F461561
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 542 | 346 | 1084 | 421 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2671180195|2671839553 |
| Length | 485 |
| Sequence | ATILRSEDHRSNMVASVATLAQEYEHSRQAVGRMTLMPPGRPSRPRHGARPGGSAPDLGNLARMALLVAKFGGSSVADADXIKRVAERIVETRRAGNDVVVVVSAMGDTTDDLLDLAEQVSPVPPARELDMLLTAGERISMALLAMAITKLGAEARSFTGSQAGVITDSVHGKARIIDVTPGRIRTALDEGAIAIVAGFQGVSQDTKDITTLGRGGSDTTAVALAAALNADACEIYTDVDGVYTADPRIVPDARRIDRISYEEMLEMAACGAKVLMLRCVEYARRYSVPVHVRSSFSSKPGTWVTETQEAQLVEQAIIRGVAHDLSEAKVTVVGCPDKPGVAAAVFRAVADADVNLDMIVQVGSVAGSGRTDISFTLPKTDGKTALEALEKVHSQIGFDRTLYDDHIGKLSLIGAGMKSHPGVSARFFGSLADAGVNVEIISTSEIRISVVVRDTDLPVAVRAVHSAFELGDPDESAVVYAGTGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 27 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 29 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 31 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 32 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 38 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 65 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 98 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 99 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 100 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 102 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 103 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 104 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 105 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 106 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 107 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 108 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 109 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 110 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 113 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 114 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 115 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 116 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 117 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 118 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 119 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 120 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 121 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 124 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 125 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 126 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 127 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 128 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 129 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 130 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 131 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 132 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 133 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 134 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 135 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 136 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 137 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 138 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 139 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 140 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 141 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 142 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 143 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 144 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 145 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 146 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 147 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 148 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 149 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 150 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 151 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 152 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 185 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 186 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 187 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 188 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 189 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 190 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 193 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 194 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 195 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 196 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 197 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 198 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 199 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 200 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 201 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 202 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 203 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 204 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 205 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 206 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 234 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 235 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 236 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 237 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 238 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 244 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 245 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 246 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 247 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 248 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 249 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 250 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 251 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 252 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 253 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 254 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 255 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 256 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 257 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 258 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 259 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 261 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 263 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 264 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 265 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 266 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 267 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 268 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 269 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 270 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 271 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 272 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 273 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 274 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 275 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 276 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 277 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 278 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 279 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 280 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 281 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 282 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 283 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 284 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 285 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 286 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 287 