F461565

General Info

Members Datasets Scaffolds Average Seq Length
542 338 1084 452

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2904434214|2904438564
Length 507
Sequence VTSVIGFFVAIDILVVFHELGHYSVARWCGVKVLRFSIGFGKPLLQRQGRDGTLWTIGWLPLGGYVRMLDERDPTQVRSDAVEDADGTVRVTAVSGSGTAAADTADAVTYRIAPADLPHAFNRQSVGKRFAIVAAGPIANFLLAILLFAGLSWYGQPEPEAILGTPTQDSMAQRAGIASGERVVAVRVTQRDGSDDGDVAYRSVRSWPELRHWLARDVDADASTVILRTQRPDGVATHTLSLAALQGDTPGKRRADMVGAGGGQADIATRLGLVPGGAAPLIASVQPGTPAAKAGLQEGDTVLRVQGETVDDANALVQMMRERPGRDTVLDIQRGNQNVTVHVVPEAVKEAGGGLPYGRIGAALGMRLPLVDVHYGPVESVRMAVGRTWDVASFSVEMFGRMLTGQASLKNLSGPVTIADYAGRSARMGVSAFISFLALVSISLGVLNLLPIPVLDGGHLLYYAVEALTGRAVSDRWQAILQRAGLVCIVALSVVALFNDLTRLAHS

