F461589
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 543 | 276 | 1086 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10091538|Ga0070681_100915383 |
| Length | 259 |
| Sequence | VTMRLLVTRPEPDNARTADTLRALGHDVLLAPMLRIEPVADADLGASCWSAVLLTSANGARAIAIHPRRDELLGLPLLAVGRGSAEAARDAGFVDVTSADGDARDLLRLASARFSGARKPLLYLAGEDRAADVAGALAERGMTVNTVVVYRATPAARFSVEVRVALQDRAVDGVLHFSRRSAEAYLACARDIVAASLAPVHYCLSARTAEPLQRAGAGRVEVALHPDEPHLLALIAAGTGGEAARPPAAMPKPRSNRLE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 81 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 82 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 129 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 130 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 131 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 133 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 134 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 135 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 136 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 139 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 140 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 141 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 145 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 148 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 151 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 153 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 159 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 164 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 165 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 166 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 167 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 168 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 169 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 211 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 212 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 213 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 214 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 215 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 218 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 219 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 220 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 221 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 222 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 223 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 224 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 252 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 253 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 254 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 255 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 256 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 257 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 258 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 268 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 269 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 270 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 271 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 274 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 275 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 276 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.26 |
| Metatranscriptomes | 0.18 |
| Isolates | 0.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.81 |
| Nodule | 0 |
| Rhizoplane | 8.29 |
| Rhizosphere | 83.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070681_10091538 | 3300005458 | Bacteria | 2991 |
| 2 | JGI25153J46596_10007254 | 3300003215 | Bacteria | 5483 |
| 3 | Ga0070658_10015046 | 3300005327 | Bacteria | 6193 |
| 4 | Ga0070676_10027631 | 3300005328 | Bacteria | 3219 |
| 5 | Ga0070676_10030041 | 3300005328 | Bacteria | 3096 |
| 6 | Ga0070690_100001691 | 3300005330 | Bacteria | 11625 |
| 7 | Ga0070670_100001662 | 3300005331 | Bacteria | 18037 |
| 8 | Ga0070670_100645431 | 3300005331 | Bacteria | 949 |
| 9 | Ga0068868_100504855 | 3300005338 | Bacteria | 1060 |
| 10 | Ga0070660_100134988 | 3300005339 | Bacteria | 1977 |
| 11 | Ga0070689_100009348 | 3300005340 | Bacteria | 6947 |
| 12 | Ga0070689_100043735 | 3300005340 | Bacteria | 3444 |
| 13 | Ga0070689_100060134 | 3300005340 | Bacteria | 2953 |
| 14 | Ga0070689_100372513 | 3300005340 | Bacteria | 1202 |
| 15 | Ga0070689_100464693 | 3300005340 | Bacteria | 1079 |
| 16 | Ga0070691_10183599 | 3300005341 | Bacteria | 1090 |
| 17 | Ga0070687_100060286 | 3300005343 | Bacteria | 2001 |
| 18 | Ga0070661_100270535 | 3300005344 | Unclassified | 1316 |
| 19 | Ga0070668_100169662 | 3300005347 | Bacteria | 1776 |
| 20 | Ga0070669_100329381 | 3300005353 | Bacteria | 1235 |
| 21 | Ga0070675_100354828 | 3300005354 | Bacteria | 1301 |
| 22 | Ga0070671_100016631 | 3300005355 | Bacteria | 5946 |
| 23 | Ga0070671_100132713 | 3300005355 | Bacteria | 2098 |
| 24 | Ga0070673_100003240 | 3300005364 | Bacteria | 10097 |
| 25 | Ga0070688_100214269 | 3300005365 | Bacteria | 1354 |
| 26 | Ga0070659_100121547 | 3300005366 | Bacteria | 2116 |
| 27 | Ga0070667_100014419 | 3300005367 | Bacteria | 6532 |
| 28 | Ga0070667_100041015 | 3300005367 | Bacteria | 3883 |
| 29 | Ga0070714_100284658 | 3300005435 | Bacteria | 1537 |
| 30 | Ga0070714_100288415 | 3300005435 | Bacteria | 1527 |
| 31 | Ga0070713_100255562 | 3300005436 | Bacteria | 1600 |
| 32 | Ga0070711_100132752 | 3300005439 | Bacteria | 1857 |
| 33 | Ga0070711_100675614 | 3300005439 | Bacteria | 868 |
| 34 | Ga0070663_100459300 | 3300005455 | Bacteria | 1051 |
| 35 | Ga0070678_100562282 | 3300005456 | Bacteria | 1014 |
| 36 | Ga0070662_100069036 | 3300005457 | Bacteria | 2600 |
| 37 | Ga0070681_10778334 | 3300005458 | Bacteria | 874 |
| 38 | Ga0068867_100061365 | 3300005459 | Bacteria | 2791 |
| 39 | Ga0070679_100034450 | 3300005530 | Bacteria | 5018 |
| 40 | Ga0070679_100290352 | 3300005530 | Unclassified | 1587 |
| 41 | Ga0068853_100316570 | 3300005539 | Bacteria | 1446 |
| 42 | Ga0070672_100091436 | 3300005543 | Bacteria | 2455 |
| 43 | Ga0070672_100097836 | 3300005543 | Bacteria | 2376 |
| 44 | Ga0070686_100128546 | 3300005544 | Bacteria | 1749 |
| 45 | Ga0070686_100242089 | 3300005544 | Unclassified | 1314 |
| 46 | Ga0070695_100112737 | 3300005545 | Bacteria | 1848 |
| 47 | Ga0070693_100116318 | 3300005547 | Bacteria | 1653 |
| 48 | Ga0070665_100213607 | 3300005548 | Unclassified | 1930 |
