ga0496115_0167954 3300048918 Bacteria 1814
346 Ga0496116_0000296 3300048919 Bacteria 84170
347 Ga0496117_0052253 3300048920 Bacteria 2880
348 Ga0496118_0000450 3300048921 Bacteria 68053
349 Ga0496118_0000539 3300048921 Bacteria 62235
350 Ga0496118_0009906 3300048921 Bacteria 9524
351 Ga0496119_0002436 3300048922 Bacteria 20424
352 Ga0496119_0018561 3300048922 Bacteria 5170
353 Ga0496119_0024855 3300048922 Bacteria 4200
354 Ga0496119_0046275 3300048922 Bacteria 2718
355 Ga0496120_0000912 3300048923 Bacteria 41157
356 Ga0496121_0002597 3300048924 Bacteria 27280
357 Ga0496124_0000070 3300048927 Bacteria 220875
358 Ga0496126_0000039 3300048929 Bacteria 347353
359 Ga0501031_0020086 3300049568 Bacteria 4354
360 Ga0501032_0001070 3300049569 Bacteria 21896
361 Ga0501032_0021017 3300049569 Bacteria 4540
362 Ga0501032_0102795 3300049569 Bacteria 1893
363 Ga0501032_0114138 3300049569 Bacteria 1787
364 Ga0501034_0002869 3300049571 Bacteria 20047
365 Ga0501034_0044786 3300049571 Bacteria 4473
366 Ga0501034_0251421 3300049571 Bacteria 1712
367 Ga0501036_0026955 3300049572 Bacteria 4856
368 Ga0501037_0188046 3300049573 Bacteria 1463
369 Ga0501038_0000874 3300049574 Bacteria 26668
370 Ga0501038_0002834 3300049574 Bacteria 16135
371 Ga0501038_0028831 3300049574 Bacteria 4928
372 Ga0501038_0050386 3300049574 Bacteria 3597
373 Ga0501038_0095135 3300049574 Bacteria 2489
374 Ga0501039_0140632 3300049575 Bacteria 1896
375 Ga0501039_0293622 3300049575 Bacteria 1278
376 Ga0501040_0076772 3300049576 Bacteria 2310
377 Ga0501043_0098959 3300049579 Bacteria 2292
378 Ga0501046_0006633 3300049580 Bacteria 10223
379 Ga0501047_0001249 3300049581 Bacteria 25187
380 Ga0501047_0001979 3300049581 Bacteria 19657
381 Ga0501047_0014587 3300049581 Bacteria 7477
382 Ga0501047_0018269 3300049581 Bacteria 6719
383 Ga0501047_0213779 3300049581 Bacteria 1786
384 Ga0501047_0216713 3300049581 Bacteria 1771
385 Ga0501048_0000373 3300049582 Bacteria 31068
386 Ga0501067_0006061 3300049583 Bacteria 6702
387 Ga0501067_0030766 3300049583 Bacteria 2977
388 Ga0501067_0036328 3300049583 Bacteria 2735
389 Ga0501068_0014611 3300049584 Bacteria 4493
390 Ga0501069_0009132 3300049585 Bacteria 5235
391 Ga0501070_0019176 3300049586 Bacteria 5737
392 Ga0501070_0056039 3300049586 Bacteria 3267
393 Ga0501070_0167207 3300049586 Bacteria 1812
394 Ga0501071_0030588 3300049587 Bacteria 3809
395 Ga0501071_0103490 3300049587 Bacteria 2100
396 Ga0501072_0022233 3300049588 Bacteria 4920
397 Ga0501072_0049749 3300049588 Bacteria 3300
398 Ga0501073_0033234 3300049589 Bacteria 3673
399 Ga0501073_0034147 3300049589 Bacteria 3621
400 Ga0501074_0000804 3300049590 Bacteria 19861
401 Ga0501074_0016896 3300049590 Bacteria 5294
402 Ga0501074_0163835 3300049590 Bacteria 1587
403 Ga0501074_0171875 3300049590 Bacteria 1547
404 Ga0501076_0008492 3300049592 Bacteria 7526
405 Ga0501080_0187002 3300049742 Bacteria 1904
406 Ga0501081_0132854 3300049743 Bacteria 1779
407 Ga0501083_0063096 3300049744 Bacteria 2471