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 288 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 289 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 290 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 291 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 292 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 293 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 294 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 295 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 296 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 297 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 298 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 299 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 300 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 301 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 302 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 303 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 304 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 305 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 306 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 307 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 308 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 309 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 310 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 311 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 312 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 313 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 314 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 315 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 316 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 317 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 318 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 319 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 320 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 321 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 322 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 323 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 324 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 325 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 326 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 327 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 328 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 329 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 330 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 331 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 332 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 333 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 334 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 335 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 336 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 337 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 338 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 339 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 340 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 341 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 342 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 343 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 344 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 345 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 346 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.66 |
| Metatranscriptomes | 2.03 |
| Isolates | 15.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.18 |
| Bulb | 0 |
| Endosphere | 7.93 |
| Nodule | 4.98 |
| Rhizoplane | 8.49 |
| Rhizosphere | 69.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0007423J48922_100306 | 3300003285 | Bacteria | 8247 |
| 2 | Ga0070658_10000174 | 3300005327 | Bacteria | 56278 |
| 3 | Ga0070658_10004590 | 3300005327 | Bacteria | 11223 |
| 4 | Ga0070658_10012296 | 3300005327 | Bacteria | 6872 |
| 5 | Ga0070658_10024980 | 3300005327 | Bacteria | 4792 |
| 6 | Ga0070658_10072107 | 3300005327 | Bacteria | 2830 |
| 7 | Ga0070658_10119594 | 3300005327 | Bacteria | 2188 |
| 8 | Ga0070683_100033142 | 3300005329 | Bacteria | 4708 |
| 9 | Ga0070683_100263182 | 3300005329 | Bacteria | 1641 |
| 10 | Ga0070680_100002830 | 3300005336 | Bacteria | 12899 |
| 11 | Ga0070660_100011981 | 3300005339 | Bacteria | 6186 |
| 12 | Ga0070660_100088973 | 3300005339 | Bacteria | 2432 |
| 13 | Ga0070660_100128559 | 3300005339 | Bacteria | 2026 |
| 14 | Ga0070689_100047655 | 3300005340 | Bacteria | 3304 |
| 15 | Ga0070689_100311337 | 3300005340 | Bacteria | 1313 |
| 16 | Ga0070659_100037671 | 3300005366 | Bacteria | 3771 |
| 17 | Ga0070667_100073523 | 3300005367 | Bacteria | 2915 |
| 18 | Ga0070709_10002956 | 3300005434 | Bacteria | 9154 |
| 19 | Ga0070714_100026166 | 3300005435 | Bacteria | 4820 |
| 20 | Ga0070714_100082456 | 3300005435 | Bacteria | 2801 |
| 21 | Ga0070714_100211283 | 3300005435 | Bacteria | 1779 |
| 22 | Ga0070713_100080582 | 3300005436 | Bacteria | 2776 |
| 23 | Ga0070713_100111324 | 3300005436 | Bacteria | 2388 |
| 24 | Ga0070710_10009074 | 3300005437 | Bacteria | 4862 |
| 25 | Ga0070711_100011553 | 3300005439 | Bacteria | 5490 |
| 26 | Ga0070711_100022037 | 3300005439 | Bacteria | 4125 |
| 27 | Ga0070705_100005403 | 3300005440 | Bacteria | 6225 |
| 28 | Ga0070678_100068914 | 3300005456 | Bacteria | 2639 |
| 29 | Ga0070681_10000699 | 3300005458 | Bacteria | 27854 |
| 30 | Ga0070681_10003041 | 3300005458 | Bacteria | 15550 |
| 31 | Ga0070681_10011606 | 3300005458 | Bacteria | 8721 |
| 32 | Ga0070681_10230920 | 3300005458 | Bacteria | 1765 |
| 33 | Ga0070679_100000016 | 3300005530 | Bacteria | 139454 |
| 34 | Ga0070679_100000749 | 3300005530 | Bacteria | 28066 |
| 35 | Ga0070672_100083110 | 3300005543 | Bacteria | 2570 |
| 36 | Ga0070695_100000134 | 3300005545 | Bacteria | 34004 |
| 37 | Ga0070696_100010761 | 3300005546 | Bacteria | 6127 |
| 38 | Ga0068855_100007652 | 3300005563 | Bacteria | 13066 |
| 39 | Ga0068855_100008356 | 3300005563 | Bacteria | 12519 |
| 40 | Ga0068855_100073057 | 3300005563 | Bacteria | 3985 |
| 41 | Ga0068855_100355862 | 3300005563 | Bacteria | 1612 |
| 42 | Ga0068857_100018448 | 3300005577 | Bacteria | 6121 |
| 43 | Ga0068859_100000044 | 3300005617 | Bacteria | 144391 |
| 44 | Ga0068859_100011375 | 3300005617 | Bacteria | 8950 |
| 45 | Ga0068863_100001443 | 3300005841 | Bacteria | 23590 |
| 46 | Ga0068858_100000255 | 3300005842 | Bacteria | 57050 |
| 47 | Ga0068858_100008444 | 3300005842 | Bacteria | 9903 |
| 48 | Ga0068862_100000582 | 3300005844 | Bacteria | 38007 |
| 49 | Ga0068862_100013448 | 3300005844 | Bacteria | 6774 |
| 50 | Ga0068862_100103465 | 3300005844 | Bacteria | 2494 |
| 51 | Ga0081538_10000017 | 3300005981 | Bacteria | 145769 |
| 52 | Ga0081538_10001387 | 3300005981 | Bacteria | 24845 |
| 53 | Ga0081538_10036580 | 3300005981 | Bacteria | 3200 |
| 54 | Ga0081539_10004810 | 3300005985 | Bacteria | 14503 |
| 55 | Ga0081539_10010140 | 3300005985 | Bacteria | 7723 |
| 56 | Ga0070717_10017851 | 3300006028 | Bacteria | 5531 |
| 57 | Ga0075365_10017868 | 3300006038 | Bacteria | 4350 |
| 58 | Ga0075365_10030967 | 3300006038 | Bacteria | 3430 |
| 59 | Ga0075365_10137124 | 3300006038 | Bacteria | 1696 |
| 60 | Ga0075368_10002673 | 3300006042 | Bacteria | 5865 |
| 61 | Ga0075368_10032353 | 3300006042 | Bacteria | 2031 |
| 62 | Ga0075363_100003808 | 3300006048 | Bacteria | 6503 |
| 63 | Ga0075363_100031723 | 3300006048 | Bacteria | 2741 |
| 64 | Ga0075364_10019192 | 3300006051 | Bacteria | 4289 |
| 65 | Ga0070715_10001332 | 3300006163 | Bacteria | 7111 |
| 66 | Ga0070716_100004048 | 3300006173 | Bacteria | 6958 |
| 67 | Ga0070712_100034576 | 3300006175 | Bacteria | 3426 |
| 68 | Ga0070712_100043165 | 3300006175 | Bacteria | 3103 |
| 69 | Ga0075367_10001582 | 3300006178 | Bacteria | 9864 |