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
3 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
146 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
155 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
156 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
157 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
158 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
159 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
160 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
221 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
222 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
230 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
262 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
288 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
289 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
293 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
294 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
295 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
296 2519103095 Burkholderia sp. KJ006 Isolate Nodule
297 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
298 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
299 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
300 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
301 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
302 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
303 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
304 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
305 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
306 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
307 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
308 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
309 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
310 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
311 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
312 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
313 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
314 2818991452 Burkholderia cepacia 561 Isolate Unclassified
315 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
316 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
317 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
318 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
319 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
320 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
321 2904564687 Burkholderia sp. 571 Isolate Unclassified
322 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
323 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
324 2928163908 Burkholderia sp. 567 Isolate Unclassified
325 2928170801 Burkholderia sp. 572 Isolate Unclassified
326 2928536128 Burkholderia sola 565 Isolate Unclassified
327 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
328 639633007 Azoarcus olearius BH72 Isolate Unclassified
329 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
330 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
331 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
332 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
333 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
334 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
335 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
336 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
337 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
338 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.33
Metatranscriptomes 0.18
Isolates 8.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 0.37
Rhizoplane 5.35
Rhizosphere 78.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000873 3300002067 Bacteria 10758
2 JGI24735J21928_10001265 3300002067 Bacteria 8973
3 Ga0055532_1003986 3300003758 Bacteria 2347
4 Ga0055527_1001753 3300003760 Bacteria 4185
5 Ga0055527_1001754 3300003760 Bacteria 4185
6 Ga0055535_1003659 3300003761 Bacteria 4185
7 Ga0055535_1003660 3300003761 Bacteria 4185
8 Ga0055542_1003532 3300003762 Bacteria 4185
9 Ga0055542_1003533 3300003762 Bacteria 4185
10 Ga0055529_1001476 3300003763 Bacteria 7024
11 Ga0055541_1007513 3300003841 Bacteria 1786
12 Ga0065704_10127221 3300005289 Bacteria 1678
13 Ga0070658_10002393 3300005327 Bacteria 15721
14 Ga0070658_10011021 3300005327 Bacteria 7247
15 Ga0070658_10059779 3300005327 Bacteria 3103
16 Ga0070658_10156923 3300005327 Bacteria 1908
17 Ga0070683_100070791 3300005329 Bacteria 3254
18 Ga0070670_100006956 3300005331 Bacteria 9588
19 Ga0070677_10015794 3300005333 Bacteria 2679
20 Ga0068869_100003904 3300005334 Bacteria 9197
21 Ga0068869_100025411 3300005334 Bacteria 4112
22 Ga0070666_10052439 3300005335 Bacteria 2749
23 Ga0068868_100035264 3300005338 Bacteria 3866
24 Ga0070660_100000504 3300005339 Bacteria 26092
25 Ga0070660_100001298 3300005339 Bacteria 17020
26 Ga0070661_100029621 3300005344 Bacteria 3952
27 Ga0070661_100102132 3300005344 Bacteria 2134
28 Ga0070675_100021815 3300005354 Bacteria 5116
29 Ga0070675_100044998 3300005354 Bacteria 3611
30 Ga0070671_100027234 3300005355 Bacteria 4703
31 Ga0070673_100005910 3300005364 Bacteria 7901
32 Ga0070673_100025823 3300005364 Bacteria 4330
33 Ga0070659_100000096 3300005366 Bacteria 66336
34 Ga0070667_100148267 3300005367 Bacteria 2059
35 Ga0070714_100051697 3300005435 Bacteria 3504
36 Ga0070713_100087693 3300005436 Bacteria 2670
37 Ga0070663_100002692 3300005455 Bacteria 10057
38 Ga0070678_100008537 3300005456 Bacteria 6137
39 Ga0070681_10016840 3300005458 Bacteria 7300
40 Ga0070681_10052589 3300005458 Bacteria 4063
41 Ga0068867_100151413 3300005459 Bacteria 1822
42 Ga0070684_100184485 3300005535 Bacteria 1897
43 Ga0068853_100008688 3300005539 Bacteria 8170
44 Ga0068853_100013155 3300005539 Bacteria 6753
45 Ga0068853_100203455 3300005539 Bacteria 1802
46 Ga0070672_100010363 3300005543 Bacteria 6463
47 Ga0070693_100011277 3300005547 Bacteria 4500
48 Ga0070693_100047823 3300005547 Bacteria 2435
49 Ga0070665_100054800 3300005548 Bacteria 3999
50 Ga0070665_100099519 3300005548 Bacteria 2912
51 Ga0068855_100010957 3300005563 Bacteria 10939
52 Ga0068855_100019484 3300005563 Bacteria 8153
53 Ga0068855_100019488 3300005563 Bacteria 8153
54 Ga0068855_100020921 3300005563 Bacteria 7846
55 Ga0068855_100148799 3300005563 Bacteria 2663
56 Ga0070664_100049898 3300005564 Bacteria 3540
57 Ga0068854_100078468 3300005578 Bacteria 2433
58 Ga0068856_100079495 3300005614 Bacteria 3252
59 Ga0068852_100005797 3300005616 Bacteria 8870
60 Ga0068859_100198246 3300005617 Bacteria 2092
61 Ga0068859_100253645 3300005617 Bacteria 1850
62 Ga0068866_10059311 3300005718 Bacteria 1979
63 Ga0068851_10020503 3300005834 Bacteria 3202
64 Ga0068870_10052284 3300005840 Bacteria 2166
65 Ga0068870_10061437 3300005840 Bacteria 2020
66 Ga0068863_100030839 3300005841 Bacteria 5120
67 Ga0068863_100073057 3300005841 Bacteria 3245