408 Ga0501035_0013814 3300049822 Bacteria 7454
409 Ga0501035_0018702 3300049822 Bacteria 6381
410 Ga0501035_0025648 3300049822 Bacteria 5403
411 Ga0501035_0064591 3300049822 Bacteria 3252
412 Ga0501035_0202702 3300049822 Bacteria 1700
413 Ga0501044_0002889 3300049823 Bacteria 19566
414 Ga0501044_0238743 3300049823 Bacteria 1762
415 Ga0501044_0302483 3300049823 Bacteria 1528
416 Ga0501045_0099509 3300049824 Bacteria 2152
417 nmdc:mga03n38_21890_c1 3300050490 Bacteria 2579
418 nmdc:mga03n38_30220_c1 3300050490 Bacteria 2275
419 nmdc:mga03n38_5964_c1 3300050490 Bacteria 4195
420 nmdc:mga03n38_76225_c1 3300050490 Bacteria 1564
421 nmdc:mga00v17_6384_c1 3300050491 Bacteria 6256
422 nmdc:mga0yw44_18423_c1 3300050492 Bacteria 3824
423 nmdc:mga0yw44_37589_c1 3300050492 Bacteria 2859
424 nmdc:mga06z11_3127_c1 3300050494 Bacteria 6386
425 nmdc:mga07m45_21281_c1 3300050496 Bacteria 3530
426 nmdc:mga07m45_56735_c1 3300050496 Bacteria 2214
427 nmdc:mga05p37_48839_c1 3300050507 Bacteria 5204
428 nmdc:mga05p37_6109_c1 3300050507 Bacteria 14184
429 nmdc:mga09592_12239_c1 3300050508 Bacteria 6985
430 nmdc:mga0qj67_64894_c1 3300050509 Bacteria 2906
431 nmdc:mga0a205_372173_c1 3300050515 Bacteria 1294
432 nmdc:mga0a205_7047_c1 3300050515 Bacteria 10152
433 Ga0495619_0057112 3300053085 Bacteria 2589
434 Ga0500578_0016970 3300053086 Bacteria 4677
435 Ga0500654_032057 3300053099 Bacteria 3142
436 Ga0500660_060920 3300053100 Bacteria 1818
437 Ga0500553_011669 3300053101 Bacteria 4434
438 Ga0500652_000974 3300053131 Bacteria 9465
439 Ga0500658_0004189 3300053134 Bacteria 5415
440 Ga0500559_0032515 3300053136 Bacteria 2243
441 Ga0500561_0001295 3300053137 Bacteria 4062
442 Ga0500577_0020615 3300053142 Bacteria 2160
443 Ga0500579_030163 3300053143 Bacteria 3482
444 Ga0500600_0065972 3300053149 Bacteria 2000
445 Ga0500616_0009319 3300053153 Bacteria 5980
446 Ga0500633_0008448 3300053160 Bacteria 2656
447 Ga0500634_0005822 3300053161 Bacteria 5902
448 Ga0500656_000164 3300053732 Bacteria 4237
449 Ga0500587_003946 3300053739 Bacteria 2050
450 Ga0501084_0001237 3300054114 Bacteria 20115
451 Ga0501084_0078479 3300054114 Bacteria 2767
452 Ga0590075_010235 3300059424 Bacteria 2257
453 Ga0501082_0001010 3300060353 Bacteria 24869
454 Ga0501082_0064880 3300060353 Bacteria 3145
455 Ga0466962_0005037 3300061719 Bacteria 6354
456 Ga0466962_0010348 3300061719 Bacteria 4482
457 Ga0466962_0026767 3300061719 Bacteria 2769
458 Ga0530510_0061968 3300061734 Bacteria 2708
459 Ga0530510_0125303 3300061734 Bacteria 1888
460 2671839553 2671180195 Bacteria 9757215
461 2506865131 2506783011 Bacteria 5323186
462 2508671248 2508501039 Bacteria 9978592
463 2517761973 2517572101 Bacteria 6884336
464 2528202877 2527291627 Bacteria 5309833
465 2528213255 2527291629 Bacteria 5267418
466 2546947608 2546825537 Bacteria 5389291
467 2579748404 2576861822 Bacteria 5004595
468 2579857877 2579778521 Bacteria 7624758
469 2619858531 2619618881 Bacteria 7521104
470 2620353766 2619619003 Bacteria 7619552