| 70 | Ga0075367_10009455 | 3300006178 | Bacteria | 5095 |
| 71 | Ga0075367_10017877 | 3300006178 | Bacteria | 3900 |
| 72 | Ga0075369_10011603 | 3300006186 | Bacteria | 3469 |
| 73 | Ga0075370_10006461 | 3300006353 | Bacteria | 5899 |
| 74 | Ga0075370_10036037 | 3300006353 | Bacteria | 2777 |
| 75 | Ga0075370_10095760 | 3300006353 | Bacteria | 1715 |
| 76 | Ga0075430_100038892 | 3300006846 | Bacteria | 4028 |
| 77 | Ga0075431_100048291 | 3300006847 | Bacteria | 4390 |
| 78 | Ga0075429_100055300 | 3300006880 | Bacteria | 3453 |
| 79 | Ga0097620_100000044 | 3300006931 | Bacteria | 144391 |
| 80 | Ga0097620_100011376 | 3300006931 | Bacteria | 8950 |
| 81 | Ga0105251_10030714 | 3300009011 | Bacteria | 2695 |
| 82 | Ga0105240_10023346 | 3300009093 | Bacteria | 8182 |
| 83 | Ga0105245_10150458 | 3300009098 | Bacteria | 2200 |
| 84 | Ga0105247_10000156 | 3300009101 | Bacteria | 67016 |
| 85 | Ga0105247_10001530 | 3300009101 | Bacteria | 16511 |
| 86 | Ga0114129_10052080 | 3300009147 | Bacteria | 5745 |
| 87 | Ga0105243_10070242 | 3300009148 | Bacteria | 2827 |
| 88 | Ga0105242_10185755 | 3300009176 | Bacteria | 1837 |
| 89 | Ga0105248_10001239 | 3300009177 | Bacteria | 28520 |
| 90 | Ga0105248_10001256 | 3300009177 | Bacteria | 28350 |
| 91 | Ga0105237_10044093 | 3300009545 | Bacteria | 4491 |
| 92 | Ga0105249_10034245 | 3300009553 | Bacteria | 4601 |
| 93 | Ga0105246_10054973 | 3300011119 | Bacteria | 2746 |
| 94 | Ga0157370_10017076 | 3300013104 | Bacteria | 7331 |
| 95 | Ga0157370_10138838 | 3300013104 | Bacteria | 2264 |
| 96 | Ga0157369_10008413 | 3300013105 | Bacteria | 11832 |
| 97 | Ga0157369_10108634 | 3300013105 | Bacteria | 2950 |
| 98 | Ga0157369_10114550 | 3300013105 | Bacteria | 2863 |
| 99 | Ga0157372_10044925 | 3300013307 | Bacteria | 4897 |
| 100 | Ga0157372_10117532 | 3300013307 | Bacteria | 3050 |
| 101 | Ga0157375_10264183 | 3300013308 | Bacteria | 1883 |
| 102 | Ga0197907_10154638 | 3300020069 | Bacteria | 2733 |
| 103 | Ga0206356_10327712 | 3300020070 | Bacteria | 2880 |
| 104 | Ga0206351_10027356 | 3300020077 | Bacteria | 1953 |
| 105 | Ga0206354_10758654 | 3300020081 | Bacteria | 6706 |
| 106 | Ga0206353_10289478 | 3300020082 | Bacteria | 4186 |
| 107 | Ga0206353_10717049 | 3300020082 | Bacteria | 3676 |
| 108 | Ga0206353_11386822 | 3300020082 | Bacteria | 5192 |
| 109 | Ga0154015_1259439 | 3300020610 | Bacteria | 3002 |
| 110 | Ga0224712_10005920 | 3300022467 | Bacteria | 3448 |
| 111 | Ga0224712_10021589 | 3300022467 | Bacteria | 2206 |
| 112 | Ga0207426_1018149 | 3300025302 | Bacteria | 2484 |
| 113 | Ga0207710_10000072 | 3300025900 | Bacteria | 150638 |
| 114 | Ga0207710_10000170 | 3300025900 | Bacteria | 67024 |
| 115 | Ga0207685_10014475 | 3300025905 | Bacteria | 2471 |
| 116 | Ga0207699_10006297 | 3300025906 | Bacteria | 5732 |
| 117 | Ga0207699_10047529 | 3300025906 | Bacteria | 2517 |
| 118 | Ga0207705_10000240 | 3300025909 | Bacteria | 54242 |
| 119 | Ga0207705_10006072 | 3300025909 | Bacteria | 8988 |
| 120 | Ga0207705_10070766 | 3300025909 | Bacteria | 2528 |
| 121 | Ga0207705_10188434 | 3300025909 | Bacteria | 1559 |
| 122 | Ga0207684_10070794 | 3300025910 | Bacteria | 2964 |
| 123 | Ga0207707_10000185 | 3300025912 | Bacteria | 65663 |
| 124 | Ga0207707_10029329 | 3300025912 | Bacteria | 4808 |
| 125 | Ga0207693_10003613 | 3300025915 | Bacteria | 13207 |
| 126 | Ga0207693_10022966 | 3300025915 | Bacteria | 4953 |
| 127 | Ga0207663_10006305 | 3300025916 | Bacteria | 6057 |
| 128 | Ga0207660_10005140 | 3300025917 | Bacteria | 8508 |
| 129 | Ga0207660_10005507 | 3300025917 | Bacteria | 8224 |
| 130 | Ga0207660_10039249 | 3300025917 | Bacteria | 3309 |
| 131 | Ga0207660_10192844 | 3300025917 | Bacteria | 1588 |
| 132 | Ga0207657_10022088 | 3300025919 | Bacteria | 5971 |
| 133 | Ga0207657_10030196 | 3300025919 | Bacteria | 4923 |
| 134 | Ga0207657_10123951 | 3300025919 | Bacteria | 2123 |
| 135 | Ga0207652_10001048 | 3300025921 | Bacteria | 25276 |
| 136 | Ga0207652_10007036 | 3300025921 | Bacteria | 9066 |
| 137 | Ga0207652_10103586 | 3300025921 | Bacteria | 2516 |
| 138 | Ga0207687_10111156 | 3300025927 | Bacteria | 2034 |
| 139 | Ga0207700_10009973 | 3300025928 | Bacteria | 5967 |
| 140 | Ga0207664_10004815 | 3300025929 | Bacteria | 9176 |
| 141 | Ga0207664_10006516 | 3300025929 | Bacteria | 8033 |
| 142 | Ga0207664_10188453 | 3300025929 | Bacteria | 1774 |
| 143 | Ga0207690_10029359 | 3300025932 | Bacteria | 3495 |
| 144 | Ga0207709_10065711 | 3300025935 | Bacteria | 2282 |
| 145 | Ga0207665_10000968 | 3300025939 | Bacteria | 19437 |
| 146 | Ga0207711_10000278 | 3300025941 | Bacteria | 55354 |
| 147 | Ga0207711_10002402 | 3300025941 | Bacteria | 16722 |
| 148 | Ga0207661_10024811 | 3300025944 | Bacteria | 4550 |
| 149 | Ga0207661_10037345 | 3300025944 | Bacteria | 3799 |
| 150 | Ga0207667_10026468 | 3300025949 | Bacteria | 6337 |
| 151 | Ga0207667_10049149 | 3300025949 | Bacteria | 4457 |
| 152 | Ga0207712_10004148 | 3300025961 | Bacteria | 9151 |
| 153 | Ga0207658_10067315 | 3300025986 | Bacteria | 2697 |
| 154 | Ga0207703_10000002 | 3300026035 | Bacteria | 600711 |
| 155 | Ga0207703_10006834 | 3300026035 | Bacteria | 9084 |
| 156 | Ga0207641_10015913 | 3300026088 | Bacteria | 6159 |
| 157 | Ga0207648_10047995 | 3300026089 | Bacteria | 3740 |
| 158 | Ga0207683_10049255 | 3300026121 | Bacteria | 3688 |
| 159 | Ga0207683_10308519 | 3300026121 | Bacteria | 1448 |
| 160 | Ga0209813_10001982 | 3300027866 | Bacteria | 4632 |
| 161 | Ga0268266_10100020 | 3300028379 | Bacteria | 2554 |
| 162 | Ga0268265_10000205 | 3300028380 | Bacteria | 68729 |
| 163 | Ga0268264_10370608 | 3300028381 | Bacteria | 1368 |
| 164 | Ga0265334_10001378 | 3300028573 | Bacteria | 11712 |
| 165 | Ga0307517_10024886 | 3300028786 | Bacteria | 7348 |
| 166 | Ga0307515_10000965 | 3300028794 | Bacteria | 65641 |
| 167 | Ga0307515_10038522 | 3300028794 | Bacteria | 7643 |
| 168 | Ga0307515_10069559 | 3300028794 | Bacteria | 4808 |
| 169 | Ga0265338_10171387 | 3300028800 | Bacteria | 1664 |
| 170 | Ga0307511_10035903 | 3300030521 | Bacteria | 4319 |
| 171 | Ga0307511_10082388 | 3300030521 | Bacteria | 2250 |
| 172 | Ga0307512_10043560 | 3300030522 | Bacteria | 3700 |
| 173 | Ga0316183_1137558 | 3300030742 | Bacteria | 1865 |
| 174 | Ga0265325_10019113 | 3300031241 | Bacteria | 3792 |
| 175 | Ga0265340_10001123 | 3300031247 | Bacteria | 15296 |
| 176 | Ga0265340_10023513 | 3300031247 | Bacteria | 3141 |
| 177 | Ga0307513_10000002 | 3300031456 | Bacteria | 842612 |
| 178 | Ga0307513_10022809 | 3300031456 | Bacteria | 7345 |
| 179 | Ga0265313_10015478 | 3300031595 | Bacteria | 4436 |
| 180 | Ga0307508_10059555 | 3300031616 | Bacteria | 3377 |
| 181 | Ga0265342_10111742 | 3300031712 | Bacteria | 1546 |
| 182 | Ga0307516_10076934 | 3300031730 | Bacteria | 3187 |
| 183 | Ga0307516_10120094 | 3300031730 | Bacteria | 2420 |
| 184 | Ga0307405_10010198 | 3300031731 | Bacteria | 4855 |
| 185 | Ga0307410_10183116 | 3300031852 | Bacteria | 1587 |
| 186 | Ga0307406_10047471 | 3300031901 | Bacteria | 2706 |
| 187 | Ga0307412_10025143 | 3300031911 | Bacteria | 3684 |
| 188 | Ga0307412_10098541 | 3300031911 | Bacteria | 2062 |
| 189 | Ga0307412_10138684 | 3300031911 | Bacteria | 1778 |
| 190 | Ga0307416_100028947 | 3300032002 | Bacteria | 4130 |
| 191 | Ga0307415_100047140 | 3300032126 | Bacteria | 2900 |
| 192 | Ga0307415_100068458 | 3300032126 | Bacteria | 2485 |
| 193 | Ga0307415_100136391 | 3300032126 | Bacteria | 1867 |
| 194 | Ga0373931_0013664 | 3300035691 | Bacteria | 3958 |
| 195 | Ga0373947_0017870 | 3300035725 | Bacteria | 4080 |
| 196 | Ga0395899_0011162 | 3300037312 | Bacteria | 6883 |
| 197 | Ga0395899_0142717 | 3300037312 | Bacteria | 1703 |
| 198 | Ga0395900_0015041 | 3300037418 | Bacteria | 7888 |
| 199 | Ga0395900_0037428 | 3300037418 | Bacteria | 5003 |