| 49 | Ga0070665_100268625 | 3300005548 | Bacteria | 1707 |
| 50 | Ga0068855_100120529 | 3300005563 | Bacteria | 3002 |
| 51 | Ga0068855_100258605 | 3300005563 | Bacteria | 1940 |
| 52 | Ga0070664_100515418 | 3300005564 | Bacteria | 1103 |
| 53 | Ga0068856_100163679 | 3300005614 | Bacteria | 2236 |
| 54 | Ga0068856_100246597 | 3300005614 | Unclassified | 1801 |
| 55 | Ga0068856_100440857 | 3300005614 | Bacteria | 1323 |
| 56 | Ga0068852_100041929 | 3300005616 | Bacteria | 3872 |
| 57 | Ga0068852_100043915 | 3300005616 | Bacteria | 3793 |
| 58 | Ga0068852_100064399 | 3300005616 | Bacteria | 3195 |
| 59 | Ga0068859_100211240 | 3300005617 | Bacteria | 2027 |
| 60 | Ga0068859_100369839 | 3300005617 | Bacteria | 1529 |
| 61 | Ga0068861_100056223 | 3300005719 | Bacteria | 3003 |
| 62 | Ga0068861_100330288 | 3300005719 | Bacteria | 1331 |
| 63 | Ga0068870_10117007 | 3300005840 | Bacteria | 1530 |
| 64 | Ga0068858_100104955 | 3300005842 | Bacteria | 2637 |
| 65 | Ga0068860_100198400 | 3300005843 | Bacteria | 1944 |
| 66 | Ga0068860_100408684 | 3300005843 | Bacteria | 1344 |
| 67 | Ga0068860_100859950 | 3300005843 | Unclassified | 922 |
| 68 | Ga0068862_100202600 | 3300005844 | Bacteria | 1790 |
| 69 | Ga0081539_10010883 | 3300005985 | Bacteria | 7306 |
| 70 | Ga0081539_10015864 | 3300005985 | Bacteria | 5434 |
| 71 | Ga0070717_10029553 | 3300006028 | Bacteria | 4397 |
| 72 | Ga0070717_10342273 | 3300006028 | Unclassified | 1336 |
| 73 | Ga0070717_10368431 | 3300006028 | Bacteria | 1287 |
| 74 | Ga0075365_10051928 | 3300006038 | Bacteria | 2709 |
| 75 | Ga0075368_10001545 | 3300006042 | Bacteria | 7380 |
| 76 | Ga0075368_10013543 | 3300006042 | Bacteria | 2996 |
| 77 | Ga0075363_100051142 | 3300006048 | Bacteria | 2203 |
| 78 | Ga0075363_100109344 | 3300006048 | Bacteria | 1535 |
| 79 | Ga0075364_10557367 | 3300006051 | Bacteria | 783 |
| 80 | Ga0070712_100016450 | 3300006175 | Bacteria | 4779 |
| 81 | Ga0070712_100208184 | 3300006175 | Bacteria | 1541 |
| 82 | Ga0075367_10001726 | 3300006178 | Bacteria | 9563 |
| 83 | Ga0075367_10001884 | 3300006178 | Bacteria | 9280 |
| 84 | Ga0075367_10013375 | 3300006178 | Bacteria | 4410 |
| 85 | Ga0075367_10262012 | 3300006178 | Unclassified | 1085 |
| 86 | Ga0075367_10304101 | 3300006178 | Bacteria | 1004 |
| 87 | Ga0075366_10019753 | 3300006195 | Bacteria | 3904 |
| 88 | Ga0075366_10160596 | 3300006195 | Unclassified | 1362 |
| 89 | Ga0075366_10347224 | 3300006195 | Bacteria | 910 |
| 90 | Ga0075370_10020682 | 3300006353 | Bacteria | 3600 |
| 91 | Ga0075428_100013925 | 3300006844 | Bacteria | 8956 |
| 92 | Ga0075428_100190104 | 3300006844 | Bacteria | 2221 |
| 93 | Ga0075430_100042618 | 3300006846 | Bacteria | 3838 |
| 94 | Ga0075431_100013846 | 3300006847 | Bacteria | 8146 |
| 95 | Ga0075433_10005783 | 3300006852 | Bacteria | 9734 |
| 96 | Ga0075429_100086069 | 3300006880 | Bacteria | 2739 |
| 97 | Ga0097620_100211248 | 3300006931 | Bacteria | 2027 |
| 98 | Ga0097620_100369785 | 3300006931 | Bacteria | 1529 |
| 99 | Ga0111539_10017172 | 3300009094 | Bacteria | 8958 |
| 100 | Ga0111539_10042912 | 3300009094 | Bacteria | 5427 |
| 101 | Ga0111539_10755945 | 3300009094 | Bacteria | 1131 |