471 2626634479 2626541554 Bacteria 7741902
472 2643768362 2643221549 Bacteria 4042819
473 2644447031 2643221679 Bacteria 3839507
474 2676202649 2675902999 Bacteria 9438463
475 2686534369 2684623035 Bacteria 8032739
476 2686543751 2684623036 Bacteria 5199090
477 2689962815 2687453737 Bacteria 11203906
478 2689990496 2687453743 Bacteria 8361025
479 2710604307 2710264753 Bacteria 5455564
480 2723641151 2721755702 Bacteria 4373124
481 2731907364 2731639228 Bacteria 4187555
482 2739206193 2738543005 Bacteria 5278128
483 2739362679 2738543034 Bacteria 6084756
484 2753302691 2751185788 Bacteria 4541048
485 2774847225 2773857921 Bacteria 9435764
486 2774857709 2773857922 Bacteria 9757215
487 2774864287 2773857924 Bacteria 5256821
488 2774904620 2773857933 Bacteria 5818019
489 2793984501 2791355406 Bacteria 11364898
490 2799183842 2799112218 Bacteria 4315149
491 2837274393 2837268691 Bacteria 7850704
492 2855390155 2855386786 Bacteria 4752232
493 2857485317 2857481737 Bacteria 4761446
494 2862383411 2862382967 Bacteria 10317375
495 2863412093 2863404153 Bacteria 9672205
496 2895883769 2895880812 Bacteria 11255272
497 2904433507 2904430863 Bacteria 3486923
498 2904503989 2904501621 Bacteria 3401437
499 2904768067 2904765812 Bacteria 5369154
500 2904776046 2904770941 Bacteria 5580202
501 2908676954 2908674828 Bacteria 3382763
502 2908815369 2908811453 Bacteria 5478616
503 2909076869 2909074476 Bacteria 3436050
504 2912761740 2912757875 Bacteria 7940295
505 2919039481 2919039151 Bacteria 3391018
506 2919042877 2919042368 Bacteria 3905917
507 2919423502 2919420072 Bacteria 5390363
508 2919436110 2919432681 Bacteria 5390474
509 2919443687 2919443155 Bacteria 4072969
510 2919448902 2919446982 Bacteria 3994487
511 2928146602 2928142448 Bacteria 5288925
512 2928502096 2928500415 Bacteria 3384541
513 2932400137 2932398195 Bacteria 3847976
514 2935392808 2935390628 Bacteria 7043367
515 2935410557 2935409751 Bacteria 4179611
516 2954006286 2954002825 Bacteria 9173742
517 2956940775 2956939328 Bacteria 3474458
518 2966927274 2966924647 Bacteria 3268643
519 2984554840 2984551494 Bacteria 3877562
520 2990065229 2990059506 Bacteria 9321252
521 2997454439 2997451912 Bacteria 8492419
522 2997600099 2997600082 Bacteria 9896405
523 3001120463 3001119090 Bacteria 3449530
524 3006325548 3006321560 Bacteria 8247479
525 3006425649 3006425503 Bacteria 6491253
526 3006487348 3006486233 Bacteria 8157040
527 637877590 637000116 Bacteria 5433628
528 8002778724 8002775197 Bacteria 10728764
529 8002790922 8002784119 Bacteria 9788632
530 8008566047 8008558824 Bacteria 10610750
531 8033688464 8033684223 Bacteria 6906479
532 8047897764 8047893842 Bacteria 11723082
533 8048137041 8048127548 Bacteria 11053136
534 8048361107 8048356638 Bacteria 11044339
535 8048374750 8048369669 Bacteria 11666822
536 8048383472 8048379754 Bacteria 11877923
537 8053951789 8053945823 Bacteria 8962862
538 8054611497 8054609563 Bacteria 5170090