68 Ga0068858_100032267 3300005842 Bacteria 4865
69 Ga0068858_100082743 3300005842 Bacteria 2984
70 Ga0068862_100039651 3300005844 Bacteria 4001
71 Ga0070717_10130248 3300006028 Bacteria 2163
72 Ga0075369_10002482 3300006186 Bacteria 6587
73 Ga0075366_10003539 3300006195 Bacteria 8256
74 Ga0097621_100003683 3300006237 Bacteria 10596
75 Ga0097621_100014887 3300006237 Bacteria 5836
76 Ga0068871_100016562 3300006358 Bacteria 5558
77 Ga0068871_100019776 3300006358 Bacteria 5145
78 Ga0068871_100048150 3300006358 Bacteria 3440
79 Ga0068871_100160874 3300006358 Bacteria 1920
80 Ga0075428_100000245 3300006844 Bacteria 53219
81 Ga0075430_100020343 3300006846 Bacteria 5647
82 Ga0075430_100056022 3300006846 Bacteria 3315
83 Ga0075431_100003069 3300006847 Bacteria 16172
84 Ga0075431_100034097 3300006847 Bacteria 5245
85 Ga0075434_100041481 3300006871 Bacteria 4560
86 Ga0075429_100008747 3300006880 Bacteria 8806
87 Ga0075436_100008048 3300006914 Bacteria 7218
88 Ga0097620_100198243 3300006931 Bacteria 2092
89 Ga0097620_100253647 3300006931 Bacteria 1850
90 Ga0099794_10053454 3300007265 Bacteria 1948
91 Ga0105251_10001119 3300009011 Bacteria 23332
92 Ga0105240_10001770 3300009093 Bacteria 36461
93 Ga0105240_10059340 3300009093 Bacteria 4775
94 Ga0111539_10000383 3300009094 Bacteria 54556
95 Ga0111539_10080582 3300009094 Bacteria 3829
96 Ga0105245_10086042 3300009098 Bacteria 2882
97 Ga0105245_10164908 3300009098 Bacteria 2105
98 Ga0105243_10000770 3300009148 Bacteria 30670
99 Ga0105243_10026412 3300009148 Bacteria 4444
100 Ga0105243_10116079 3300009148 Bacteria 2248
101 Ga0105241_10017067 3300009174 Bacteria 5331
102 Ga0105242_10049912 3300009176 Bacteria 3406
103 Ga0105248_10002407 3300009177 Bacteria 20777
104 Ga0105248_10058954 3300009177 Bacteria 4312
105 Ga0105248_10137513 3300009177 Bacteria 2756
106 Ga0105237_10005766 3300009545 Bacteria 13911
107 Ga0105238_10001068 3300009551 Bacteria 27660
108 Ga0105238_10014298 3300009551 Bacteria 8023
109 Ga0105238_10078193 3300009551 Bacteria 3299
110 Ga0105249_10144621 3300009553 Bacteria 2283
111 Ga0105239_10002463 3300010375 Bacteria 23588
112 Ga0105239_10003884 3300010375 Bacteria 18132
113 Ga0105239_10007605 3300010375 Bacteria 12417
114 Ga0105239_10069989 3300010375 Bacteria 3854
115 Ga0157373_10006985 3300013100 Bacteria 8410
116 Ga0157373_10083475 3300013100 Bacteria 2252
117 Ga0157371_10007279 3300013102 Bacteria 8990
118 Ga0157370_10007952 3300013104 Bacteria 11485
119 Ga0157370_10008261 3300013104 Bacteria 11238
120 Ga0157370_10157383 3300013104 Bacteria 2114
121 Ga0157369_10000511 3300013105 Bacteria 51116
122 Ga0157369_10000979 3300013105 Bacteria 36209
123 Ga0157369_10002197 3300013105 Bacteria 23502
124 Ga0157369_10091577 3300013105 Bacteria 3245
125 Ga0157369_10246458 3300013105 Bacteria 1865
126 Ga0157374_10000107 3300013296 Bacteria 75925
127 Ga0157374_10031938 3300013296 Bacteria 4790
128 Ga0157374_10127586 3300013296 Bacteria 2459
129 Ga0157378_10063541 3300013297 Bacteria 3298
130 Ga0157378_10097337 3300013297 Bacteria 2682
131 Ga0157378_10169632 3300013297 Bacteria 2046
132 Ga0163162_10006481 3300013306 Bacteria 11333
133 Ga0157372_10002854 3300013307 Bacteria 18675
134 Ga0157372_10128119 3300013307 Bacteria 2919
135 Ga0157372_10129037 3300013307 Bacteria 2908
136 Ga0157372_10415704 3300013307 Bacteria 1567
137 Ga0157375_10023805 3300013308 Bacteria 5658
138 Ga0157375_10028549 3300013308 Bacteria 5232
139 Ga0157375_10069517 3300013308 Bacteria 3528
140 Ga0157375_10173663 3300013308 Bacteria 2304
141 Ga0157380_10210633 3300014326 Bacteria 1732
142 Ga0157376_10011903 3300014969 Bacteria 6433
143 Ga0157376_10040685 3300014969 Bacteria 3800
144 Ga0157376_10151166 3300014969 Bacteria 2094
145 Ga0182006_1033937 3300015261 Bacteria 2044
146 Ga0182007_10031403 3300015262 Bacteria 1809
147 Ga0182005_1020509 3300015265 Bacteria 1818
148 Ga0213872_10000003 3300021361 Bacteria 366948
149 Ga0209566_100559 3300025225 Bacteria 24573
150 Ga0209672_100014 3300025228 Bacteria 546252
151 Ga0209672_100023 3300025228 Bacteria 371758
152 Ga0209672_100433 3300025228 Bacteria 24114
153 Ga0209147_100094 3300025229 Bacteria 167145
154 Ga0209147_100104 3300025229 Bacteria 158375
155 Ga0209147_101808 3300025229 Bacteria 6696
156 Ga0209258_100040 3300025242 Bacteria 385401
157 Ga0209258_100142 3300025242 Bacteria 165865
158 Ga0209148_1000035 3300025254 Bacteria 548413
159 Ga0209759_1000030 3300025256 Bacteria 285649
160 Ga0209759_1011780 3300025256 Bacteria 2462
161 Ga0209455_1000072 3300025272 Bacteria 293074
162 Ga0209564_1004868 3300025295 Bacteria 7977
163 Ga0209257_1026844 3300025304 Bacteria 1930
164 Ga0207713_1002241 3300025735 Bacteria 14307
165 Ga0207682_10020088 3300025893 Bacteria 2620
166 Ga0207647_10000108 3300025904 Bacteria 63172
167 Ga0207647_10000498 3300025904 Bacteria 31401
168 Ga0207647_10036364 3300025904 Bacteria 3129
169 Ga0207643_10018307 3300025908 Bacteria 3836
170 Ga0207643_10084818 3300025908 Bacteria 1839
171 Ga0207705_10001472 3300025909 Bacteria 18763
172 Ga0207705_10010151 3300025909 Bacteria 6852
173 Ga0207654_10003311 3300025911 Bacteria 8149
174 Ga0207707_10145180 3300025912 Bacteria 2074
175 Ga0207695_10012800 3300025913 Bacteria 10045
176 Ga0207695_10026800 3300025913 Bacteria 6428
177 Ga0207695_10232992 3300025913 Bacteria 1745
178 Ga0207671_10008853 3300025914 Bacteria 8477
179 Ga0207662_10036199 3300025918 Bacteria 2884
180 Ga0207657_10000004 3300025919 Bacteria 247179
181 Ga0207657_10064846 3300025919 Bacteria 3116
182 Ga0207649_10022174 3300025920 Bacteria 3668
183 Ga0207694_10024852 3300025924 Bacteria 4550
184 Ga0207650_10023575 3300025925 Bacteria 4365
185 Ga0207687_10010562 3300025927 Bacteria 6035
186 Ga0207644_10017931 3300025931 Bacteria 4787
187 Ga0207690_10000015 3300025932 Bacteria 257457
188 Ga0207709_10005524 3300025935 Bacteria 7171
189 Ga0207691_10007106 3300025940 Bacteria 10808
190 Ga0207689_10000974 3300025942 Bacteria 27470
191 Ga0207661_10188261 3300025944 Bacteria 1808
192 Ga0207667_10002397 3300025949 Bacteria 23474
193 Ga0207667_10003025 3300025949 Bacteria 20864
194 Ga0207667_10005390 3300025949 Bacteria 15598
195 Ga0207667_10007177 3300025949 Bacteria 13441
196 Ga0207667_10097788 3300025949 Bacteria 3029
197 Ga0207651_10019003 3300025960 Bacteria 4107
198 Ga0207651_10040384 3300025960 Bacteria 3086
199 Ga0207640_10064246 3300025981 Bacteria 2443
200 Ga0207658_10066305 3300025986 Bacteria 2715
201 Ga0207677_10036089 3300026023 Bacteria 3218
202 Ga0207703_10030879 3300026035 Bacteria 4236
203 Ga0207703_10057411 3300026035 Bacteria 3174
204 Ga0207639_10048486 3300026041 Bacteria 3215
205 Ga0207639_10064507 3300026041 Bacteria 2840
206 Ga0207678_10001691 3300026067 Bacteria 20214
207 Ga0207678_10002079 3300026067 Bacteria 18154
208 Ga0207702_10031798 3300026078 Bacteria 4401
209 Ga0207702_10100141 3300026078 Bacteria 2556
210 Ga0207641_10068358 3300026088 Bacteria 3046