| 200 | Ga0395900_0091206 | 3300037418 | Bacteria | 3131 |
| 201 | Ga0395900_0365267 | 3300037418 | Bacteria | 1414 |
| 202 | Ga0395898_0011193 | 3300037466 | Bacteria | 9340 |
| 203 | Ga0395898_0027543 | 3300037466 | Bacteria | 5702 |
| 204 | Ga0395898_0050587 | 3300037466 | Bacteria | 4066 |
| 205 | Ga0395898_0113444 | 3300037466 | Bacteria | 2597 |
| 206 | Ga0395898_0137819 | 3300037466 | Bacteria | 2336 |
| 207 | Ga0395905_0153452 | 3300037471 | Bacteria | 2166 |
| 208 | Ga0395901_0006329 | 3300038443 | Bacteria | 11991 |
| 209 | Ga0395901_0014408 | 3300038443 | Bacteria | 8048 |
| 210 | Ga0395901_0023031 | 3300038443 | Bacteria | 6383 |
| 211 | Ga0395901_0024910 | 3300038443 | Bacteria | 6143 |
| 212 | Ga0395901_0083700 | 3300038443 | Bacteria | 3335 |
| 213 | Ga0395901_0095144 | 3300038443 | Bacteria | 3121 |
| 214 | Ga0395901_0160636 | 3300038443 | Bacteria | 2360 |
| 215 | Ga0436360_0848307 | 3300039438 | Bacteria | 6654 |
| 216 | Ga0439439_0000735 | 3300041406 | Bacteria | 5883 |
| 217 | Ga0439461_0001842 | 3300041410 | Bacteria | 3336 |
| 218 | Ga0451837_0079567 | 3300041494 | Bacteria | 2154 |
| 219 | Ga0451853_0100757 | 3300041512 | Bacteria | 5898 |
| 220 | Ga0439449_0002513 | 3300042007 | Bacteria | 7163 |
| 221 | Ga0439449_0063764 | 3300042007 | Bacteria | 1359 |
| 222 | Ga0439457_004183 | 3300042014 | Bacteria | 3807 |
| 223 | Ga0450920_010690 | 3300042122 | Bacteria | 1705 |
| 224 | Ga0450894_000343 | 3300042131 | Bacteria | 8221 |
| 225 | Ga0450899_000348 | 3300042135 | Bacteria | 5113 |
| 226 | Ga0439446_0001632 | 3300042156 | Bacteria | 5181 |
| 227 | Ga0450908_001928 | 3300042184 | Bacteria | 4060 |
| 228 | Ga0439434_0010336 | 3300042435 | Bacteria | 2751 |
| 229 | Ga0466969_0009667 | 3300044656 | Bacteria | 5112 |
| 230 | Ga0466972_0030107 | 3300044658 | Bacteria | 2672 |
| 231 | Ga0466966_0010587 | 3300044684 | Bacteria | 6131 |
| 232 | Ga0466966_0060870 | 3300044684 | Bacteria | 2382 |
| 233 | Ga0466961_0010946 | 3300044693 | Bacteria | 5795 |
| 234 | Ga0466961_0066782 | 3300044693 | Bacteria | 2284 |
| 235 | Ga0466961_0160387 | 3300044693 | Bacteria | 1402 |
| 236 | Ga0466963_0000081 | 3300044694 | Bacteria | 32755 |
| 237 | Ga0466963_0031402 | 3300044694 | Bacteria | 3433 |
| 238 | Ga0466963_0114406 | 3300044694 | Bacteria | 1853 |
| 239 | Ga0466964_0037806 | 3300044706 | Bacteria | 1939 |
| 240 | Ga0466971_0044829 | 3300044719 | Bacteria | 1986 |
| 241 | Ga0466968_0032535 | 3300044735 | Bacteria | 2170 |
| 242 | Ga0466970_0035649 | 3300044765 | Bacteria | 2635 |
| 243 | Ga0466970_0047232 | 3300044765 | Bacteria | 2294 |
| 244 | Ga0466970_0097883 | 3300044765 | Bacteria | 1596 |
| 245 | Ga0466957_0010698 | 3300044842 | Bacteria | 5275 |
| 246 | Ga0466957_0050970 | 3300044842 | Bacteria | 2519 |
| 247 | Ga0466957_0104247 | 3300044842 | Bacteria | 1791 |
| 248 | Ga0466960_0015007 | 3300044901 | Bacteria | 3332 |
| 249 | Ga0466960_0027833 | 3300044901 | Bacteria | 2582 |
| 250 | Ga0466960_0041408 | 3300044901 | Bacteria | 2182 |
| 251 | Ga0466959_0013654 | 3300045049 | Bacteria | 5892 |
| 252 | Ga0466959_0018421 | 3300045049 | Bacteria | 5125 |
| 253 | Ga0466959_0042821 | 3300045049 | Bacteria | 3339 |
| 254 | Ga0466959_0106466 | 3300045049 | Bacteria | 2005 |
| 255 | Ga0451576_0260405 | 3300045051 | Bacteria | 1813 |
| 256 | Ga0466958_0004438 | 3300045836 | Bacteria | 7409 |
| 257 | Ga0466958_0019262 | 3300045836 | Bacteria | 3971 |
| 258 | Ga0466958_0027753 | 3300045836 | Bacteria | 3351 |
| 259 | Ga0466967_0007539 | 3300045976 | Bacteria | 7859 |
| 260 | Ga0466967_0028901 | 3300045976 | Bacteria | 4634 |
| 261 | Ga0466967_0039345 | 3300045976 | Bacteria | 4064 |
| 262 | Ga0466967_0417145 | 3300045976 | Bacteria | 1308 |
| 263 | Ga0495592_0108372 | 3300046454 | Bacteria | 1969 |
| 264 | Ga0495603_0036241 | 3300046455 | Bacteria | 2962 |
| 265 | Ga0495629_0041283 | 3300046459 | Bacteria | 3247 |
| 266 | Ga0495629_0073339 | 3300046459 | Bacteria | 2390 |
| 267 | Ga0495638_0047747 | 3300046460 | Bacteria | 2683 |
| 268 | Ga0495641_0040716 | 3300046461 | Bacteria | 2160 |
| 269 | Ga0495653_0053957 | 3300046463 | Bacteria | 3073 |
| 270 | Ga0495580_0045845 | 3300046472 | Bacteria | 3104 |
| 271 | Ga0495582_0000017 | 3300046473 | Bacteria | 100348 |
| 272 | Ga0495582_0126930 | 3300046473 | Bacteria | 1440 |
| 273 | Ga0495585_0041174 | 3300046492 | Bacteria | 2591 |
| 274 | Ga0495585_0052679 | 3300046492 | Bacteria | 2253 |
| 275 | Ga0495608_0011282 | 3300046511 | Bacteria | 6222 |
| 276 | Ga0495608_0103590 | 3300046511 | Bacteria | 1834 |
| 277 | Ga0495630_0037793 | 3300046517 | Bacteria | 3610 |
| 278 | Ga0495643_0013758 | 3300046522 | Bacteria | 4831 |
| 279 | Ga0495648_0030362 | 3300046524 | Bacteria | 3574 |
| 280 | Ga0495652_0060443 | 3300046529 | Bacteria | 3202 |
| 281 | Ga0495665_0003912 | 3300046531 | Bacteria | 8061 |
| 282 | Ga0495640_0102780 | 3300046533 | Bacteria | 1875 |
| 283 | Ga0495586_0016132 | 3300046535 | Bacteria | 3974 |
| 284 | Ga0495645_0026719 | 3300046543 | Bacteria | 4191 |
| 285 | Ga0495625_0017175 | 3300046660 | Bacteria | 5667 |
| 286 | Ga0495658_0002599 | 3300046683 | Bacteria | 9075 |
| 287 | Ga0495658_0006079 | 3300046683 | Bacteria | 5930 |
| 288 | Ga0495658_0070718 | 3300046683 | Bacteria | 2026 |
| 289 | Ga0495658_0082859 | 3300046683 | Bacteria | 1885 |
| 290 | Ga0495658_0145870 | 3300046683 | Bacteria | 1450 |
| 291 | Ga0495613_0025541 | 3300046689 | Bacteria | 4401 |
| 292 | Ga0495670_0019119 | 3300046691 | Bacteria | 3376 |
| 293 | Ga0495589_0030983 | 3300046794 | Bacteria | 2693 |
| 294 | Ga0495660_0033359 | 3300046810 | Bacteria | 2887 |
| 295 | Ga0495581_0003120 | 3300047315 | Bacteria | 9487 |
| 296 | Ga0495675_0029951 | 3300047444 | Bacteria | 3472 |
| 297 | Ga0495685_006233 | 3300047447 | Bacteria | 3900 |
| 298 | Ga0495681_0002008 | 3300047470 | Bacteria | 14874 |
| 299 | Ga0495686_0022937 | 3300047472 | Bacteria | 4124 |
| 300 | Ga0495686_0065542 | 3300047472 | Bacteria | 2245 |
| 301 | Ga0495593_0039592 | 3300047673 | Bacteria | 2541 |
| 302 | Ga0496100_0035880 | 3300048903 | Bacteria | 3123 |
| 303 | Ga0496100_0053075 | 3300048903 | Bacteria | 2638 |
| 304 | Ga0496101_0149301 | 3300048904 | Bacteria | 1787 |
| 305 | Ga0496102_0020851 | 3300048905 | Bacteria | 5793 |
| 306 | Ga0496102_0033417 | 3300048905 | Bacteria | 4622 |
| 307 | Ga0496102_0081665 | 3300048905 | Bacteria | 2980 |
| 308 | Ga0496102_0179950 | 3300048905 | Bacteria | 1992 |
| 309 | Ga0496103_0014332 | 3300048906 | Bacteria | 4708 |
| 310 | Ga0496103_0026275 | 3300048906 | Bacteria | 3525 |
| 311 | Ga0496103_0035073 | 3300048906 | Bacteria | 3070 |
| 312 | Ga0496104_0005629 | 3300048907 | Bacteria | 10975 |
| 313 | Ga0496104_0021152 | 3300048907 | Bacteria | 5970 |
| 314 | Ga0496104_0030725 | 3300048907 | Bacteria | 4993 |
| 315 | Ga0496104_0050791 | 3300048907 | Bacteria | 3912 |
| 316 | Ga0496105_0013069 | 3300048908 | Bacteria | 6582 |
| 317 | Ga0496105_0024142 | 3300048908 | Bacteria | 4937 |
| 318 | Ga0496105_0078763 | 3300048908 | Bacteria | 2721 |
| 319 | Ga0496105_0147382 | 3300048908 | Bacteria | 1935 |
| 320 | Ga0496105_0187719 | 3300048908 | Bacteria | 1691 |
| 321 | Ga0496106_0042595 | 3300048909 | Bacteria | 3404 |
| 322 | Ga0496107_0008280 | 3300048910 | Bacteria | 7193 |
| 323 | Ga0496108_0007995 | 3300048911 | Bacteria | 8579 |
| 324 | Ga0496108_0017314 | 3300048911 | Bacteria | 5894 |
| 325 | Ga0496108_0120787 | 3300048911 | Bacteria | 2247 |
| 326 | Ga0496108_0170294 | 3300048911 | Bacteria | 1884 |
| 327 | Ga0496108_0207655 | 3300048911 | Bacteria | 1700 |
| 328 | Ga0496109_0059766 | 3300048912 | Bacteria | 3483 |
| 329 | Ga0496109_0210365 | 3300048912 | Bacteria | 1829 |
| 330 | Ga0496110_0086690 | 3300048913 | Bacteria | 2796 |
| 331 | Ga0496110_0174724 | 3300048913 | Bacteria | 1949 |
| 332 | Ga0496110_0220401 | 3300048913 | Bacteria | 1725 |