539 8054915565 8054913762 Bacteria 7713009
540 8054922125 8054920844 Bacteria 7068637
541 8055162199 8055157932 Bacteria 6429399
542 8056060028 8056054917 Bacteria 5736694
543 Ga0007423J48922_100306
544 Ga0070658_10000174
545 Ga0070658_10004590
546 Ga0070658_10012296
547 Ga0070658_10024980
548 Ga0070658_10072107
549 Ga0070658_10119594
550 Ga0070683_100033142
551 Ga0070683_100263182
552 Ga0070680_100002830
553 Ga0070660_100011981
554 Ga0070660_100088973
555 Ga0070660_100128559
556 Ga0070689_100047655
557 Ga0070689_100311337
558 Ga0070659_100037671
559 Ga0070667_100073523
560 Ga0070709_10002956
561 Ga0070714_100026166
562 Ga0070714_100082456
563 Ga0070714_100211283
564 Ga0070713_100080582
565 Ga0070713_100111324
566 Ga0070710_10009074
567 Ga0070711_100011553
568 Ga0070711_100022037
569 Ga0070705_100005403
570 Ga0070678_100068914
571 Ga0070681_10000699
572 Ga0070681_10003041
573 Ga0070681_10011606
574 Ga0070681_10230920
575 Ga0070679_100000016
576 Ga0070679_100000749
577 Ga0070672_100083110
578 Ga0070695_100000134
579 Ga0070696_100010761
580 Ga0068855_100007652
581 Ga0068855_100008356
582 Ga0068855_100073057
583 Ga0068855_100355862
584 Ga0068857_100018448
585 Ga0068859_100000044
586 Ga0068859_100011375
587 Ga0068863_100001443
588 Ga0068858_100000255
589 Ga0068858_100008444
590 Ga0068862_100000582
591 Ga0068862_100013448
592 Ga0068862_100103465
593 Ga0081538_10000017
594 Ga0081538_10001387
595 Ga0081538_10036580
596 Ga0081539_10004810
597 Ga0081539_10010140
598 Ga0070717_10017851
599 Ga0075365_10017868
600 Ga0075365_10030967
601 Ga0075365_10137124
602 Ga0075368_10002673
603 Ga0075368_10032353
604 Ga0075363_100003808
605 Ga0075363_100031723
606 Ga0075364_10019192
607 Ga0070715_10001332
608 Ga0070716_100004048
609 Ga0070712_100034576
610 Ga0070712_100043165
611 Ga0075367_10001582
612 Ga0075367_10009455
613 Ga0075367_10017877
614 Ga0075369_10011603
615 Ga0075370_10006461
616 Ga0075370_10036037
617 Ga0075370_10095760
618 Ga0075430_100038892
619 Ga0075431_100048291
620 Ga0075429_100055300
621 Ga0097620_100000044
622 Ga0097620_100011376
623 Ga0105251_10030714
624 Ga0105240_10023346
625 Ga0105245_10150458
626 Ga0105247_10000156
627 Ga0105247_10001530
628 Ga0114129_10052080
629 Ga0105243_10070242
630 Ga0105242_10185755
631 Ga0105248_10001239
632 Ga0105248_10001256
633 Ga0105237_10044093
634 Ga0105249_10034245
635 Ga0105246_10054973
636 Ga0157370_10017076
637 Ga0157370_10138838
638 Ga0157369_10008413
639 Ga0157369_10108634
640 Ga0157369_10114550
641 Ga0157372_10044925
642 Ga0157372_10117532
643 Ga0157375_10264183
644 Ga0197907_10154638
645 Ga0206356_10327712
646 Ga0206351_10027356
647 Ga0206354_10758654
648 Ga0206353_10289478
649 Ga0206353_10717049
650 Ga0206353_11386822
651 Ga0154015_1259439
652 Ga0224712_10005920
653 Ga0224712_10021589
654 Ga0207426_1018149
655 Ga0207710_10000072
656 Ga0207710_10000170
657 Ga0207685_10014475
658 Ga0207699_10006297
659 Ga0207699_10047529
660 Ga0207705_10000240
661 Ga0207705_10006072
662 Ga0207705_10070766