211 Ga0207648_10000142 3300026089 Bacteria 71593
212 Ga0207676_10104768 3300026095 Bacteria 2353
213 Ga0207683_10003576 3300026121 Bacteria 13558
214 Ga0207683_10187256 3300026121 Bacteria 1878
215 Ga0207698_10049953 3300026142 Bacteria 3187
216 Ga0209371_1000079 3300027312 Bacteria 187621
217 Ga0209981_1002317 3300027378 Bacteria 2418
218 Ga0209974_10006559 3300027876 Bacteria 4058
219 Ga0207428_10005311 3300027907 Bacteria 12021
220 Ga0268266_10020285 3300028379 Bacteria 5668
221 Ga0268266_10035234 3300028379 Bacteria 4258
222 Ga0268266_10185285 3300028379 Bacteria 1898
223 Ga0265336_10002632 3300028666 Bacteria 7290
224 Ga0265338_10000028 3300028800 Bacteria 279132
225 Ga0265338_10000741 3300028800 Bacteria 55680
226 Ga0265324_10000005 3300029957 Bacteria 347038
227 Ga0265324_10000205 3300029957 Bacteria 45035
228 Ga0265324_10014450 3300029957 Bacteria 2922
229 Ga0268256_1000090 3300030500 Bacteria 153976
230 Ga0265325_10000314 3300031241 Bacteria 34098
231 Ga0265331_10013109 3300031250 Bacteria 4466
232 Ga0265331_10017844 3300031250 Bacteria 3693
233 Ga0265327_10001032 3300031251 Bacteria 39265
234 Ga0265316_10108626 3300031344 Bacteria 2103
235 Ga0307408_100131321 3300031548 Bacteria 1954
236 Ga0307408_100167561 3300031548 Bacteria 1751
237 Ga0265314_10000740 3300031711 Bacteria 39277
238 Ga0316583_10013376 3300032133 Bacteria 2961
239 Ga0316593_10000190 3300032168 Bacteria 9414
240 Ga0373955_0042294 3300035172 Bacteria 2446
241 Ga0373937_0011712 3300036401 Bacteria 7692
242 Ga0373937_0090607 3300036401 Bacteria 2832
243 Ga0395899_0000007 3300037312 Bacteria 629129
244 Ga0395900_0000026 3300037418 Bacteria 313470
245 Ga0395900_0027856 3300037418 Bacteria 5788
246 Ga0395900_0044477 3300037418 Bacteria 4575
247 Ga0395898_0000497 3300037466 Bacteria 76853
248 Ga0395898_0001748 3300037466 Bacteria 28615
249 Ga0395905_0028009 3300037471 Bacteria 5311
250 Ga0395901_0000077 3300038443 Bacteria 135073
251 Ga0395901_0000296 3300038443 Bacteria 61806
252 Ga0395901_0000923 3300038443 Bacteria 31994
253 Ga0395901_0019691 3300038443 Bacteria 6899
254 Ga0400484_29948 3300038725 Bacteria 10111
255 Ga0400484_43627 3300038725 Bacteria 12060
256 Ga0400490_17851 3300038726 Bacteria 80099
257 Ga0400485_07894 3300038735 Bacteria 3828
258 Ga0400488_31176 3300038741 Bacteria 4202
259 Ga0400488_33004 3300038741 Bacteria 10792
260 Ga0400488_38891 3300038741 Bacteria 20773
261 Ga0400486_00233 3300038742 Bacteria 7497
262 Ga0400486_14851 3300038742 Bacteria 63108
263 Ga0400483_108358 3300039062 Bacteria 8062
264 Ga0400483_121666 3300039062 Bacteria 18159
265 Ga0400483_145565 3300039062 Bacteria 12981
266 Ga0400483_179405 3300039062 Bacteria 2925
267 Ga0400483_192031 3300039062 Bacteria 23073
268 Ga0400483_241642 3300039062 Bacteria 19322
269 Ga0400483_268051 3300039062 Bacteria 17073
270 Ga0400487_01458 3300039110 Bacteria 5704
271 Ga0400487_19502 3300039110 Bacteria 1877
272 Ga0400487_24806 3300039110 Bacteria 35141
273 Ga0436365_1054781 3300039437 Bacteria 2190
274 Ga0436361_0007468 3300039447 Bacteria 5122
275 Ga0436361_0746584 3300039447 Bacteria 9390
276 Ga0436361_1124174 3300039447 Bacteria 21478
277 Ga0439448_0004190 3300042005 Bacteria 4060
278 Ga0451577_0000002 3300042876 Bacteria 1731375
279 Ga0451577_0000319 3300042876 Bacteria 90564
280 Ga0451577_0023500 3300042876 Bacteria 5621
281 Ga0451577_0045119 3300042876 Bacteria 3946
282 Ga0451577_0117675 3300042876 Bacteria 2380
283 Ga0466969_0000297 3300044656 Bacteria 27202
284 Ga0466969_0014342 3300044656 Bacteria 4165
285 Ga0466969_0029521 3300044656 Bacteria 2799
286 Ga0466977_0001674 3300044666 Bacteria 9434
287 Ga0453683_0000003 3300044673 Bacteria 942572
288 Ga0453683_0021694 3300044673 Bacteria 4098
289 Ga0466965_0001551 3300044683 Bacteria 9348
290 Ga0466966_0000084 3300044684 Bacteria 58535
291 Ga0466966_0007478 3300044684 Bacteria 7239
292 Ga0466966_0009017 3300044684 Bacteria 6610
293 Ga0466966_0024377 3300044684 Bacteria 3958
294 Ga0466966_0069537 3300044684 Bacteria 2208
295 Ga0466961_0000567 3300044693 Bacteria 23500
296 Ga0466961_0009347 3300044693 Bacteria 6244
297 Ga0466961_0031147 3300044693 Bacteria 3428
298 Ga0466961_0076667 3300044693 Bacteria 2118
299 Ga0466963_0001538 3300044694 Bacteria 12494
300 Ga0466963_0018644 3300044694 Bacteria 4343
301 Ga0466964_0001157 3300044706 Bacteria 8921
302 Ga0453684_0000002 3300044712 Bacteria 1731375
303 Ga0453684_0000075 3300044712 Bacteria 437715
304 Ga0453684_0012407 3300044712 Bacteria 14056
305 Ga0453684_0018401 3300044712 Bacteria 10724
306 Ga0453684_0053791 3300044712 Bacteria 5252
307 Ga0466971_0001519 3300044719 Bacteria 9782
308 Ga0466968_0059491 3300044735 Bacteria 1646
309 Ga0466970_0019669 3300044765 Bacteria 3502
310 Ga0466970_0064372 3300044765 Bacteria 1966
311 Ga0466957_0002457 3300044842 Bacteria 9948
312 Ga0466957_0005149 3300044842 Bacteria 7309
313 Ga0466957_0032769 3300044842 Bacteria 3113
314 Ga0466957_0071889 3300044842 Bacteria 2140
315 Ga0466960_0024840 3300044901 Bacteria 2707
316 Ga0466959_0000802 3300045049 Bacteria 18513
317 Ga0466959_0003739 3300045049 Bacteria 10061
318 Ga0466959_0008983 3300045049 Bacteria 7087
319 Ga0466959_0021302 3300045049 Bacteria 4779
320 Ga0451576_0000004 3300045051 Bacteria 1312238
321 Ga0451576_0000029 3300045051 Bacteria 404449
322 Ga0451576_0000250 3300045051 Bacteria 132101
323 Ga0451576_0001615 3300045051 Bacteria 37836
324 Ga0451576_0005294 3300045051 Bacteria 16219
325 Ga0451576_0011555 3300045051 Bacteria 10017
326 Ga0451576_0012005 3300045051 Bacteria 9782
327 Ga0451576_0012462 3300045051 Bacteria 9546
328 Ga0451576_0038365 3300045051 Bacteria 5070
329 Ga0466958_0000254 3300045836 Bacteria 20704
330 Ga0466958_0000731 3300045836 Bacteria 14358
331 Ga0466967_0186318 3300045976 Bacteria 1960
332 Ga0495592_0017875 3300046454 Bacteria 5390
333 Ga0495603_0004961 3300046455 Bacteria 7963
334 Ga0495590_0009596 3300046457 Bacteria 3671
335 Ga0495629_0024830 3300046459 Bacteria 4264
336 Ga0495638_0002053 3300046460 Bacteria 17098
337 Ga0495638_0054738 3300046460 Bacteria 2479
338 Ga0495651_0034283 3300046462 Bacteria 3957
339 Ga0495651_0091675 3300046462 Bacteria 2278
340 Ga0495653_0094116 3300046463 Bacteria 2184
341 Ga0495650_0000224 3300046471 Bacteria 118058
342 Ga0495650_0003457 3300046471 Bacteria 11513
343 Ga0495650_0034042 3300046471 Bacteria 2260
344 Ga0495650_0037541 3300046471 Bacteria 2107
345 Ga0495650_0039439 3300046471 Bacteria 2038
346 Ga0495580_0016071 3300046472 Bacteria 5625
347 Ga0495605_0039456 3300046474 Bacteria 2365
348 Ga0495664_0060004 3300046477 Bacteria 2264
349 Ga0495664_0099369 3300046477 Bacteria 1752
350 Ga0495584_0053090 3300046491 Bacteria 2040
351 Ga0495607_0031805 3300046501 Bacteria 3228
352 Ga0495583_0012474 3300046506 Bacteria 4804
353 Ga0495606_0015445 3300046507 Bacteria 5881
354 Ga0495606_0145331 3300046507 Bacteria 1397
355 Ga0495628_0095529 3300046516 Bacteria 2296