| 102 | Ga0105245_10084018 | 3300009098 | Bacteria | 2915 |
| 103 | Ga0105245_10312728 | 3300009098 | Bacteria | 1545 |
| 104 | Ga0105245_10444159 | 3300009098 | Unclassified | 1304 |
| 105 | Ga0105245_10929888 | 3300009098 | Bacteria | 912 |
| 106 | Ga0105247_10185915 | 3300009101 | Bacteria | 1389 |
| 107 | Ga0114129_10024191 | 3300009147 | Bacteria | 8608 |
| 108 | Ga0114129_11083707 | 3300009147 | Bacteria | 1004 |
| 109 | Ga0105242_10438371 | 3300009176 | Bacteria | 1228 |
| 110 | Ga0105248_10460400 | 3300009177 | Unclassified | 1434 |
| 111 | Ga0105238_10043594 | 3300009551 | Bacteria | 4539 |
| 112 | Ga0105238_10636455 | 3300009551 | Unclassified | 1076 |
| 113 | Ga0099796_10065414 | 3300010159 | Bacteria | 1300 |
| 114 | Ga0105239_11166055 | 3300010375 | Bacteria | 887 |
| 115 | Ga0105246_10151474 | 3300011119 | Bacteria | 1756 |
| 116 | Ga0163162_10144158 | 3300013306 | Unclassified | 2497 |
| 117 | Ga0163162_10178574 | 3300013306 | Unclassified | 2249 |
| 118 | Ga0157375_10278863 | 3300013308 | Bacteria | 1834 |
| 119 | Ga0157375_10466928 | 3300013308 | Bacteria | 1427 |
| 120 | Ga0157375_10590643 | 3300013308 | Unclassified | 1270 |
| 121 | Ga0163163_10029817 | 3300014325 | Bacteria | 5250 |
| 122 | Ga0163163_10286236 | 3300014325 | Bacteria | 1700 |
| 123 | Ga0163163_10753483 | 3300014325 | Bacteria | 1037 |
| 124 | Ga0157380_10178831 | 3300014326 | Bacteria | 1862 |
| 125 | Ga0157380_10386758 | 3300014326 | Bacteria | 1322 |
| 126 | Ga0157377_10181534 | 3300014745 | Unclassified | 1324 |
| 127 | Ga0157379_10395949 | 3300014968 | Bacteria | 1269 |
| 128 | Ga0157376_10236429 | 3300014969 | Bacteria | 1700 |
| 129 | Ga0163161_10045315 | 3300017792 | Bacteria | 3171 |
| 130 | Ga0206353_11628533 | 3300020082 | Unclassified | 959 |
| 131 | Ga0213876_10172859 | 3300021384 | Bacteria | 1150 |
| 132 | Ga0228598_1026186 | 3300024227 | Bacteria | 1147 |
| 133 | Ga0209758_1000351 | 3300025297 | Bacteria | 83626 |
| 134 | Ga0207692_10145176 | 3300025898 | Bacteria | 1353 |
| 135 | Ga0207680_10392696 | 3300025903 | Unclassified | 980 |
| 136 | Ga0207699_10161596 | 3300025906 | Bacteria | 1491 |
| 137 | Ga0207645_10029552 | 3300025907 | Bacteria | 3532 |
| 138 | Ga0207705_10010088 | 3300025909 | Bacteria | 6876 |
| 139 | Ga0207693_10215483 | 3300025915 | Bacteria | 1509 |
| 140 | Ga0207663_10217780 | 3300025916 | Bacteria | 1387 |
| 141 | Ga0207657_10118280 | 3300025919 | Bacteria | 2181 |
| 142 | Ga0207657_10304705 | 3300025919 | Bacteria | 1262 |
| 143 | Ga0207657_10397286 | 3300025919 | Bacteria | 1084 |
| 144 | Ga0207649_10224857 | 3300025920 | Unclassified | 1339 |
| 145 | Ga0207652_10009939 | 3300025921 | Bacteria | 7659 |
| 146 | Ga0207652_10060781 | 3300025921 | Bacteria | 3260 |
| 147 | Ga0207652_10424670 | 3300025921 | Bacteria | 1199 |
| 148 | Ga0207681_10081945 | 3300025923 | Bacteria | 2279 |
| 149 | Ga0207681_10173933 | 3300025923 | Bacteria | 1634 |
| 150 | Ga0207681_10328747 | 3300025923 | Unclassified | 1218 |
| 151 | Ga0207694_10062573 | 3300025924 | Bacteria | 2897 |
| 152 | Ga0207694_10298245 | 3300025924 | Unclassified | 1327 |
| 153 | Ga0207650_10224092 | 3300025925 | Bacteria | 1514 |
| 154 | Ga0207687_10153979 | 3300025927 | Bacteria | 1757 |