663 Ga0207705_10188434
664 Ga0207684_10070794
665 Ga0207707_10000185
666 Ga0207707_10029329
667 Ga0207693_10003613
668 Ga0207693_10022966
669 Ga0207663_10006305
670 Ga0207660_10005140
671 Ga0207660_10005507
672 Ga0207660_10039249
673 Ga0207660_10192844
674 Ga0207657_10022088
675 Ga0207657_10030196
676 Ga0207657_10123951
677 Ga0207652_10001048
678 Ga0207652_10007036
679 Ga0207652_10103586
680 Ga0207687_10111156
681 Ga0207700_10009973
682 Ga0207664_10004815
683 Ga0207664_10006516
684 Ga0207664_10188453
685 Ga0207690_10029359
686 Ga0207709_10065711
687 Ga0207665_10000968
688 Ga0207711_10000278
689 Ga0207711_10002402
690 Ga0207661_10024811
691 Ga0207661_10037345
692 Ga0207667_10026468
693 Ga0207667_10049149
694 Ga0207712_10004148
695 Ga0207658_10067315
696 Ga0207703_10000002
697 Ga0207703_10006834
698 Ga0207641_10015913
699 Ga0207648_10047995
700 Ga0207683_10049255
701 Ga0207683_10308519
702 Ga0209813_10001982
703 Ga0268266_10100020
704 Ga0268265_10000205
705 Ga0268264_10370608
706 Ga0265334_10001378
707 Ga0307517_10024886
708 Ga0307515_10000965
709 Ga0307515_10038522
710 Ga0307515_10069559
711 Ga0265338_10171387
712 Ga0307511_10035903
713 Ga0307511_10082388
714 Ga0307512_10043560
715 Ga0316183_1137558
716 Ga0265325_10019113
717 Ga0265340_10001123
718 Ga0265340_10023513
719 Ga0307513_10000002
720 Ga0307513_10022809
721 Ga0265313_10015478
722 Ga0307508_10059555
723 Ga0265342_10111742
724 Ga0307516_10076934
725 Ga0307516_10120094
726 Ga0307405_10010198
727 Ga0307410_10183116
728 Ga0307406_10047471
729 Ga0307412_10025143
730 Ga0307412_10098541
731 Ga0307412_10138684
732 Ga0307416_100028947
733 Ga0307415_100047140
734 Ga0307415_100068458
735 Ga0307415_100136391
736 Ga0373931_0013664
737 Ga0373947_0017870
738 Ga0395899_0011162
739 Ga0395899_0142717
740 Ga0395900_0015041
741 Ga0395900_0037428
742 Ga0395900_0091206
743 Ga0395900_0365267
744 Ga0395898_0011193
745 Ga0395898_0027543
746 Ga0395898_0050587
747 Ga0395898_0113444
748 Ga0395898_0137819
749 Ga0395905_0153452
750 Ga0395901_0006329
751 Ga0395901_0014408
752 Ga0395901_0023031
753 Ga0395901_0024910
754 Ga0395901_0083700
755 Ga0395901_0095144
756 Ga0395901_0160636
757 Ga0436360_0848307
758 Ga0439439_0000735
759 Ga0439461_0001842
760 Ga0451837_0079567
761 Ga0451853_0100757
762 Ga0439449_0002513
763 Ga0439449_0063764
764 Ga0439457_004183
765 Ga0450920_010690
766 Ga0450894_000343
767 Ga0450899_000348
768 Ga0439446_0001632
769 Ga0450908_001928
770 Ga0439434_0010336
771 Ga0466969_0009667
772 Ga0466972_0030107
773 Ga0466966_0010587
774 Ga0466966_0060870
775 Ga0466961_0010946
776 Ga0466961_0066782
777 Ga0466961_0160387
778 Ga0466963_0000081
779 Ga0466963_0031402
780 Ga0466963_0114406
781 Ga0466964_0037806
782 Ga0466971_0044829
783 Ga0466968_0032535
784 Ga0466970_0035649
785 Ga0466970_0047232
786 Ga0466970_0097883
787 Ga0466957_0010698
788 Ga0466957_0050970
789 Ga0466957_0104247
790 Ga0466960_0015007
791 Ga0466960_0027833
792 Ga0466960_0041408
793 Ga0466959_0013654
794 Ga0466959_0018421