356 Ga0495630_0302180 3300046517 Bacteria 1223
357 Ga0495652_0080614 3300046529 Bacteria 2688
358 Ga0495654_0000428 3300046530 Bacteria 35538
359 Ga0495654_0030825 3300046530 Bacteria 2726
360 Ga0495665_0050918 3300046531 Bacteria 2194
361 Ga0495586_0056560 3300046535 Bacteria 2128
362 Ga0495586_0111805 3300046535 Bacteria 1521
363 Ga0495587_0006632 3300046536 Bacteria 7540
364 Ga0495609_0019834 3300046538 Bacteria 3109
365 Ga0495621_0003224 3300046539 Bacteria 4481
366 Ga0495621_0010869 3300046539 Bacteria 2799
367 Ga0495597_0004490 3300046542 Bacteria 7649
368 Ga0495645_0004194 3300046543 Bacteria 9855
369 Ga0495645_0013820 3300046543 Bacteria 5720
370 Ga0495645_0020676 3300046543 Bacteria 4752
371 Ga0495645_0081925 3300046543 Bacteria 2314
372 Ga0495645_0089437 3300046543 Bacteria 2202
373 Ga0495622_0001676 3300046557 Bacteria 10959
374 Ga0495667_0008494 3300046559 Bacteria 6971
375 Ga0495611_0019128 3300046648 Bacteria 2941
376 Ga0495625_0099965 3300046660 Bacteria 1994
377 Ga0495635_0118106 3300046663 Bacteria 1810
378 Ga0495657_0060592 3300046675 Bacteria 2507
379 Ga0495599_0044046 3300046678 Bacteria 2799
380 Ga0495623_0080470 3300046679 Bacteria 2016
381 Ga0495669_0006587 3300046684 Bacteria 4856
382 Ga0495669_0032792 3300046684 Bacteria 2284
383 Ga0495624_0040024 3300046690 Bacteria 3003
384 Ga0495624_0080393 3300046690 Bacteria 2019
385 Ga0495670_0003239 3300046691 Bacteria 8016
386 Ga0495671_0005413 3300046692 Bacteria 7472
387 Ga0495671_0020374 3300046692 Bacteria 3495
388 Ga0495649_0035118 3300046694 Bacteria 2757
389 Ga0495589_0006457 3300046794 Bacteria 6182
390 Ga0495600_0080517 3300046809 Bacteria 2126
391 Ga0495660_0042286 3300046810 Bacteria 2519
392 Ga0495581_0036259 3300047315 Bacteria 2853
393 Ga0495604_0025792 3300047317 Bacteria 4681
394 Ga0495674_0058466 3300047319 Bacteria 3370
395 Ga0495674_0142085 3300047319 Bacteria 2017
396 Ga0495680_0033291 3300047322 Bacteria 4174
397 Ga0495680_0095292 3300047322 Bacteria 2225
398 Ga0495683_0005181 3300047323 Bacteria 7261
399 Ga0495687_001154 3300047443 Bacteria 25585
400 Ga0495675_0038381 3300047444 Bacteria 3049
401 Ga0495675_0090023 3300047444 Bacteria 1926
402 Ga0495679_000102 3300047446 Bacteria 76337
403 Ga0495684_0081603 3300047471 Bacteria 2454
404 Ga0495686_0000002 3300047472 Bacteria 1050777
405 Ga0495686_0068900 3300047472 Bacteria 2182
406 Ga0495593_0030003 3300047673 Bacteria 2978
407 Ga0495593_0038870 3300047673 Bacteria 2568
408 Ga0495593_0046238 3300047673 Bacteria 2320
409 Ga0495614_0037940 3300048089 Bacteria 2068
410 Ga0495614_0067220 3300048089 Bacteria 1543
411 Ga0495626_0013534 3300048091 Bacteria 4237
412 Ga0496100_0003455 3300048903 Bacteria 8240
413 Ga0496100_0058050 3300048903 Bacteria 2538
414 Ga0496101_0003813 3300048904 Bacteria 9419
415 Ga0496101_0201261 3300048904 Bacteria 1540
416 Ga0496102_0003091 3300048905 Bacteria 14107
417 Ga0496102_0263983 3300048905 Bacteria 1623
418 Ga0496103_0001420 3300048906 Bacteria 16051
419 Ga0496104_0187250 3300048907 Bacteria 1981
420 Ga0496105_0138088 3300048908 Bacteria 2007
421 Ga0496106_0001077 3300048909 Bacteria 20151
422 Ga0496106_0027324 3300048909 Bacteria 4250
423 Ga0496106_0059256 3300048909 Bacteria 2900
424 Ga0496107_0116147 3300048910 Bacteria 1970
425 Ga0496109_0126523 3300048912 Bacteria 2383
426 Ga0496109_0214428 3300048912 Bacteria 1810
427 Ga0496110_0000457 3300048913 Bacteria 27743
428 Ga0496110_0032191 3300048913 Bacteria 4527
429 Ga0496111_0009434 3300048914 Bacteria 6513
430 Ga0496111_0082443 3300048914 Bacteria 2349
431 Ga0496111_0082732 3300048914 Bacteria 2345
432 Ga0496112_0010133 3300048915 Bacteria 8537
433 Ga0496113_0001720 3300048916 Bacteria 12380
434 Ga0496114_0009017 3300048917 Bacteria 7906
435 Ga0496114_0290531 3300048917 Bacteria 1442
436 Ga0496115_0034553 3300048918 Bacteria 3996
437 Ga0496116_0039696 3300048919 Bacteria 3250
438 Ga0496117_0005730 3300048920 Bacteria 12910
439 Ga0496117_0012388 3300048920 Bacteria 7524
440 Ga0496117_0070837 3300048920 Bacteria 2339
441 Ga0496118_0001989 3300048921 Bacteria 29022
442 Ga0496118_0005512 3300048921 Bacteria 14361
443 Ga0496118_0063179 3300048921 Bacteria 2725
444 Ga0496121_0003420 3300048924 Bacteria 22697
445 Ga0496121_0074975 3300048924 Bacteria 2704
446 Ga0496121_0099771 3300048924 Bacteria 2243
447 Ga0496122_0004586 3300048925 Bacteria 17012
448 Ga0496123_0015693 3300048926 Bacteria 6197
449 Ga0496124_0001916 3300048927 Bacteria 28536
450 Ga0496126_0002042 3300048929 Bacteria 28406
451 Ga0466983_0196272 3300048986 Bacteria 1612
452 Ga0495678_026175 3300049459 Bacteria 2494
453 Ga0501039_0030275 3300049575 Bacteria 4173
454 Ga0501039_0068019 3300049575 Bacteria 2766
455 Ga0501039_0158298 3300049575 Bacteria 1780
456 Ga0501042_0198529 3300049578 Bacteria 1447
457 Ga0501043_0000141 3300049579 Bacteria 67326
458 Ga0501046_0000047 3300049580 Bacteria 140344
459 Ga0501047_0000058 3300049581 Bacteria 139202
460 Ga0501048_0000475 3300049582 Bacteria 28030
461 Ga0501067_0043438 3300049583 Bacteria 2496
462 Ga0501070_0000612 3300049586 Bacteria 32731
463 Ga0501070_0003856 3300049586 Bacteria 12935
464 Ga0501070_0175917 3300049586 Bacteria 1762
465 Ga0501071_0056146 3300049587 Bacteria 2843
466 Ga0501073_0001654 3300049589 Bacteria 16525
467 Ga0501074_0000811 3300049590 Bacteria 19770
468 Ga0501074_0001507 3300049590 Bacteria 15711
469 Ga0501076_0026193 3300049592 Bacteria 4514
470 Ga0501079_0030446 3300049741 Bacteria 4146
471 Ga0501080_0008750 3300049742 Bacteria 9193
472 Ga0501080_0024443 3300049742 Bacteria 5599
473 Ga0501080_0032837 3300049742 Bacteria 4842
474 Ga0501080_0114349 3300049742 Bacteria 2502
475 Ga0501083_0002111 3300049744 Bacteria 13636
476 Ga0501280_000375 3300049776 Bacteria 10946
477 Ga0501045_0015906 3300049824 Bacteria 5337
478 nmdc:mga0k408_24582_c1 3300050493 Bacteria 3406
479 nmdc:mga0k408_380_c2 3300050493 Bacteria 20523
480 nmdc:mga09592_1274_c1 3300050508 Bacteria 13551
481 nmdc:mga0qj67_81220_c1 3300050509 Bacteria 2599
482 nmdc:mga06r32_18433_c1 3300050510 Bacteria 6390
483 nmdc:mga06r32_28961_c1 3300050510 Bacteria 5185
484 nmdc:mga08y16_65551_c1 3300050511 Bacteria 3791
485 nmdc:mga0n895_126170_c1 3300050512 Bacteria 2583
486 nmdc:mga08x19_5866_c1 3300050514 Bacteria 7268
487 Ga0500618_000976 3300053125 Bacteria 14500
488 Ga0500636_0000185 3300053177 Bacteria 33554
489 Ga0500625_002765 3300053729 Bacteria 6694
490 Ga0501084_0023535 3300054114 Bacteria 5139
491 Ga0501084_0229158 3300054114 Bacteria 1568
492 Ga0501082_0017124 3300060353 Bacteria 6244
493 Ga0466962_0000537 3300061719 Bacteria 16663
494 Ga0466962_0000675 3300061719 Bacteria 15172
495 Ga0466962_0022586 3300061719 Bacteria 3023
496 Ga0466962_0032196 3300061719 Bacteria 2510
497 2904438564 2904434214 Bacteria 6230908
498 2501070247 2501025501 Bacteria 7768574
499 2515689942 2515154123 Bacteria 6387382
500 2519459056 2519103095 Bacteria 6629912