| 155 | Ga0207664_10162167 | 3300025929 | Bacteria | 1907 |
| 156 | Ga0207644_10000776 | 3300025931 | Bacteria | 20251 |
| 157 | Ga0207709_10356994 | 3300025935 | Bacteria | 1105 |
| 158 | Ga0207670_10003308 | 3300025936 | Bacteria | 8541 |
| 159 | Ga0207670_10011845 | 3300025936 | Bacteria | 5078 |
| 160 | Ga0207670_10038338 | 3300025936 | Bacteria | 3129 |
| 161 | Ga0207669_10008411 | 3300025937 | Bacteria | 4844 |
| 162 | Ga0207669_10292018 | 3300025937 | Bacteria | 1235 |
| 163 | Ga0207691_10111651 | 3300025940 | Bacteria | 2430 |
| 164 | Ga0207691_10136589 | 3300025940 | Bacteria | 2162 |
| 165 | Ga0207711_10272457 | 3300025941 | Bacteria | 1557 |
| 166 | Ga0207661_10100140 | 3300025944 | Unclassified | 2432 |
| 167 | Ga0207667_10038306 | 3300025949 | Bacteria | 5122 |
| 168 | Ga0207667_10121395 | 3300025949 | Bacteria | 2692 |
| 169 | Ga0207667_10768047 | 3300025949 | Bacteria | 962 |
| 170 | Ga0207651_10187848 | 3300025960 | Bacteria | 1645 |
| 171 | Ga0207668_10150121 | 3300025972 | Bacteria | 1803 |
| 172 | Ga0207658_10294031 | 3300025986 | Bacteria | 1397 |
| 173 | Ga0207677_10131513 | 3300026023 | Bacteria | 1901 |
| 174 | Ga0207703_10064554 | 3300026035 | Bacteria | 3006 |
| 175 | Ga0207639_10346759 | 3300026041 | Bacteria | 1325 |
| 176 | Ga0207678_10803515 | 3300026067 | Unclassified | 830 |
| 177 | Ga0207708_10311077 | 3300026075 | Bacteria | 1283 |
| 178 | Ga0207702_10063575 | 3300026078 | Bacteria | 3156 |
| 179 | Ga0207702_10217150 | 3300026078 | Unclassified | 1780 |
| 180 | Ga0207702_10271915 | 3300026078 | Bacteria | 1598 |
| 181 | Ga0207648_10052087 | 3300026089 | Bacteria | 3579 |
| 182 | Ga0207648_10084112 | 3300026089 | Bacteria | 2775 |
| 183 | Ga0207676_10034980 | 3300026095 | Bacteria | 3808 |
| 184 | Ga0207675_100479016 | 3300026118 | Bacteria | 1237 |
| 185 | Ga0207683_10813146 | 3300026121 | Bacteria | 867 |
| 186 | Ga0207698_10141398 | 3300026142 | Unclassified | 2074 |
| 187 | Ga0209813_10000451 | 3300027866 | Bacteria | 9963 |
| 188 | Ga0209813_10023612 | 3300027866 | Bacteria | 1750 |
| 189 | Ga0209813_10029447 | 3300027866 | Unclassified | 1608 |
| 190 | Ga0207428_10013290 | 3300027907 | Bacteria | 7198 |
| 191 | Ga0268265_10041258 | 3300028380 | Bacteria | 3414 |
| 192 | Ga0268265_10093978 | 3300028380 | Bacteria | 2404 |
| 193 | Ga0268264_10472965 | 3300028381 | Unclassified | 1218 |
| 194 | Ga0268264_10952772 | 3300028381 | Bacteria | 863 |
| 195 | Ga0265318_10046763 | 3300028577 | Unclassified | 1633 |
| 196 | Ga0265338_10275429 | 3300028800 | Bacteria | 1232 |
| 197 | Ga0265330_10033379 | 3300031235 | Bacteria | 2301 |
| 198 | Ga0265332_10002432 | 3300031238 | Bacteria | 9503 |
| 199 | Ga0265332_10053631 | 3300031238 | Unclassified | 1730 |
| 200 | Ga0265320_10024129 | 3300031240 | Bacteria | 3224 |
| 201 | Ga0265325_10000031 | 3300031241 | Bacteria | 102905 |
| 202 | Ga0265325_10032113 | 3300031241 | Bacteria | 2805 |
| 203 | Ga0265325_10053909 | 3300031241 | Bacteria | 2060 |
| 204 | Ga0265325_10075142 | 3300031241 | Bacteria | 1688 |
| 205 | Ga0265325_10138591 | 3300031241 | Bacteria | 1159 |
| 206 | Ga0265340_10002265 | 3300031247 | Bacteria | 10993 |
| 207 | Ga0265340_10025753 | 3300031247 | Unclassified | 2977 |