795 Ga0466959_0042821
796 Ga0466959_0106466
797 Ga0451576_0260405
798 Ga0466958_0004438
799 Ga0466958_0019262
800 Ga0466958_0027753
801 Ga0466967_0007539
802 Ga0466967_0028901
803 Ga0466967_0039345
804 Ga0466967_0417145
805 Ga0495592_0108372
806 Ga0495603_0036241
807 Ga0495629_0041283
808 Ga0495629_0073339
809 Ga0495638_0047747
810 Ga0495641_0040716
811 Ga0495653_0053957
812 Ga0495580_0045845
813 Ga0495582_0000017
814 Ga0495582_0126930
815 Ga0495585_0041174
816 Ga0495585_0052679
817 Ga0495608_0011282
818 Ga0495608_0103590
819 Ga0495630_0037793
820 Ga0495643_0013758
821 Ga0495648_0030362
822 Ga0495652_0060443
823 Ga0495665_0003912
824 Ga0495640_0102780
825 Ga0495586_0016132
826 Ga0495645_0026719
827 Ga0495625_0017175
828 Ga0495658_0002599
829 Ga0495658_0006079
830 Ga0495658_0070718
831 Ga0495658_0082859
832 Ga0495658_0145870
833 Ga0495613_0025541
834 Ga0495670_0019119
835 Ga0495589_0030983
836 Ga0495660_0033359
837 Ga0495581_0003120
838 Ga0495675_0029951
839 Ga0495685_006233
840 Ga0495681_0002008
841 Ga0495686_0022937
842 Ga0495686_0065542
843 Ga0495593_0039592
844 Ga0496100_0035880
845 Ga0496100_0053075
846 Ga0496101_0149301
847 Ga0496102_0020851
848 Ga0496102_0033417
849 Ga0496102_0081665
850 Ga0496102_0179950
851 Ga0496103_0014332
852 Ga0496103_0026275
853 Ga0496103_0035073
854 Ga0496104_0005629
855 Ga0496104_0021152
856 Ga0496104_0030725
857 Ga0496104_0050791
858 Ga0496105_0013069
859 Ga0496105_0024142
860 Ga0496105_0078763
861 Ga0496105_0147382
862 Ga0496105_0187719
863 Ga0496106_0042595
864 Ga0496107_0008280
865 Ga0496108_0007995
866 Ga0496108_0017314
867 Ga0496108_0120787
868 Ga0496108_0170294
869 Ga0496108_0207655
870 Ga0496109_0059766
871 Ga0496109_0210365
872 Ga0496110_0086690
873 Ga0496110_0174724
874 Ga0496110_0220401
875 Ga0496111_0029707
876 Ga0496112_0003408
877 Ga0496112_0121240
878 Ga0496113_0135798
879 Ga0496114_0007483
880 Ga0496114_0011309
881 Ga0496114_0028769
882 Ga0496114_0037440
883 Ga0496114_0059614
884 Ga0496114_0064535
885 Ga0496114_0201690
886 Ga0496115_0012201
887 Ga0496115_0167954
888 Ga0496116_0000296
889 Ga0496117_0052253
890 Ga0496118_0000450
891 Ga0496118_0000539
892 Ga0496118_0009906
893 Ga0496119_0002436
894 Ga0496119_0018561
895 Ga0496119_0024855
896 Ga0496119_0046275
897 Ga0496120_0000912
898 Ga0496121_0002597
899 Ga0496124_0000070
900 Ga0496126_0000039
901 Ga0501031_0020086
902 Ga0501032_0001070
903 Ga0501032_0021017
904 Ga0501032_0102795
905 Ga0501032_0114138
906 Ga0501034_0002869
907 Ga0501034_0044786
908 Ga0501034_0251421
909 Ga0501036_0026955
910 Ga0501037_0188046
911 Ga0501038_0000874
912 Ga0501038_0002834
913 Ga0501038_0028831
914 Ga0501038_0050386
915 Ga0501038_0095135
916 Ga0501039_0140632
917 Ga0501039_0293622
918 Ga0501040_0076772
919 Ga0501043_0098959
920 Ga0501046_0006633
921 Ga0501047_0001249
922 Ga0501047_0001979
923 Ga0501047_0014587
924 Ga0501047_0018269
925 Ga0501047_0213779
926 Ga0501047_0216713
927 Ga0501048_0000373
928 Ga0501067_0006061
929 Ga0501067_0030766