501 2526213521 2526164512 Bacteria 4025691
502 2574432049 2574179768 Bacteria 4907129
503 2585291426 2582581311 Bacteria 6763856
504 2599736660 2599185239 Bacteria 8686614
505 2599744714 2599185240 Bacteria 7968121
506 2600205925 2599185355 Bacteria 7968906
507 2600809460 2600255067 Bacteria 6795583
508 2676742841 2675903129 Bacteria 7964495
509 2723877468 2721755763 Bacteria 4464185
510 2735818237 2734482258 Unclassified 2930739
511 2792835945 2791355137 Bacteria 9654227
512 2808972397 2808606384 Bacteria 8474373
513 2809007226 2808606390 Bacteria 8476311
514 2809014364 2808606391 Bacteria 8308166
515 2817261346 2816332253 Bacteria 6764532
516 2817279023 2816332256 Bacteria 6891714
517 2817451253 2816332286 Bacteria 6853759
518 2819631144 2818991452 Bacteria 8442785
519 2856290452 2856287931 Bacteria 7223934
520 2857363329 2857357740 Bacteria 9937880
521 2863424754 2863421361 Bacteria 7300805
522 2870070990 2870068957 Bacteria 8925310
523 2883092935 2883087390 Bacteria 9532701
524 2891634585 2891633521 Bacteria 4602265
525 2904570983 2904564687 Bacteria 7609577
526 2904575967 2904571731 Bacteria 7608790
527 2928160055 2928157003 Bacteria 7522202
528 2928168494 2928163908 Bacteria 7561269
529 2928171738 2928170801 Bacteria 8785406
530 2928539894 2928536128 Bacteria 7657547
531 2981994791 2981990288 Bacteria 7590678
532 639787050 639633007 Bacteria 4376040
533 642416875 641736154 Bacteria 7689995
534 8018851378 8018845410 Bacteria 8933938
535 8020810190 8020807995 Bacteria 6801506
536 8020945032 8020938398 Bacteria 7472757
537 8020951710 8020945358 Bacteria 8467355
538 8020956931 8020953355 Bacteria 7439080
539 8021122215 8021120328 Bacteria 8782274
540 8039102540 8039098773 Bacteria 6602928
541 8040168805 8040167225 Bacteria 6542727
542 8040174731 8040173305 Bacteria 6827067
543 JGI24735J21928_10000873
544 JGI24735J21928_10001265
545 Ga0055532_1003986
546 Ga0055527_1001753
547 Ga0055527_1001754
548 Ga0055535_1003659
549 Ga0055535_1003660
550 Ga0055542_1003532
551 Ga0055542_1003533
552 Ga0055529_1001476
553 Ga0055541_1007513
554 Ga0065704_10127221
555 Ga0070658_10002393
556 Ga0070658_10011021
557 Ga0070658_10059779
558 Ga0070658_10156923
559 Ga0070683_100070791
560 Ga0070670_100006956
561 Ga0070677_10015794
562 Ga0068869_100003904
563 Ga0068869_100025411
564 Ga0070666_10052439
565 Ga0068868_100035264
566 Ga0070660_100000504
567 Ga0070660_100001298
568 Ga0070661_100029621
569 Ga0070661_100102132
570 Ga0070675_100021815
571 Ga0070675_100044998
572 Ga0070671_100027234
573 Ga0070673_100005910
574 Ga0070673_100025823
575 Ga0070659_100000096
576 Ga0070667_100148267
577 Ga0070714_100051697
578 Ga0070713_100087693
579 Ga0070663_100002692
580 Ga0070678_100008537
581 Ga0070681_10016840
582 Ga0070681_10052589
583 Ga0068867_100151413
584 Ga0070684_100184485
585 Ga0068853_100008688
586 Ga0068853_100013155
587 Ga0068853_100203455
588 Ga0070672_100010363
589 Ga0070693_100011277
590 Ga0070693_100047823
591 Ga0070665_100054800
592 Ga0070665_100099519
593 Ga0068855_100010957
594 Ga0068855_100019484
595 Ga0068855_100019488
596 Ga0068855_100020921
597 Ga0068855_100148799
598 Ga0070664_100049898
599 Ga0068854_100078468
600 Ga0068856_100079495
601 Ga0068852_100005797
602 Ga0068859_100198246
603 Ga0068859_100253645
604 Ga0068866_10059311
605 Ga0068851_10020503
606 Ga0068870_10052284
607 Ga0068870_10061437
608 Ga0068863_100030839
609 Ga0068863_100073057
610 Ga0068858_100032267
611 Ga0068858_100082743
612 Ga0068862_100039651
613 Ga0070717_10130248
614 Ga0075369_10002482
615 Ga0075366_10003539
616 Ga0097621_100003683
617 Ga0097621_100014887
618 Ga0068871_100016562
619 Ga0068871_100019776
620 Ga0068871_100048150
621 Ga0068871_100160874
622 Ga0075428_100000245
623 Ga0075430_100020343
624 Ga0075430_100056022
625 Ga0075431_100003069
626 Ga0075431_100034097
627 Ga0075434_100041481
628 Ga0075429_100008747
629 Ga0075436_100008048
630 Ga0097620_100198243
631 Ga0097620_100253647
632 Ga0099794_10053454
633 Ga0105251_10001119
634 Ga0105240_10001770
635 Ga0105240_10059340
636 Ga0111539_10000383
637 Ga0111539_10080582
638 Ga0105245_10086042
639 Ga0105245_10164908
640 Ga0105243_10000770
641 Ga0105243_10026412
642 Ga0105243_10116079
643 Ga0105241_10017067
644 Ga0105242_10049912
645 Ga0105248_10002407
646 Ga0105248_10058954
647 Ga0105248_10137513
648 Ga0105237_10005766
649 Ga0105238_10001068
650 Ga0105238_10014298
651 Ga0105238_10078193
652 Ga0105249_10144621
653 Ga0105239_10002463
654 Ga0105239_10003884
655 Ga0105239_10007605
656 Ga0105239_10069989
657 Ga0157373_10006985
658 Ga0157373_10083475
659 Ga0157371_10007279
660 Ga0157370_10007952
661 Ga0157370_10008261
662 Ga0157370_10157383
663 Ga0157369_10000511
664 Ga0157369_10000979
665 Ga0157369_10002197
666 Ga0157369_10091577
667 Ga0157369_10246458
668 Ga0157374_10000107
669 Ga0157374_10031938
670 Ga0157374_10127586
671 Ga0157378_10063541
672 Ga0157378_10097337
673 Ga0157378_10169632
674 Ga0163162_10006481
675 Ga0157372_10002854
676 Ga0157372_10128119
677 Ga0157372_10129037
678 Ga0157372_10415704
679 Ga0157375_10023805
680 Ga0157375_10028549
681 Ga0157375_10069517
682 Ga0157375_10173663
683 Ga0157380_10210633
684 Ga0157376_10011903
685 Ga0157376_10040685
686 Ga0157376_10151166
687 Ga0182006_1033937
688 Ga0182007_10031403
689 Ga0182005_1020509
690 Ga0213872_10000003
691 Ga0209566_100559
692 Ga0209672_100014
693 Ga0209672_100023
694 Ga0209672_100433
695 Ga0209147_100094
696 Ga0209147_100104
697 Ga0209147_101808
698 Ga0209258_100040
699 Ga0209258_100142
700 Ga0209148_1000035
701 Ga0209759_1000030
702 Ga0209759_1011780
703 Ga0209455_1000072
704 Ga0209564_1004868
705 Ga0209257_1026844
706 Ga0207713_1002241
707 Ga0207682_10020088
708 Ga0207647_10000108
709 Ga0207647_10000498
710 Ga0207647_10036364
711 Ga0207643_10018307
712 Ga0207643_10084818
713 Ga0207705_10001472
714 Ga0207705_10010151
715 Ga0207654_10003311
716 Ga0207707_10145180
717 Ga0207695_10012800
718 Ga0207695_10026800
719 Ga0207695_10232992
720 Ga0207671_10008853
721 Ga0207662_10036199
722 Ga0207657_10000004
723 Ga0207657_10064846
724 Ga0207649_10022174
725 Ga0207694_10024852
726 Ga0207650_10023575
727 Ga0207687_10010562
728 Ga0207644_10017931
729 Ga0207690_10000015
730 Ga0207709_10005524
731 Ga0207691_10007106
732 Ga0207689_10000974
733 Ga0207661_10188261
734 Ga0207667_10002397
735 Ga0207667_10003025
736 Ga0207667_10005390
737 Ga0207667_10007177
738 Ga0207667_10097788
739 Ga0207651_10019003
740 Ga0207651_10040384
741 Ga0207640_10064246
742 Ga0207658_10066305
743 Ga0207677_10036089
744 Ga0207703_10030879
745 Ga0207703_10057411
746 Ga0207639_10048486
747 Ga0207639_10064507
748 Ga0207678_10001691
749 Ga0207678_10002079
750 Ga0207702_10031798
751 Ga0207702_10100141
752 Ga0207641_10068358
753 Ga0207648_10000142
754 Ga0207676_10104768
755 Ga0207683_10003576
756 Ga0207683_10187256
757 Ga0207698_10049953
758 Ga0209371_1000079
759 Ga0209981_1002317
760 Ga0209974_10006559
761 Ga0207428_10005311
762 Ga0268266_10020285