| 333 | Ga0496111_0029707 | 3300048914 | Bacteria | 3883 |
| 334 | Ga0496112_0003408 | 3300048915 | Bacteria | 13132 |
| 335 | Ga0496112_0121240 | 3300048915 | Bacteria | 2584 |
| 336 | Ga0496113_0135798 | 3300048916 | Bacteria | 1932 |
| 337 | Ga0496114_0007483 | 3300048917 | Bacteria | 8634 |
| 338 | Ga0496114_0011309 | 3300048917 | Bacteria | 7128 |
| 339 | Ga0496114_0028769 | 3300048917 | Bacteria | 4563 |
| 340 | Ga0496114_0037440 | 3300048917 | Bacteria | 4012 |
| 341 | Ga0496114_0059614 | 3300048917 | Bacteria | 3189 |
| 342 | Ga0496114_0064535 | 3300048917 | Bacteria | 3067 |
| 343 | Ga0496114_0201690 | 3300048917 | Bacteria | 1742 |
| 344 | Ga0496115_0012201 | 3300048918 | Bacteria | 6461 |
| 345 | Ga0496115_0167954 | 3300048918 | Bacteria | 1814 |
| 346 | Ga0496116_0000296 | 3300048919 | Bacteria | 84170 |
| 347 | Ga0496117_0052253 | 3300048920 | Bacteria | 2880 |
| 348 | Ga0496118_0000450 | 3300048921 | Bacteria | 68053 |
| 349 | Ga0496118_0000539 | 3300048921 | Bacteria | 62235 |
| 350 | Ga0496118_0009906 | 3300048921 | Bacteria | 9524 |
| 351 | Ga0496119_0002436 | 3300048922 | Bacteria | 20424 |
| 352 | Ga0496119_0018561 | 3300048922 | Bacteria | 5170 |
| 353 | Ga0496119_0024855 | 3300048922 | Bacteria | 4200 |
| 354 | Ga0496119_0046275 | 3300048922 | Bacteria | 2718 |
| 355 | Ga0496120_0000912 | 3300048923 | Bacteria | 41157 |
| 356 | Ga0496121_0002597 | 3300048924 | Bacteria | 27280 |
| 357 | Ga0496124_0000070 | 3300048927 | Bacteria | 220875 |
| 358 | Ga0496126_0000039 | 3300048929 | Bacteria | 347353 |
| 359 | Ga0501031_0020086 | 3300049568 | Bacteria | 4354 |
| 360 | Ga0501032_0001070 | 3300049569 | Bacteria | 21896 |
| 361 | Ga0501032_0021017 | 3300049569 | Bacteria | 4540 |
| 362 | Ga0501032_0102795 | 3300049569 | Bacteria | 1893 |
| 363 | Ga0501032_0114138 | 3300049569 | Bacteria | 1787 |
| 364 | Ga0501034_0002869 | 3300049571 | Bacteria | 20047 |
| 365 | Ga0501034_0044786 | 3300049571 | Bacteria | 4473 |
| 366 | Ga0501034_0251421 | 3300049571 | Bacteria | 1712 |
| 367 | Ga0501036_0026955 | 3300049572 | Bacteria | 4856 |
| 368 | Ga0501037_0188046 | 3300049573 | Bacteria | 1463 |
| 369 | Ga0501038_0000874 | 3300049574 | Bacteria | 26668 |
| 370 | Ga0501038_0002834 | 3300049574 | Bacteria | 16135 |
| 371 | Ga0501038_0028831 | 3300049574 | Bacteria | 4928 |
| 372 | Ga0501038_0050386 | 3300049574 | Bacteria | 3597 |
| 373 | Ga0501038_0095135 | 3300049574 | Bacteria | 2489 |
| 374 | Ga0501039_0140632 | 3300049575 | Bacteria | 1896 |
| 375 | Ga0501039_0293622 | 3300049575 | Bacteria | 1278 |
| 376 | Ga0501040_0076772 | 3300049576 | Bacteria | 2310 |
| 377 | Ga0501043_0098959 | 3300049579 | Bacteria | 2292 |
| 378 | Ga0501046_0006633 | 3300049580 | Bacteria | 10223 |
| 379 | Ga0501047_0001249 | 3300049581 | Bacteria | 25187 |
| 380 | Ga0501047_0001979 | 3300049581 | Bacteria | 19657 |
| 381 | Ga0501047_0014587 | 3300049581 | Bacteria | 7477 |
| 382 | Ga0501047_0018269 | 3300049581 | Bacteria | 6719 |
| 383 | Ga0501047_0213779 | 3300049581 | Bacteria | 1786 |
| 384 | Ga0501047_0216713 | 3300049581 | Bacteria | 1771 |
| 385 | Ga0501048_0000373 | 3300049582 | Bacteria | 31068 |
| 386 | Ga0501067_0006061 | 3300049583 | Bacteria | 6702 |
| 387 | Ga0501067_0030766 | 3300049583 | Bacteria | 2977 |
| 388 | Ga0501067_0036328 | 3300049583 | Bacteria | 2735 |
| 389 | Ga0501068_0014611 | 3300049584 | Bacteria | 4493 |
| 390 | Ga0501069_0009132 | 3300049585 | Bacteria | 5235 |
| 391 | Ga0501070_0019176 | 3300049586 | Bacteria | 5737 |
| 392 | Ga0501070_0056039 | 3300049586 | Bacteria | 3267 |
| 393 | Ga0501070_0167207 | 3300049586 | Bacteria | 1812 |
| 394 | Ga0501071_0030588 | 3300049587 | Bacteria | 3809 |
| 395 | Ga0501071_0103490 | 3300049587 | Bacteria | 2100 |
| 396 | Ga0501072_0022233 | 3300049588 | Bacteria | 4920 |
| 397 | Ga0501072_0049749 | 3300049588 | Bacteria | 3300 |
| 398 | Ga0501073_0033234 | 3300049589 | Bacteria | 3673 |
| 399 | Ga0501073_0034147 | 3300049589 | Bacteria | 3621 |
| 400 | Ga0501074_0000804 | 3300049590 | Bacteria | 19861 |
| 401 | Ga0501074_0016896 | 3300049590 | Bacteria | 5294 |
| 402 | Ga0501074_0163835 | 3300049590 | Bacteria | 1587 |
| 403 | Ga0501074_0171875 | 3300049590 | Bacteria | 1547 |
| 404 | Ga0501076_0008492 | 3300049592 | Bacteria | 7526 |
| 405 | Ga0501080_0187002 | 3300049742 | Bacteria | 1904 |
| 406 | Ga0501081_0132854 | 3300049743 | Bacteria | 1779 |
| 407 | Ga0501083_0063096 | 3300049744 | Bacteria | 2471 |
| 408 | Ga0501035_0013814 | 3300049822 | Bacteria | 7454 |
| 409 | Ga0501035_0018702 | 3300049822 | Bacteria | 6381 |
| 410 | Ga0501035_0025648 | 3300049822 | Bacteria | 5403 |
| 411 | Ga0501035_0064591 | 3300049822 | Bacteria | 3252 |
| 412 | Ga0501035_0202702 | 3300049822 | Bacteria | 1700 |
| 413 | Ga0501044_0002889 | 3300049823 | Bacteria | 19566 |
| 414 | Ga0501044_0238743 | 3300049823 | Bacteria | 1762 |
| 415 | Ga0501044_0302483 | 3300049823 | Bacteria | 1528 |
| 416 | Ga0501045_0099509 | 3300049824 | Bacteria | 2152 |
| 417 | nmdc:mga03n38_21890_c1 | 3300050490 | Bacteria | 2579 |
| 418 | nmdc:mga03n38_30220_c1 | 3300050490 | Bacteria | 2275 |
| 419 | nmdc:mga03n38_5964_c1 | 3300050490 | Bacteria | 4195 |
| 420 | nmdc:mga03n38_76225_c1 | 3300050490 | Bacteria | 1564 |
| 421 | nmdc:mga00v17_6384_c1 | 3300050491 | Bacteria | 6256 |
| 422 | nmdc:mga0yw44_18423_c1 | 3300050492 | Bacteria | 3824 |
| 423 | nmdc:mga0yw44_37589_c1 | 3300050492 | Bacteria | 2859 |
| 424 | nmdc:mga06z11_3127_c1 | 3300050494 | Bacteria | 6386 |
| 425 | nmdc:mga07m45_21281_c1 | 3300050496 | Bacteria | 3530 |
| 426 | nmdc:mga07m45_56735_c1 | 3300050496 | Bacteria | 2214 |
| 427 | nmdc:mga05p37_48839_c1 | 3300050507 | Bacteria | 5204 |
| 428 | nmdc:mga05p37_6109_c1 | 3300050507 | Bacteria | 14184 |
| 429 | nmdc:mga09592_12239_c1 | 3300050508 | Bacteria | 6985 |
| 430 | nmdc:mga0qj67_64894_c1 | 3300050509 | Bacteria | 2906 |
| 431 | nmdc:mga0a205_372173_c1 | 3300050515 | Bacteria | 1294 |
| 432 | nmdc:mga0a205_7047_c1 | 3300050515 | Bacteria | 10152 |
| 433 | Ga0495619_0057112 | 3300053085 | Bacteria | 2589 |
| 434 | Ga0500578_0016970 | 3300053086 | Bacteria | 4677 |
| 435 | Ga0500654_032057 | 3300053099 | Bacteria | 3142 |
| 436 | Ga0500660_060920 | 3300053100 | Bacteria | 1818 |
| 437 | Ga0500553_011669 | 3300053101 | Bacteria | 4434 |
| 438 | Ga0500652_000974 | 3300053131 | Bacteria | 9465 |
| 439 | Ga0500658_0004189 | 3300053134 | Bacteria | 5415 |
| 440 | Ga0500559_0032515 | 3300053136 | Bacteria | 2243 |
| 441 | Ga0500561_0001295 | 3300053137 | Bacteria | 4062 |
| 442 | Ga0500577_0020615 | 3300053142 | Bacteria | 2160 |
| 443 | Ga0500579_030163 | 3300053143 | Bacteria | 3482 |
| 444 | Ga0500600_0065972 | 3300053149 | Bacteria | 2000 |
| 445 | Ga0500616_0009319 | 3300053153 | Bacteria | 5980 |
| 446 | Ga0500633_0008448 | 3300053160 | Bacteria | 2656 |
| 447 | Ga0500634_0005822 | 3300053161 | Bacteria | 5902 |
| 448 | Ga0500656_000164 | 3300053732 | Bacteria | 4237 |
| 449 | Ga0500587_003946 | 3300053739 | Bacteria | 2050 |
| 450 | Ga0501084_0001237 | 3300054114 | Bacteria | 20115 |
| 451 | Ga0501084_0078479 | 3300054114 | Bacteria | 2767 |
| 452 | Ga0590075_010235 | 3300059424 | Bacteria | 2257 |
| 453 | Ga0501082_0001010 | 3300060353 | Bacteria | 24869 |
| 454 | Ga0501082_0064880 | 3300060353 | Bacteria | 3145 |
| 455 | Ga0466962_0005037 | 3300061719 | Bacteria | 6354 |
| 456 | Ga0466962_0010348 | 3300061719 | Bacteria | 4482 |
| 457 | Ga0466962_0026767 | 3300061719 | Bacteria | 2769 |
| 458 | Ga0530510_0061968 | 3300061734 | Bacteria | 2708 |
| 459 | Ga0530510_0125303 | 3300061734 | Bacteria | 1888 |
| 460 | 2671839553 | 2671180195 | Bacteria | 9757215 |
| 461 | 2506865131 | 2506783011 | Bacteria | 5323186 |
| 462 | 2508671248 | 2508501039 | Bacteria | 9978592 |
| 463 | 2517761973 | 2517572101 | Bacteria | 6884336 |