930 Ga0501067_0036328
931 Ga0501068_0014611
932 Ga0501069_0009132
933 Ga0501070_0019176
934 Ga0501070_0056039
935 Ga0501070_0167207
936 Ga0501071_0030588
937 Ga0501071_0103490
938 Ga0501072_0022233
939 Ga0501072_0049749
940 Ga0501073_0033234
941 Ga0501073_0034147
942 Ga0501074_0000804
943 Ga0501074_0016896
944 Ga0501074_0163835
945 Ga0501074_0171875
946 Ga0501076_0008492
947 Ga0501080_0187002
948 Ga0501081_0132854
949 Ga0501083_0063096
950 Ga0501035_0013814
951 Ga0501035_0018702
952 Ga0501035_0025648
953 Ga0501035_0064591
954 Ga0501035_0202702
955 Ga0501044_0002889
956 Ga0501044_0238743
957 Ga0501044_0302483
958 Ga0501045_0099509
959 nmdc:mga03n38_21890_c1
960 nmdc:mga03n38_30220_c1
961 nmdc:mga03n38_5964_c1
962 nmdc:mga03n38_76225_c1
963 nmdc:mga00v17_6384_c1
964 nmdc:mga0yw44_18423_c1
965 nmdc:mga0yw44_37589_c1
966 nmdc:mga06z11_3127_c1
967 nmdc:mga07m45_21281_c1
968 nmdc:mga07m45_56735_c1
969 nmdc:mga05p37_48839_c1
970 nmdc:mga05p37_6109_c1
971 nmdc:mga09592_12239_c1
972 nmdc:mga0qj67_64894_c1
973 nmdc:mga0a205_372173_c1
974 nmdc:mga0a205_7047_c1
975 Ga0495619_0057112
976 Ga0500578_0016970
977 Ga0500654_032057
978 Ga0500660_060920
979 Ga0500553_011669
980 Ga0500652_000974
981 Ga0500658_0004189
982 Ga0500559_0032515
983 Ga0500561_0001295
984 Ga0500577_0020615
985 Ga0500579_030163
986 Ga0500600_0065972
987 Ga0500616_0009319
988 Ga0500633_0008448
989 Ga0500634_0005822
990 Ga0500656_000164
991 Ga0500587_003946
992 Ga0501084_0001237
993 Ga0501084_0078479
994 Ga0590075_010235
995 Ga0501082_0001010
996 Ga0501082_0064880
997 Ga0466962_0005037
998 Ga0466962_0010348
999 Ga0466962_0026767
1000 Ga0530510_0061968
1001 Ga0530510_0125303
1002 2671839553
1003 2506865131
1004 2508671248
1005 2517761973
1006 2528202877
1007 2528213255
1008 2546947608
1009 2579748404
1010 2579857877
1011 2619858531
1012 2620353766
1013 2626634479
1014 2643768362
1015 2644447031
1016 2676202649
1017 2686534369
1018 2686543751
1019 2689962815
1020 2689990496
1021 2710604307
1022 2723641151
1023 2731907364
1024 2739206193
1025 2739362679
1026 2753302691
1027 2774847225
1028 2774857709
1029 2774864287
1030 2774904620
1031 2793984501
1032 2799183842
1033 2837274393
1034 2855390155
1035 2857485317
1036 2862383411
1037 2863412093
1038 2895883769
1039 2904433507
1040 2904503989
1041 2904768067
1042 2904776046
1043 2908676954
1044 2908815369
1045 2909076869
1046 2912761740
1047 2919039481
1048 2919042877
1049 2919423502
1050 2919436110
1051 2919443687
1052 2919448902
1053 2928146602
1054 2928502096
1055 2932400137
1056 2935392808
1057 2935410557
1058 2954006286
1059 2956940775
1060 2966927274
1061 2984554840
1062 2990065229
1063 2997454439
1064 2997600099
1065 3001120463
1066 3006325548
1067 3006425649
1068 3006487348
1069 637877590
1070 8002778724
1071 8002790922
1072 8008566047
1073 8033688464
1074 8047897764
1075 8048137041
1076 8048361107
1077 8048374750
1078 8048383472
1079 8053951789
1080 8054611497
1081 8054915565
1082 8054922125
1083 8055162199
1084 8056060028