763 Ga0268266_10035234
764 Ga0268266_10185285
765 Ga0265336_10002632
766 Ga0265338_10000028
767 Ga0265338_10000741
768 Ga0265324_10000005
769 Ga0265324_10000205
770 Ga0265324_10014450
771 Ga0268256_1000090
772 Ga0265325_10000314
773 Ga0265331_10013109
774 Ga0265331_10017844
775 Ga0265327_10001032
776 Ga0265316_10108626
777 Ga0307408_100131321
778 Ga0307408_100167561
779 Ga0265314_10000740
780 Ga0316583_10013376
781 Ga0316593_10000190
782 Ga0373955_0042294
783 Ga0373937_0011712
784 Ga0373937_0090607
785 Ga0395899_0000007
786 Ga0395900_0000026
787 Ga0395900_0027856
788 Ga0395900_0044477
789 Ga0395898_0000497
790 Ga0395898_0001748
791 Ga0395905_0028009
792 Ga0395901_0000077
793 Ga0395901_0000296
794 Ga0395901_0000923
795 Ga0395901_0019691
796 Ga0400484_29948
797 Ga0400484_43627
798 Ga0400490_17851
799 Ga0400485_07894
800 Ga0400488_31176
801 Ga0400488_33004
802 Ga0400488_38891
803 Ga0400486_00233
804 Ga0400486_14851
805 Ga0400483_108358
806 Ga0400483_121666
807 Ga0400483_145565
808 Ga0400483_179405
809 Ga0400483_192031
810 Ga0400483_241642
811 Ga0400483_268051
812 Ga0400487_01458
813 Ga0400487_19502
814 Ga0400487_24806
815 Ga0436365_1054781
816 Ga0436361_0007468
817 Ga0436361_0746584
818 Ga0436361_1124174
819 Ga0439448_0004190
820 Ga0451577_0000002
821 Ga0451577_0000319
822 Ga0451577_0023500
823 Ga0451577_0045119
824 Ga0451577_0117675
825 Ga0466969_0000297
826 Ga0466969_0014342
827 Ga0466969_0029521
828 Ga0466977_0001674
829 Ga0453683_0000003
830 Ga0453683_0021694
831 Ga0466965_0001551
832 Ga0466966_0000084
833 Ga0466966_0007478
834 Ga0466966_0009017
835 Ga0466966_0024377
836 Ga0466966_0069537
837 Ga0466961_0000567
838 Ga0466961_0009347
839 Ga0466961_0031147
840 Ga0466961_0076667
841 Ga0466963_0001538
842 Ga0466963_0018644
843 Ga0466964_0001157
844 Ga0453684_0000002
845 Ga0453684_0000075
846 Ga0453684_0012407
847 Ga0453684_0018401
848 Ga0453684_0053791
849 Ga0466971_0001519
850 Ga0466968_0059491
851 Ga0466970_0019669
852 Ga0466970_0064372
853 Ga0466957_0002457
854 Ga0466957_0005149
855 Ga0466957_0032769
856 Ga0466957_0071889
857 Ga0466960_0024840
858 Ga0466959_0000802
859 Ga0466959_0003739
860 Ga0466959_0008983
861 Ga0466959_0021302
862 Ga0451576_0000004
863 Ga0451576_0000029
864 Ga0451576_0000250
865 Ga0451576_0001615
866 Ga0451576_0005294
867 Ga0451576_0011555
868 Ga0451576_0012005
869 Ga0451576_0012462
870 Ga0451576_0038365
871 Ga0466958_0000254
872 Ga0466958_0000731
873 Ga0466967_0186318
874 Ga0495592_0017875
875 Ga0495603_0004961
876 Ga0495590_0009596
877 Ga0495629_0024830
878 Ga0495638_0002053
879 Ga0495638_0054738
880 Ga0495651_0034283
881 Ga0495651_0091675
882 Ga0495653_0094116
883 Ga0495650_0000224
884 Ga0495650_0003457
885 Ga0495650_0034042
886 Ga0495650_0037541
887 Ga0495650_0039439
888 Ga0495580_0016071
889 Ga0495605_0039456
890 Ga0495664_0060004
891 Ga0495664_0099369
892 Ga0495584_0053090
893 Ga0495607_0031805
894 Ga0495583_0012474
895 Ga0495606_0015445
896 Ga0495606_0145331
897 Ga0495628_0095529
898 Ga0495630_0302180
899 Ga0495652_0080614
900 Ga0495654_0000428
901 Ga0495654_0030825
902 Ga0495665_0050918
903 Ga0495586_0056560
904 Ga0495586_0111805
905 Ga0495587_0006632
906 Ga0495609_0019834
907 Ga0495621_0003224
908 Ga0495621_0010869
909 Ga0495597_0004490
910 Ga0495645_0004194
911 Ga0495645_0013820
912 Ga0495645_0020676
913 Ga0495645_0081925
914 Ga0495645_0089437
915 Ga0495622_0001676
916 Ga0495667_0008494
917 Ga0495611_0019128
918 Ga0495625_0099965
919 Ga0495635_0118106
920 Ga0495657_0060592
921 Ga0495599_0044046
922 Ga0495623_0080470
923 Ga0495669_0006587
924 Ga0495669_0032792
925 Ga0495624_0040024
926 Ga0495624_0080393
927 Ga0495670_0003239
928 Ga0495671_0005413
929 Ga0495671_0020374
930 Ga0495649_0035118
931 Ga0495589_0006457
932 Ga0495600_0080517
933 Ga0495660_0042286
934 Ga0495581_0036259
935 Ga0495604_0025792
936 Ga0495674_0058466
937 Ga0495674_0142085
938 Ga0495680_0033291
939 Ga0495680_0095292
940 Ga0495683_0005181
941 Ga0495687_001154
942 Ga0495675_0038381
943 Ga0495675_0090023
944 Ga0495679_000102
945 Ga0495684_0081603
946 Ga0495686_0000002
947 Ga0495686_0068900
948 Ga0495593_0030003
949 Ga0495593_0038870
950 Ga0495593_0046238
951 Ga0495614_0037940
952 Ga0495614_0067220
953 Ga0495626_0013534
954 Ga0496100_0003455
955 Ga0496100_0058050
956 Ga0496101_0003813
957 Ga0496101_0201261
958 Ga0496102_0003091
959 Ga0496102_0263983
960 Ga0496103_0001420
961 Ga0496104_0187250
962 Ga0496105_0138088
963 Ga0496106_0001077
964 Ga0496106_0027324
965 Ga0496106_0059256
966 Ga0496107_0116147
967 Ga0496109_0126523
968 Ga0496109_0214428
969 Ga0496110_0000457
970 Ga0496110_0032191
971 Ga0496111_0009434
972 Ga0496111_0082443
973 Ga0496111_0082732
974 Ga0496112_0010133
975 Ga0496113_0001720
976 Ga0496114_0009017
977 Ga0496114_0290531
978 Ga0496115_0034553
979 Ga0496116_0039696
980 Ga0496117_0005730
981 Ga0496117_0012388
982 Ga0496117_0070837
983 Ga0496118_0001989
984 Ga0496118_0005512
985 Ga0496118_0063179
986 Ga0496121_0003420
987 Ga0496121_0074975
988 Ga0496121_0099771
989 Ga0496122_0004586
990 Ga0496123_0015693
991 Ga0496124_0001916
992 Ga0496126_0002042
993 Ga0466983_0196272
994 Ga0495678_026175
995 Ga0501039_0030275
996 Ga0501039_0068019
997 Ga0501039_0158298
998 Ga0501042_0198529
999 Ga0501043_0000141
1000 Ga0501046_0000047
1001 Ga0501047_0000058
1002 Ga0501048_0000475
1003 Ga0501067_0043438
1004 Ga0501070_0000612
1005 Ga0501070_0003856
1006 Ga0501070_0175917
1007 Ga0501071_0056146
1008 Ga0501073_0001654
1009 Ga0501074_0000811
1010 Ga0501074_0001507
1011 Ga0501076_0026193
1012 Ga0501079_0030446
1013 Ga0501080_0008750
1014 Ga0501080_0024443
1015 Ga0501080_0032837
1016 Ga0501080_0114349
1017 Ga0501083_0002111
1018 Ga0501280_000375
1019 Ga0501045_0015906
1020 nmdc:mga0k408_24582_c1
1021 nmdc:mga0k408_380_c2
1022 nmdc:mga09592_1274_c1
1023 nmdc:mga0qj67_81220_c1
1024 nmdc:mga06r32_18433_c1
1025 nmdc:mga06r32_28961_c1
1026 nmdc:mga08y16_65551_c1
1027 nmdc:mga0n895_126170_c1
1028 nmdc:mga08x19_5866_c1
1029 Ga0500618_000976
1030 Ga0500636_0000185
1031 Ga0500625_002765
1032 Ga0501084_0023535
1033 Ga0501084_0229158
1034 Ga0501082_0017124
1035 Ga0466962_0000537
1036 Ga0466962_0000675
1037 Ga0466962_0022586
1038 Ga0466962_0032196
1039 2904438564
1040 2501070247
1041 2515689942
1042 2519459056
1043 2526213521
1044 2574432049
1045 2585291426
1046 2599736660
1047 2599744714
1048 2600205925
1049 2600809460
1050 2676742841
1051 2723877468
1052 2735818237
1053 2792835945
1054 2808972397
1055 2809007226
1056 2809014364
1057 2817261346
1058 2817279023
1059 2817451253
1060 2819631144
1061 2856290452
1062 2857363329
1063 2863424754
1064 2870070990
1065 2883092935
1066 2891634585
1067 2904570983
1068 2904575967
1069 2928160055
1070 2928168494
1071 2928171738
1072 2928539894
1073 2981994791
1074 639787050
1075 642416875
1076 8018851378
1077 8020810190
1078 8020945032
1079 8020951710
1080 8020956931
1081 8021122215
1082 8039102540
1083 8040168805
1084 8040174731