| 464 | 2528202877 | 2527291627 | Bacteria | 5309833 |
| 465 | 2528213255 | 2527291629 | Bacteria | 5267418 |
| 466 | 2546947608 | 2546825537 | Bacteria | 5389291 |
| 467 | 2579748404 | 2576861822 | Bacteria | 5004595 |
| 468 | 2579857877 | 2579778521 | Bacteria | 7624758 |
| 469 | 2619858531 | 2619618881 | Bacteria | 7521104 |
| 470 | 2620353766 | 2619619003 | Bacteria | 7619552 |
| 471 | 2626634479 | 2626541554 | Bacteria | 7741902 |
| 472 | 2643768362 | 2643221549 | Bacteria | 4042819 |
| 473 | 2644447031 | 2643221679 | Bacteria | 3839507 |
| 474 | 2676202649 | 2675902999 | Bacteria | 9438463 |
| 475 | 2686534369 | 2684623035 | Bacteria | 8032739 |
| 476 | 2686543751 | 2684623036 | Bacteria | 5199090 |
| 477 | 2689962815 | 2687453737 | Bacteria | 11203906 |
| 478 | 2689990496 | 2687453743 | Bacteria | 8361025 |
| 479 | 2710604307 | 2710264753 | Bacteria | 5455564 |
| 480 | 2723641151 | 2721755702 | Bacteria | 4373124 |
| 481 | 2731907364 | 2731639228 | Bacteria | 4187555 |
| 482 | 2739206193 | 2738543005 | Bacteria | 5278128 |
| 483 | 2739362679 | 2738543034 | Bacteria | 6084756 |
| 484 | 2753302691 | 2751185788 | Bacteria | 4541048 |
| 485 | 2774847225 | 2773857921 | Bacteria | 9435764 |
| 486 | 2774857709 | 2773857922 | Bacteria | 9757215 |
| 487 | 2774864287 | 2773857924 | Bacteria | 5256821 |
| 488 | 2774904620 | 2773857933 | Bacteria | 5818019 |
| 489 | 2793984501 | 2791355406 | Bacteria | 11364898 |
| 490 | 2799183842 | 2799112218 | Bacteria | 4315149 |
| 491 | 2837274393 | 2837268691 | Bacteria | 7850704 |
| 492 | 2855390155 | 2855386786 | Bacteria | 4752232 |
| 493 | 2857485317 | 2857481737 | Bacteria | 4761446 |
| 494 | 2862383411 | 2862382967 | Bacteria | 10317375 |
| 495 | 2863412093 | 2863404153 | Bacteria | 9672205 |
| 496 | 2895883769 | 2895880812 | Bacteria | 11255272 |
| 497 | 2904433507 | 2904430863 | Bacteria | 3486923 |
| 498 | 2904503989 | 2904501621 | Bacteria | 3401437 |
| 499 | 2904768067 | 2904765812 | Bacteria | 5369154 |
| 500 | 2904776046 | 2904770941 | Bacteria | 5580202 |
| 501 | 2908676954 | 2908674828 | Bacteria | 3382763 |
| 502 | 2908815369 | 2908811453 | Bacteria | 5478616 |
| 503 | 2909076869 | 2909074476 | Bacteria | 3436050 |
| 504 | 2912761740 | 2912757875 | Bacteria | 7940295 |
| 505 | 2919039481 | 2919039151 | Bacteria | 3391018 |
| 506 | 2919042877 | 2919042368 | Bacteria | 3905917 |
| 507 | 2919423502 | 2919420072 | Bacteria | 5390363 |
| 508 | 2919436110 | 2919432681 | Bacteria | 5390474 |
| 509 | 2919443687 | 2919443155 | Bacteria | 4072969 |
| 510 | 2919448902 | 2919446982 | Bacteria | 3994487 |
| 511 | 2928146602 | 2928142448 | Bacteria | 5288925 |
| 512 | 2928502096 | 2928500415 | Bacteria | 3384541 |
| 513 | 2932400137 | 2932398195 | Bacteria | 3847976 |
| 514 | 2935392808 | 2935390628 | Bacteria | 7043367 |
| 515 | 2935410557 | 2935409751 | Bacteria | 4179611 |
| 516 | 2954006286 | 2954002825 | Bacteria | 9173742 |
| 517 | 2956940775 | 2956939328 | Bacteria | 3474458 |
| 518 | 2966927274 | 2966924647 | Bacteria | 3268643 |
| 519 | 2984554840 | 2984551494 | Bacteria | 3877562 |
| 520 | 2990065229 | 2990059506 | Bacteria | 9321252 |
| 521 | 2997454439 | 2997451912 | Bacteria | 8492419 |
| 522 | 2997600099 | 2997600082 | Bacteria | 9896405 |
| 523 | 3001120463 | 3001119090 | Bacteria | 3449530 |
| 524 | 3006325548 | 3006321560 | Bacteria | 8247479 |
| 525 | 3006425649 | 3006425503 | Bacteria | 6491253 |
| 526 | 3006487348 | 3006486233 | Bacteria | 8157040 |
| 527 | 637877590 | 637000116 | Bacteria | 5433628 |
| 528 | 8002778724 | 8002775197 | Bacteria | 10728764 |
| 529 | 8002790922 | 8002784119 | Bacteria | 9788632 |
| 530 | 8008566047 | 8008558824 | Bacteria | 10610750 |
| 531 | 8033688464 | 8033684223 | Bacteria | 6906479 |
| 532 | 8047897764 | 8047893842 | Bacteria | 11723082 |
| 533 | 8048137041 | 8048127548 | Bacteria | 11053136 |
| 534 | 8048361107 | 8048356638 | Bacteria | 11044339 |
| 535 | 8048374750 | 8048369669 | Bacteria | 11666822 |
| 536 | 8048383472 | 8048379754 | Bacteria | 11877923 |
| 537 | 8053951789 | 8053945823 | Bacteria | 8962862 |
| 538 | 8054611497 | 8054609563 | Bacteria | 5170090 |
| 539 | 8054915565 | 8054913762 | Bacteria | 7713009 |
| 540 | 8054922125 | 8054920844 | Bacteria | 7068637 |
| 541 | 8055162199 | 8055157932 | Bacteria | 6429399 |
| 542 | 8056060028 | 8056054917 | Bacteria | 5736694 |
| 543 | Ga0007423J48922_100306 | |||
| 544 | Ga0070658_10000174 | |||
| 545 | Ga0070658_10004590 | |||
| 546 | Ga0070658_10012296 | |||
| 547 | Ga0070658_10024980 | |||
| 548 | Ga0070658_10072107 | |||
| 549 | Ga0070658_10119594 | |||
| 550 | Ga0070683_100033142 | |||
| 551 | Ga0070683_100263182 | |||
| 552 | Ga0070680_100002830 | |||
| 553 | Ga0070660_100011981 | |||
| 554 | Ga0070660_100088973 | |||
| 555 | Ga0070660_100128559 | |||
| 556 | Ga0070689_100047655 | |||
| 557 | Ga0070689_100311337 | |||
| 558 | Ga0070659_100037671 | |||
| 559 | Ga0070667_100073523 | |||
| 560 | Ga0070709_10002956 | |||
| 561 | Ga0070714_100026166 | |||
| 562 | Ga0070714_100082456 | |||
| 563 | Ga0070714_100211283 | |||
| 564 | Ga0070713_100080582 | |||
| 565 | Ga0070713_100111324 | |||
| 566 | Ga0070710_10009074 | |||
| 567 | Ga0070711_100011553 | |||
| 568 | Ga0070711_100022037 | |||
| 569 | Ga0070705_100005403 | |||
| 570 | Ga0070678_100068914 | |||
| 571 | Ga0070681_10000699 | |||
| 572 | Ga0070681_10003041 | |||
| 573 | Ga0070681_10011606 | |||
| 574 | Ga0070681_10230920 | |||
| 575 | Ga0070679_100000016 | |||
| 576 | Ga0070679_100000749 | |||
| 577 | Ga0070672_100083110 | |||
| 578 | Ga0070695_100000134 | |||
| 579 | Ga0070696_100010761 | |||
| 580 | Ga0068855_100007652 | |||
| 581 | Ga0068855_100008356 | |||
| 582 | Ga0068855_100073057 | |||
| 583 | Ga0068855_100355862 | |||
| 584 | Ga0068857_100018448 | |||
| 585 | Ga0068859_100000044 | |||
| 586 | Ga0068859_100011375 | |||
| 587 | Ga0068863_100001443 | |||
| 588 | Ga0068858_100000255 | |||
| 589 | Ga0068858_100008444 | |||
| 590 | Ga0068862_100000582 | |||
| 591 | Ga0068862_100013448 | |||
| 592 | Ga0068862_100103465 | |||
| 593 | Ga0081538_10000017 | |||
| 594 | Ga0081538_10001387 | |||
| 595 | Ga0081538_10036580 | |||
| 596 | Ga0081539_10004810 | |||
| 597 | Ga0081539_10010140 | |||
| 598 | Ga0070717_10017851 | |||
| 599 | Ga0075365_10017868 | |||
| 600 | Ga0075365_10030967 | |||
| 601 | Ga0075365_10137124 | |||
| 602 | Ga0075368_10002673 | |||
| 603 | Ga0075368_10032353 | |||
| 604 | Ga0075363_100003808 | |||
| 605 | Ga0075363_100031723 | |||
| 606 | Ga0075364_10019192 | |||
| 607 | Ga0070715_10001332 | |||
| 608 | Ga0070716_100004048 | |||
| 609 | Ga0070712_100034576 | |||
| 610 | Ga0070712_100043165 | |||
| 611 | Ga0075367_10001582 | |||
| 612 | Ga0075367_10009455 | |||
| 613 | Ga0075367_10017877 | |||
| 614 | Ga0075369_10011603 | |||
| 615 | Ga0075370_10006461 | |||
| 616 | Ga0075370_10036037 | |||
| 617 | Ga0075370_10095760 | |||
| 618 | Ga0075430_100038892 | |||
| 619 | Ga0075431_100048291 | |||
| 620 | Ga0075429_100055300 | |||
| 621 | Ga0097620_100000044 | |||
| 622 | Ga0097620_100011376 | |||
| 623 | Ga0105251_10030714 | |||
| 624 | Ga0105240_10023346 | |||
| 625 | Ga0105245_10150458 | |||
| 626 | Ga0105247_10000156 | |||
| 627 | Ga0105247_10001530 | |||
| 628 | Ga0114129_10052080 | |||
| 629 | Ga0105243_10070242 | |||
| 630 | Ga0105242_10185755 | |||
| 631 | Ga0105248_10001239 | |||
| 632 | Ga0105248_10001256 | |||
| 633 | Ga0105237_10044093 | |||
| 634 | Ga0105249_10034245 | |||
| 635 | Ga0105246_10054973 | |||
| 636 | Ga0157370_10017076 | |||
| 637 | Ga0157370_10138838 | |||
| 638 | Ga0157369_10008413 | |||
| 639 | Ga0157369_10108634 | |||
| 640 | Ga0157369_10114550 | |||
| 641 | Ga0157372_10044925 | |||
| 642 | Ga0157372_10117532 | |||
| 643 | Ga0157375_10264183 | |||
| 644 | Ga0197907_10154638 | |||
| 645 | Ga0206356_10327712 | |||
| 646 | Ga0206351_10027356 | |||