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22468

ACT_9

ACT domain

410

468

0.99

PF00696

AA_kinase

Amino acid kinase family

65

294

0.97

PF13840

ACT_7

ACT domain

402

466

0.97

PF22468

ACT_9

ACT domain

330

392

0.96

PF01842

ACT

ACT domain

329

396

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s1t-assembly1.cif.gz_B structure of the regulatory domain of aspartokinase (rv3709c; ak-beta) in complex with threonine from mycobacterium tuberculosis 0.9824 238 391
3ab2-assembly2.cif.gz_F crystal structure of aspartate kinase from corynebacterium glutamicum in complex with threonine 0.964 238 392
2re1-assembly1.cif.gz_A crystal structure of aspartokinase alpha and beta subunits 0.9639 240 391
3s1t-assembly1.cif.gz_B structure of the regulatory domain of aspartokinase (rv3709c; ak-beta) in complex with threonine from mycobacterium tuberculosis 0.9639 238 391
3ab2-assembly3.cif.gz_L crystal structure of aspartate kinase from corynebacterium glutamicum in complex with threonine 0.9627 240 392
ID Description Score Start End Superfamily
4go5X02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9665 249 327 3.30.70.260
af_A0A1D6LW70_109_162_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9617 347 373 3.30.70.260
3ab2N01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9533 327 392 3.30.70.260
5yeiG02 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.9526 239 395 3.30.2130.10
5yeiG02 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.9467 239 395 3.30.2130.10
ID Description Score Start End GO Terms
AF-A0A6B3FFF4-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9948 80 166 GO:0004072
GO:0005829
GO:0009089
GO:0009090
AF-A0A3C1KC44-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9853 45 159 GO:0004072
GO:0005829
GO:0009089
GO:0009090
AF-A0A7X6H8S5-F1-model_v4 deleted 0.9843 311 391
AF-A0A3C1KC44-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9769 45 159 GO:0004072
GO:0005829
GO:0009089
GO:0009090
AF-A0A6B3FFF4-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9725 80 166 GO:0004072
GO:0005829
GO:0009089
GO:0009090

Map