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02163

Peptidase_M50

Peptidase family M50

6

492

0.98

PF17820

PDZ_6

PDZ domain

281

334

0.98

PF13180

PDZ_2

PDZ domain

266

344

0.91

PF00595

PDZ

PDZ domain

263

333

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xft-assembly1.cif.gz_A-2 mucp pdz2 domain 0.9501 234 316
5tnz-assembly1.cif.gz_A htra2 s142d mutant 0.9495 234 299
2zpm-assembly1.cif.gz_A crystal structure analysis of pdz domain b 0.9488 234 316
3id2-assembly1.cif.gz_B crystal structure of rsep pdz2 domain 0.9458 234 316
5fht-assembly1.cif.gz_A htra2 protease mutant v226k 0.9458 234 301
ID Description Score Start End Superfamily
af_A0A1D8PCD2_285_377_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9598 232 297 2.30.42.10
af_A0A0P0VNU6_285_398_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9583 234 296 2.30.42.10
af_A0A0R0HTR5_280_372_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9547 231 297 2.30.42.10
af_Q4E3N9_28_113_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9544 234 272 2.30.42.10
af_Q9P7S1_280_374_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9502 234 297 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A0B2C669-F1-model_v4 deleted 0.9668 327 457
AF-F0GIN3-F1-model_v4 Membrane-associated zinc metalloprotease 0.9568 1 132 GO:0004222
GO:0006508
GO:0016020
AF-A0A3C1TND1-F1-model_v4 RIP metalloprotease RseP 0.9553 326 458 GO:0004222
GO:0006508
GO:0016020
AF-A0A836P347-F1-model_v4 Zinc metalloprotease 0.955 334 457 GO:0004222
GO:0006508
GO:0016020
AF-F0GIN3-F1-model_v4 Membrane-associated zinc metalloprotease 0.9496 1 132 GO:0004222
GO:0006508
GO:0016020

Map