| 208 | Ga0265340_10047406 | 3300031247 | Bacteria | 2093 |
| 209 | Ga0265339_10008343 | 3300031249 | Bacteria | 6596 |
| 210 | Ga0265339_10098020 | 3300031249 | Unclassified | 1529 |
| 211 | Ga0265331_10098973 | 3300031250 | Bacteria | 1343 |
| 212 | Ga0265331_10117455 | 3300031250 | Bacteria | 1217 |
| 213 | Ga0265316_10012332 | 3300031344 | Bacteria | 7672 |
| 214 | Ga0265316_10118911 | 3300031344 | Bacteria | 1997 |
| 215 | Ga0265316_10336453 | 3300031344 | Unclassified | 1094 |
| 216 | Ga0265316_10413299 | 3300031344 | Bacteria | 971 |
| 217 | Ga0265313_10004833 | 3300031595 | Bacteria | 10135 |
| 218 | Ga0265313_10059341 | 3300031595 | Unclassified | 1800 |
| 219 | Ga0265313_10109229 | 3300031595 | Bacteria | 1218 |
| 220 | Ga0316579_10006101 | 3300031691 | Bacteria | 4895 |
| 221 | Ga0265314_10037520 | 3300031711 | Bacteria | 3510 |
| 222 | Ga0265342_10000034 | 3300031712 | Bacteria | 145074 |
| 223 | Ga0265342_10004075 | 3300031712 | Bacteria | 11653 |
| 224 | Ga0307414_10086114 | 3300032004 | Bacteria | 2317 |
| 225 | Ga0307414_10112073 | 3300032004 | Bacteria | 2079 |
| 226 | Ga0307414_10118424 | 3300032004 | Bacteria | 2031 |
| 227 | Ga0307414_10214413 | 3300032004 | Bacteria | 1576 |
| 228 | Ga0307414_10363104 | 3300032004 | Bacteria | 1247 |
| 229 | Ga0373950_0022462 | 3300034818 | Bacteria | 1122 |
| 230 | Ga0373926_0061713 | 3300035083 | Bacteria | 1368 |
| 231 | Ga0373934_0006961 | 3300035086 | Bacteria | 4195 |
| 232 | Ga0373934_0177345 | 3300035086 | Bacteria | 875 |
| 233 | Ga0373934_0221716 | 3300035086 | Bacteria | 780 |
| 234 | Ga0373940_0005945 | 3300035088 | Bacteria | 2677 |
| 235 | Ga0373949_0006177 | 3300035090 | Bacteria | 2647 |
| 236 | Ga0373949_0059604 | 3300035090 | Bacteria | 979 |
| 237 | Ga0373952_0001811 | 3300035092 | Bacteria | 3888 |
| 238 | Ga0373923_0000861 | 3300035111 | Bacteria | 8044 |
| 239 | Ga0373923_0003118 | 3300035111 | Bacteria | 5261 |
| 240 | Ga0373932_0042336 | 3300035112 | Bacteria | 1320 |
| 241 | Ga0373932_0080330 | 3300035112 | Bacteria | 1029 |
| 242 | Ga0373939_0000782 | 3300035114 | Bacteria | 7839 |
| 243 | Ga0373939_0105640 | 3300035114 | Bacteria | 973 |
| 244 | Ga0373941_0010601 | 3300035115 | Bacteria | 2359 |
| 245 | Ga0373953_0005270 | 3300035117 | Bacteria | 4181 |
| 246 | Ga0373954_0009566 | 3300035118 | Bacteria | 4266 |
| 247 | Ga0373954_0055830 | 3300035118 | Bacteria | 1858 |
| 248 | Ga0373956_0063722 | 3300035119 | Bacteria | 1673 |
| 249 | Ga0373957_0002286 | 3300035120 | Bacteria | 5435 |
| 250 | Ga0373957_0018734 | 3300035120 | Bacteria | 2428 |
| 251 | Ga0373957_0170336 | 3300035120 | Bacteria | 900 |
| 252 | Ga0373955_0001096 | 3300035172 | Bacteria | 11496 |
| 253 | Ga0373955_0001851 | 3300035172 | Bacteria | 9104 |
| 254 | Ga0373955_0161263 | 3300035172 | Unclassified | 1324 |
| 255 | Ga0373955_0200503 | 3300035172 | Bacteria | 1188 |
| 256 | Ga0373961_0018257 | 3300035241 | Unclassified | 1829 |
| 257 | Ga0373924_0017522 | 3300035410 | Bacteria | 2749 |
| 258 | Ga0373931_0001118 | 3300035691 | Bacteria | 11387 |
| 259 | Ga0373931_0014779 | 3300035691 | Bacteria | 3821 |
| 260 | Ga0373931_0027525 | 3300035691 | Bacteria | 2903 |
| 261 | Ga0373931_0071986 | 3300035691 | Bacteria | 1889 |