| 647 | Ga0206354_10758654 | |||
| 648 | Ga0206353_10289478 | |||
| 649 | Ga0206353_10717049 | |||
| 650 | Ga0206353_11386822 | |||
| 651 | Ga0154015_1259439 | |||
| 652 | Ga0224712_10005920 | |||
| 653 | Ga0224712_10021589 | |||
| 654 | Ga0207426_1018149 | |||
| 655 | Ga0207710_10000072 | |||
| 656 | Ga0207710_10000170 | |||
| 657 | Ga0207685_10014475 | |||
| 658 | Ga0207699_10006297 | |||
| 659 | Ga0207699_10047529 | |||
| 660 | Ga0207705_10000240 | |||
| 661 | Ga0207705_10006072 | |||
| 662 | Ga0207705_10070766 | |||
| 663 | Ga0207705_10188434 | |||
| 664 | Ga0207684_10070794 | |||
| 665 | Ga0207707_10000185 | |||
| 666 | Ga0207707_10029329 | |||
| 667 | Ga0207693_10003613 | |||
| 668 | Ga0207693_10022966 | |||
| 669 | Ga0207663_10006305 | |||
| 670 | Ga0207660_10005140 | |||
| 671 | Ga0207660_10005507 | |||
| 672 | Ga0207660_10039249 | |||
| 673 | Ga0207660_10192844 | |||
| 674 | Ga0207657_10022088 | |||
| 675 | Ga0207657_10030196 | |||
| 676 | Ga0207657_10123951 | |||
| 677 | Ga0207652_10001048 | |||
| 678 | Ga0207652_10007036 | |||
| 679 | Ga0207652_10103586 | |||
| 680 | Ga0207687_10111156 | |||
| 681 | Ga0207700_10009973 | |||
| 682 | Ga0207664_10004815 | |||
| 683 | Ga0207664_10006516 | |||
| 684 | Ga0207664_10188453 | |||
| 685 | Ga0207690_10029359 | |||
| 686 | Ga0207709_10065711 | |||
| 687 | Ga0207665_10000968 | |||
| 688 | Ga0207711_10000278 | |||
| 689 | Ga0207711_10002402 | |||
| 690 | Ga0207661_10024811 | |||
| 691 | Ga0207661_10037345 | |||
| 692 | Ga0207667_10026468 | |||
| 693 | Ga0207667_10049149 | |||
| 694 | Ga0207712_10004148 | |||
| 695 | Ga0207658_10067315 | |||
| 696 | Ga0207703_10000002 | |||
| 697 | Ga0207703_10006834 | |||
| 698 | Ga0207641_10015913 | |||
| 699 | Ga0207648_10047995 | |||
| 700 | Ga0207683_10049255 | |||
| 701 | Ga0207683_10308519 | |||
| 702 | Ga0209813_10001982 | |||
| 703 | Ga0268266_10100020 | |||
| 704 | Ga0268265_10000205 | |||
| 705 | Ga0268264_10370608 | |||
| 706 | Ga0265334_10001378 | |||
| 707 | Ga0307517_10024886 | |||
| 708 | Ga0307515_10000965 | |||
| 709 | Ga0307515_10038522 | |||
| 710 | Ga0307515_10069559 | |||
| 711 | Ga0265338_10171387 | |||
| 712 | Ga0307511_10035903 | |||
| 713 | Ga0307511_10082388 | |||
| 714 | Ga0307512_10043560 | |||
| 715 | Ga0316183_1137558 | |||
| 716 | Ga0265325_10019113 | |||
| 717 | Ga0265340_10001123 | |||
| 718 | Ga0265340_10023513 | |||
| 719 | Ga0307513_10000002 | |||
| 720 | Ga0307513_10022809 | |||
| 721 | Ga0265313_10015478 | |||
| 722 | Ga0307508_10059555 | |||
| 723 | Ga0265342_10111742 | |||
| 724 | Ga0307516_10076934 | |||
| 725 | Ga0307516_10120094 | |||
| 726 | Ga0307405_10010198 | |||
| 727 | Ga0307410_10183116 | |||
| 728 | Ga0307406_10047471 | |||
| 729 | Ga0307412_10025143 | |||
| 730 | Ga0307412_10098541 | |||
| 731 | Ga0307412_10138684 | |||
| 732 | Ga0307416_100028947 | |||
| 733 | Ga0307415_100047140 | |||
| 734 | Ga0307415_100068458 | |||
| 735 | Ga0307415_100136391 | |||
| 736 | Ga0373931_0013664 | |||
| 737 | Ga0373947_0017870 | |||
| 738 | Ga0395899_0011162 | |||
| 739 | Ga0395899_0142717 | |||
| 740 | Ga0395900_0015041 | |||
| 741 | Ga0395900_0037428 | |||
| 742 | Ga0395900_0091206 | |||
| 743 | Ga0395900_0365267 | |||
| 744 | Ga0395898_0011193 | |||
| 745 | Ga0395898_0027543 | |||
| 746 | Ga0395898_0050587 | |||
| 747 | Ga0395898_0113444 | |||
| 748 | Ga0395898_0137819 | |||
| 749 | Ga0395905_0153452 | |||
| 750 | Ga0395901_0006329 | |||
| 751 | Ga0395901_0014408 | |||
| 752 | Ga0395901_0023031 | |||
| 753 | Ga0395901_0024910 | |||
| 754 | Ga0395901_0083700 | |||
| 755 | Ga0395901_0095144 | |||
| 756 | Ga0395901_0160636 | |||
| 757 | Ga0436360_0848307 | |||
| 758 | Ga0439439_0000735 | |||
| 759 | Ga0439461_0001842 | |||
| 760 | Ga0451837_0079567 | |||
| 761 | Ga0451853_0100757 | |||
| 762 | Ga0439449_0002513 | |||
| 763 | Ga0439449_0063764 | |||
| 764 | Ga0439457_004183 | |||
| 765 | Ga0450920_010690 | |||
| 766 | Ga0450894_000343 | |||
| 767 | Ga0450899_000348 | |||
| 768 | Ga0439446_0001632 | |||
| 769 | Ga0450908_001928 | |||
| 770 | Ga0439434_0010336 | |||
| 771 | Ga0466969_0009667 | |||
| 772 | Ga0466972_0030107 | |||
| 773 | Ga0466966_0010587 | |||
| 774 | Ga0466966_0060870 | |||
| 775 | Ga0466961_0010946 | |||
| 776 | Ga0466961_0066782 | |||
| 777 | Ga0466961_0160387 | |||
| 778 | Ga0466963_0000081 | |||
| 779 | Ga0466963_0031402 | |||
| 780 | Ga0466963_0114406 | |||
| 781 | Ga0466964_0037806 | |||
| 782 | Ga0466971_0044829 | |||
| 783 | Ga0466968_0032535 | |||
| 784 | Ga0466970_0035649 | |||
| 785 | Ga0466970_0047232 | |||
| 786 | Ga0466970_0097883 | |||
| 787 | Ga0466957_0010698 | |||
| 788 | Ga0466957_0050970 | |||
| 789 | Ga0466957_0104247 | |||
| 790 | Ga0466960_0015007 | |||
| 791 | Ga0466960_0027833 | |||
| 792 | Ga0466960_0041408 | |||
| 793 | Ga0466959_0013654 | |||
| 794 | Ga0466959_0018421 | |||
| 795 | Ga0466959_0042821 | |||
| 796 | Ga0466959_0106466 | |||
| 797 | Ga0451576_0260405 | |||
| 798 | Ga0466958_0004438 | |||
| 799 | Ga0466958_0019262 | |||
| 800 | Ga0466958_0027753 | |||
| 801 | Ga0466967_0007539 | |||
| 802 | Ga0466967_0028901 | |||
| 803 | Ga0466967_0039345 | |||
| 804 | Ga0466967_0417145 | |||
| 805 | Ga0495592_0108372 | |||
| 806 | Ga0495603_0036241 | |||
| 807 | Ga0495629_0041283 | |||
| 808 | Ga0495629_0073339 | |||
| 809 | Ga0495638_0047747 | |||
| 810 | Ga0495641_0040716 | |||
| 811 | Ga0495653_0053957 | |||
| 812 | Ga0495580_0045845 | |||
| 813 | Ga0495582_0000017 | |||
| 814 | Ga0495582_0126930 | |||
| 815 | Ga0495585_0041174 | |||
| 816 | Ga0495585_0052679 | |||
| 817 | Ga0495608_0011282 | |||
| 818 | Ga0495608_0103590 | |||
| 819 | Ga0495630_0037793 | |||
| 820 | Ga0495643_0013758 | |||
| 821 | Ga0495648_0030362 | |||
| 822 | Ga0495652_0060443 | |||
| 823 | Ga0495665_0003912 | |||
| 824 | Ga0495640_0102780 | |||
| 825 | Ga0495586_0016132 | |||
| 826 | Ga0495645_0026719 | |||
| 827 | Ga0495625_0017175 | |||
| 828 | Ga0495658_0002599 | |||
| 829 | Ga0495658_0006079 | |||
| 830 | Ga0495658_0070718 | |||
| 831 | Ga0495658_0082859 | |||
| 832 | Ga0495658_0145870 | |||
| 833 | Ga0495613_0025541 | |||
| 834 | Ga0495670_0019119 | |||
| 835 | Ga0495589_0030983 | |||
| 836 | Ga0495660_0033359 | |||
| 837 | Ga0495581_0003120 | |||
| 838 | Ga0495675_0029951 | |||
| 839 | Ga0495685_006233 | |||
| 840 | Ga0495681_0002008 | |||
| 841 | Ga0495686_0022937 | |||
| 842 | Ga0495686_0065542 | |||
| 843 | Ga0495593_0039592 | |||
| 844 | Ga0496100_0035880 | |||
| 845 | Ga0496100_0053075 | |||
| 846 | Ga0496101_0149301 | |||
| 847 | Ga0496102_0020851 | |||
| 848 | Ga0496102_0033417 | |||
| 849 | Ga0496102_0081665 | |||
| 850 | Ga0496102_0179950 | |||
| 851 | Ga0496103_0014332 | |||
| 852 | Ga0496103_0026275 | |||
| 853 | Ga0496103_0035073 | |||
| 854 | Ga0496104_0005629 | |||
| 855 | Ga0496104_0021152 | |||
| 856 | Ga0496104_0030725 | |||
| 857 | Ga0496104_0050791 | |||
| 858 | Ga0496105_0013069 | |||
| 859 | Ga0496105_0024142 | |||
| 860 | Ga0496105_0078763 | |||
| 861 | Ga0496105_0147382 | |||
| 862 | Ga0496105_0187719 | |||
| 863 | Ga0496106_0042595 | |||
| 864 | Ga0496107_0008280 | |||
| 865 | Ga0496108_0007995 | |||
| 866 | Ga0496108_0017314 | |||
| 867 | Ga0496108_0120787 | |||
| 868 | Ga0496108_0170294 | |||
| 869 | Ga0496108_0207655 | |||
| 870 | Ga0496109_0059766 | |||
| 871 | Ga0496109_0210365 | |||
| 872 | Ga0496110_0086690 | |||
| 873 | Ga0496110_0174724 | |||
| 874 | Ga0496110_0220401 | |||
| 875 | Ga0496111_0029707 | |||
| 876 | Ga0496112_0003408 | |||
| 877 | Ga0496112_0121240 | |||
| 878 | Ga0496113_0135798 | |||
| 879 | Ga0496114_0007483 | |||
| 880 | Ga0496114_0011309 | |||
| 881 | Ga0496114_0028769 | |||
| 882 | Ga0496114_0037440 | |||
| 883 | Ga0496114_0059614 | |||
| 884 | Ga0496114_0064535 | |||
| 885 | Ga0496114_0201690 | |||
| 886 | Ga0496115_0012201 | |||
| 887 | Ga0496115_0167954 | |||
| 888 | Ga0496116_0000296 | |||
| 889 | Ga0496117_0052253 | |||
| 890 | Ga0496118_0000450 | |||
| 891 | Ga0496118_0000539 | |||
| 892 | Ga0496118_0009906 | |||
| 893 | Ga0496119_0002436 | |||
| 894 | Ga0496119_0018561 | |||
| 895 | Ga0496119_0024855 | |||
| 896 | Ga0496119_0046275 | |||
| 897 | Ga0496120_0000912 | |||
| 898 | Ga0496121_0002597 | |||
| 899 | Ga0496124_0000070 | |||
| 900 | Ga0496126_0000039 | |||
| 901 | Ga0501031_0020086 | |||
| 902 | Ga0501032_0001070 | |||
| 903 | Ga0501032_0021017 | |||
| 904 | Ga0501032_0102795 | |||
| 905 | Ga0501032_0114138 | |||
| 906 | Ga0501034_0002869 | |||
| 907 | Ga0501034_0044786 | |||
| 908 | Ga0501034_0251421 | |||
| 909 | Ga0501036_0026955 | |||
| 910 | Ga0501037_0188046 | |||
| 911 | Ga0501038_0000874 | |||
| 912 | Ga0501038_0002834 | |||
| 913 | Ga0501038_0028831 | |||
| 914 | Ga0501038_0050386 | |||
| 915 | Ga0501038_0095135 | |||
| 916 | Ga0501039_0140632 | |||
| 917 | Ga0501039_0293622 | |||
| 918 | Ga0501040_0076772 | |||
| 919 | Ga0501043_0098959 | |||
| 920 | Ga0501046_0006633 | |||
| 921 | Ga0501047_0001249 | |||
| 922 | Ga0501047_0001979 | |||
| 923 | Ga0501047_0014587 | |||
| 924 | Ga0501047_0018269 | |||
| 925 | Ga0501047_0213779 | |||
| 926 | Ga0501047_0216713 | |||
| 927 | Ga0501048_0000373 | |||
| 928 | Ga0501067_0006061 | |||
| 929 | Ga0501067_0030766 | |||
| 930 | Ga0501067_0036328 | |||
| 931 | Ga0501068_0014611 | |||
| 932 | Ga0501069_0009132 | |||
| 933 | Ga0501070_0019176 | |||
| 934 | Ga0501070_0056039 | |||
| 935 | Ga0501070_0167207 | |||
| 936 | Ga0501071_0030588 | |||
| 937 | Ga0501071_0103490 | |||
| 938 | Ga0501072_0022233 | |||
| 939 | Ga0501072_0049749 | |||
| 940 | Ga0501073_0033234 | |||
| 941 | Ga0501073_0034147 | |||
| 942 | Ga0501074_0000804 | |||
| 943 | Ga0501074_0016896 | |||
| 944 | Ga0501074_0163835 | |||
| 945 | Ga0501074_0171875 | |||
| 946 | Ga0501076_0008492 | |||
| 947 | Ga0501080_0187002 | |||
| 948 | Ga0501081_0132854 | |||
| 949 | Ga0501083_0063096 | |||
| 950 | Ga0501035_0013814 | |||
| 951 | Ga0501035_0018702 | |||
| 952 | Ga0501035_0025648 | |||
| 953 | Ga0501035_0064591 | |||
| 954 | Ga0501035_0202702 | |||
| 955 | Ga0501044_0002889 | |||
| 956 | Ga0501044_0238743 | |||
| 957 | Ga0501044_0302483 | |||
| 958 | Ga0501045_0099509 | |||
| 959 | nmdc:mga03n38_21890_c1 | |||
| 960 | nmdc:mga03n38_30220_c1 | |||
| 961 | nmdc:mga03n38_5964_c1 | |||
| 962 | nmdc:mga03n38_76225_c1 | |||
| 963 | nmdc:mga00v17_6384_c1 | |||
| 964 | nmdc:mga0yw44_18423_c1 | |||
| 965 | nmdc:mga0yw44_37589_c1 | |||
| 966 | nmdc:mga06z11_3127_c1 | |||
| 967 | nmdc:mga07m45_21281_c1 | |||
| 968 | nmdc:mga07m45_56735_c1 | |||
| 969 | nmdc:mga05p37_48839_c1 | |||
| 970 | nmdc:mga05p37_6109_c1 | |||
| 971 | nmdc:mga09592_12239_c1 | |||
| 972 | nmdc:mga0qj67_64894_c1 | |||
| 973 | nmdc:mga0a205_372173_c1 | |||
| 974 | nmdc:mga0a205_7047_c1 | |||
| 975 | Ga0495619_0057112 | |||
| 976 | Ga0500578_0016970 | |||
| 977 | Ga0500654_032057 | |||
| 978 | Ga0500660_060920 | |||
| 979 | Ga0500553_011669 | |||
| 980 | Ga0500652_000974 | |||
| 981 | Ga0500658_0004189 | |||
| 982 | Ga0500559_0032515 | |||
| 983 | Ga0500561_0001295 | |||
| 984 | Ga0500577_0020615 | |||
| 985 | Ga0500579_030163 | |||
| 986 | Ga0500600_0065972 | |||
| 987 | Ga0500616_0009319 | |||
| 988 | Ga0500633_0008448 | |||
| 989 | Ga0500634_0005822 | |||
| 990 | Ga0500656_000164 | |||
| 991 | Ga0500587_003946 | |||
| 992 | Ga0501084_0001237 | |||
| 993 | Ga0501084_0078479 | |||
| 994 | Ga0590075_010235 | |||
| 995 | Ga0501082_0001010 | |||
| 996 | Ga0501082_0064880 | |||
| 997 | Ga0466962_0005037 | |||
| 998 | Ga0466962_0010348 | |||
| 999 | Ga0466962_0026767 | |||
| 1000 | Ga0530510_0061968 | |||
| 1001 | Ga0530510_0125303 | |||
| 1002 | 2671839553 | |||
| 1003 | 2506865131 | |||
| 1004 | 2508671248 | |||
| 1005 | 2517761973 | |||
| 1006 | 2528202877 | |||
| 1007 | 2528213255 | |||
| 1008 | 2546947608 | |||
| 1009 | 2579748404 | |||
| 1010 | 2579857877 | |||
| 1011 | 2619858531 | |||
| 1012 | 2620353766 | |||
| 1013 | 2626634479 | |||
| 1014 | 2643768362 | |||
| 1015 | 2644447031 | |||
| 1016 | 2676202649 | |||
| 1017 | 2686534369 | |||
| 1018 | 2686543751 | |||
| 1019 | 2689962815 | |||
| 1020 | 2689990496 | |||
| 1021 | 2710604307 | |||
| 1022 | 2723641151 | |||
| 1023 | 2731907364 | |||
| 1024 | 2739206193 | |||
| 1025 | 2739362679 | |||
| 1026 | 2753302691 | |||
| 1027 | 2774847225 | |||
| 1028 | 2774857709 | |||
| 1029 | 2774864287 | |||
| 1030 | 2774904620 | |||
| 1031 | 2793984501 | |||
| 1032 | 2799183842 | |||
| 1033 | 2837274393 | |||
| 1034 | 2855390155 | |||
| 1035 | 2857485317 | |||
| 1036 | 2862383411 | |||
| 1037 | 2863412093 | |||
| 1038 | 2895883769 | |||
| 1039 | 2904433507 | |||
| 1040 | 2904503989 | |||
| 1041 | 2904768067 | |||
| 1042 | 2904776046 | |||
| 1043 | 2908676954 | |||
| 1044 | 2908815369 | |||
| 1045 | 2909076869 | |||
| 1046 | 2912761740 | |||
| 1047 | 2919039481 | |||
| 1048 | 2919042877 | |||
| 1049 | 2919423502 | |||
| 1050 | 2919436110 | |||
| 1051 | 2919443687 | |||
| 1052 | 2919448902 | |||
| 1053 | 2928146602 | |||
| 1054 | 2928502096 | |||
| 1055 | 2932400137 | |||
| 1056 | 2935392808 | |||
| 1057 | 2935410557 | |||
| 1058 | 2954006286 | |||
| 1059 | 2956940775 | |||
| 1060 | 2966927274 | |||
| 1061 | 2984554840 | |||
| 1062 | 2990065229 | |||
| 1063 | 2997454439 | |||
| 1064 | 2997600099 | |||
| 1065 | 3001120463 | |||
| 1066 | 3006325548 | |||
| 1067 | 3006425649 | |||
| 1068 | 3006487348 | |||
| 1069 | 637877590 | |||
| 1070 | 8002778724 | |||
| 1071 | 8002790922 | |||
| 1072 | 8008566047 | |||
| 1073 | 8033688464 | |||
| 1074 | 8047897764 | |||
| 1075 | 8048137041 | |||
| 1076 | 8048361107 | |||
| 1077 | 8048374750 | |||
| 1078 | 8048383472 | |||
| 1079 | 8053951789 | |||
| 1080 | 8054611497 | |||
| 1081 | 8054915565 | |||
| 1082 | 8054922125 | |||
| 1083 | 8055162199 | |||
| 1084 | 8056060028 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3s1t-assembly1.cif.gz_B | structure of the regulatory domain of aspartokinase (rv3709c; ak-beta) in complex with threonine from mycobacterium tuberculosis | 0.9824 | 238 | 391 |
| 3ab2-assembly2.cif.gz_F | crystal structure of aspartate kinase from corynebacterium glutamicum in complex with threonine | 0.964 | 238 | 392 |
| 2re1-assembly1.cif.gz_A | crystal structure of aspartokinase alpha and beta subunits | 0.9639 | 240 | 391 |
| 3s1t-assembly1.cif.gz_B | structure of the regulatory domain of aspartokinase (rv3709c; ak-beta) in complex with threonine from mycobacterium tuberculosis | 0.9639 | 238 | 391 |
| 3ab2-assembly3.cif.gz_L | crystal structure of aspartate kinase from corynebacterium glutamicum in complex with threonine | 0.9627 | 240 | 392 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4go5X02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9665 | 249 | 327 | 3.30.70.260 |
| af_A0A1D6LW70_109_162_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9617 | 347 | 373 | 3.30.70.260 |
| 3ab2N01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9533 | 327 | 392 | 3.30.70.260 |
| 5yeiG02 | Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like | 0.9526 | 239 | 395 | 3.30.2130.10 |
| 5yeiG02 | Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like | 0.9467 | 239 | 395 | 3.30.2130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3FFF4-F1-model_v4 | aspartate kinase (EC 2.7.2.4) | 0.9948 | 80 | 166 |
GO:0004072
GO:0005829 GO:0009089 GO:0009090 |
| AF-A0A3C1KC44-F1-model_v4 | aspartate kinase (EC 2.7.2.4) | 0.9853 | 45 | 159 |
GO:0004072
GO:0005829 GO:0009089 GO:0009090 |
| AF-A0A7X6H8S5-F1-model_v4 | deleted | 0.9843 | 311 | 391 |
|
| AF-A0A3C1KC44-F1-model_v4 | aspartate kinase (EC 2.7.2.4) | 0.9769 | 45 | 159 |
GO:0004072
GO:0005829 GO:0009089 GO:0009090 |
| AF-A0A6B3FFF4-F1-model_v4 | aspartate kinase (EC 2.7.2.4) | 0.9725 | 80 | 166 |
GO:0004072
GO:0005829 GO:0009089 GO:0009090 |