| 262 | Ga0373935_0000973 | 3300035692 | Bacteria | 15541 |
| 263 | Ga0373935_0149173 | 3300035692 | Unclassified | 1585 |
| 264 | Ga0373927_0032785 | 3300035695 | Bacteria | 3383 |
| 265 | Ga0373927_0150792 | 3300035695 | Bacteria | 1522 |
| 266 | Ga0373927_0163593 | 3300035695 | Bacteria | 1458 |
| 267 | Ga0373933_0002105 | 3300035724 | Bacteria | 11427 |
| 268 | Ga0373933_0014332 | 3300035724 | Bacteria | 4407 |
| 269 | Ga0373933_0216219 | 3300035724 | Bacteria | 1229 |
| 270 | Ga0373947_0001220 | 3300035725 | Bacteria | 15835 |
| 271 | Ga0373947_0004829 | 3300035725 | Bacteria | 7879 |
| 272 | Ga0373947_0012687 | 3300035725 | Bacteria | 4832 |
| 273 | Ga0373947_0286202 | 3300035725 | Bacteria | 1096 |
| 274 | Ga0373937_0001087 | 3300036401 | Bacteria | 22920 |
| 275 | Ga0373937_0064197 | 3300036401 | Bacteria | 3377 |
| 276 | Ga0373937_0140783 | 3300036401 | Bacteria | 2257 |
| 277 | Ga0373937_0438571 | 3300036401 | Bacteria | 1240 |
| 278 | Ga0373937_0449383 | 3300036401 | Bacteria | 1224 |
| 279 | Ga0373925_0000081 | 3300037068 | Bacteria | 102407 |
| 280 | Ga0373925_0031512 | 3300037068 | Bacteria | 3897 |
| 281 | Ga0373925_0175150 | 3300037068 | Bacteria | 1695 |
| 282 | Ga0373925_0401120 | 3300037068 | Bacteria | 1118 |
| 283 | Ga0436364_0802096 | 3300037853 | Bacteria | 1843 |
| 284 | Ga0436364_1178803 | 3300037853 | Bacteria | 1425 |
| 285 | Ga0436365_0633936 | 3300039437 | Bacteria | 2143 |
| 286 | Ga0436360_1277773 | 3300039438 | Unclassified | 1583 |
| 287 | Ga0436363_0076456 | 3300039450 | Unclassified | 1109 |
| 288 | Ga0466957_0004324 | 3300044842 | Bacteria | 7887 |
| 289 | Ga0466958_0019727 | 3300045836 | Bacteria | 3925 |
| 290 | Ga0495592_0000526 | 3300046454 | Bacteria | 27625 |
| 291 | Ga0495592_0014345 | 3300046454 | Bacteria | 6016 |
| 292 | Ga0495592_0049886 | 3300046454 | Bacteria | 3110 |
| 293 | Ga0495603_0109237 | 3300046455 | Bacteria | 1614 |
| 294 | Ga0495629_0001747 | 3300046459 | Bacteria | 17032 |
| 295 | Ga0495629_0001974 | 3300046459 | Bacteria | 15984 |
| 296 | Ga0495629_0039498 | 3300046459 | Bacteria | 3321 |
| 297 | Ga0495651_0000828 | 3300046462 | Bacteria | 24059 |
| 298 | Ga0495651_0024798 | 3300046462 | Bacteria | 4665 |
| 299 | Ga0495653_0003441 | 3300046463 | Bacteria | 12725 |
| 300 | Ga0495653_0283709 | 3300046463 | Unclassified | 1086 |
| 301 | Ga0495582_0041954 | 3300046473 | Bacteria | 2521 |
| 302 | Ga0495662_0011697 | 3300046476 | Bacteria | 4289 |
| 303 | Ga0495664_0000016 | 3300046477 | Bacteria | 175933 |
| 304 | Ga0495584_0020758 | 3300046491 | Bacteria | 3336 |
| 305 | Ga0495608_0000289 | 3300046511 | Bacteria | 35308 |
| 306 | Ga0495608_0000452 | 3300046511 | Bacteria | 28636 |
| 307 | Ga0495608_0081319 | 3300046511 | Bacteria | 2105 |
| 308 | Ga0495618_0000774 | 3300046514 | Bacteria | 22352 |
| 309 | Ga0495618_0008584 | 3300046514 | Bacteria | 6171 |
| 310 | Ga0495628_0000018 | 3300046516 | Bacteria | 169916 |
| 311 | Ga0495628_0031423 | 3300046516 | Bacteria | 4295 |
| 312 | Ga0495628_0244777 | 3300046516 | Bacteria | 1340 |
| 313 | Ga0495630_0002741 | 3300046517 | Bacteria | 12222 |
| 314 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 315 | Ga0495652_0007469 | 3300046529 | Bacteria | 10075 |
| 316 | Ga0495652_0046325 | 3300046529 | Bacteria | 3734 |
| 317 | Ga0495652_0072432 | 3300046529 | Bacteria | 2872 |
| 318 | Ga0495652_0288532 | 3300046529 | Bacteria | 1198 |
| 319 | Ga0495665_0278544 | 3300046531 | Bacteria | 858 |
| 320 | Ga0495640_0000976 | 3300046533 | Bacteria | 22141 |
| 321 | Ga0495640_0002278 | 3300046533 | Bacteria | 15391 |
| 322 | Ga0495640_0182888 | 3300046533 | Bacteria | 1335 |
| 323 | Ga0495640_0397275 | 3300046533 | Bacteria | 847 |
| 324 | Ga0495587_0000005 | 3300046536 | Bacteria | 358412 |
| 325 | Ga0495587_0001579 | 3300046536 | Bacteria | 15169 |
| 326 | Ga0495597_0099041 | 3300046542 | Unclassified | 1231 |
| 327 | Ga0495645_0000007 | 3300046543 | Bacteria | 376299 |
| 328 | Ga0495645_0015600 | 3300046543 | Bacteria | 5404 |
| 329 | Ga0495645_0100876 | 3300046543 | Bacteria | 2053 |
| 330 | Ga0495645_0133476 | 3300046543 | Bacteria | 1738 |
| 331 | Ga0495667_0000745 | 3300046559 | Bacteria | 20880 |
| 332 | Ga0495667_0001085 | 3300046559 | Bacteria | 17640 |
| 333 | Ga0495667_0251006 | 3300046559 | Bacteria | 1126 |
| 334 | Ga0495634_0030922 | 3300046642 | Bacteria | 3691 |
| 335 | Ga0495634_0114799 | 3300046642 | Bacteria | 1729 |
| 336 | Ga0495635_0000045 | 3300046663 | Bacteria | 82266 |
| 337 | Ga0495635_0000288 | 3300046663 | Bacteria | 32286 |
| 338 | Ga0495588_0246619 | 3300046674 | Bacteria | 942 |
| 339 | Ga0495657_0135713 | 3300046675 | Bacteria | 1537 |
| 340 | Ga0495599_0000201 | 3300046678 | Bacteria | 39630 |
| 341 | Ga0495599_0018953 | 3300046678 | Bacteria | 4289 |
| 342 | Ga0495623_0002014 | 3300046679 | Bacteria | 13644 |
| 343 | Ga0495623_0002320 | 3300046679 | Bacteria | 12683 |
| 344 | Ga0495623_0016342 | 3300046679 | Bacteria | 4793 |
| 345 | Ga0495646_0000027 | 3300046680 | Bacteria | 97629 |
| 346 | Ga0495646_0206549 | 3300046680 | Unclassified | 1067 |
| 347 | Ga0495658_0212265 | 3300046683 | Unclassified | 1210 |
| 348 | Ga0495624_0151406 | 3300046690 | Bacteria | 1419 |
| 349 | Ga0495589_0104779 | 3300046794 | Bacteria | 1367 |
| 350 | Ga0495600_0001518 | 3300046809 | Bacteria | 12888 |
| 351 | Ga0495600_0019594 | 3300046809 | Bacteria | 4322 |
| 352 | Ga0495604_0000014 | 3300047317 | Bacteria | 205481 |
| 353 | Ga0495604_0002473 | 3300047317 | Bacteria | 14751 |
| 354 | Ga0495604_0039216 | 3300047317 | Bacteria | 3723 |
| 355 | Ga0495604_0111967 | 3300047317 | Bacteria | 1989 |
| 356 | Ga0495674_0000014 | 3300047319 | Bacteria | 241211 |
| 357 | Ga0495674_0005148 | 3300047319 | Bacteria | 12558 |
| 358 | Ga0495680_0000871 | 3300047322 | Bacteria | 33528 |
| 359 | Ga0495680_0002779 | 3300047322 | Bacteria | 17650 |
| 360 | Ga0495675_0002726 | 3300047444 | Bacteria | 10592 |
| 361 | Ga0495675_0210937 | 3300047444 | Bacteria | 1179 |
| 362 | Ga0495675_0357577 | 3300047444 | Unclassified | 858 |
| 363 | Ga0495685_015828 | 3300047447 | Bacteria | 2576 |
| 364 | Ga0495684_0003288 | 3300047471 | Bacteria | 12695 |
| 365 | Ga0495684_0487357 | 3300047471 | Bacteria | 850 |
| 366 | Ga0495684_0542686 | 3300047471 | Bacteria | 793 |
| 367 | Ga0495593_0179775 | 3300047673 | Bacteria | 1065 |
| 368 | Ga0495602_0006048 | 3300048088 | Bacteria | 12699 |
| 369 | Ga0495602_0040975 | 3300048088 | Bacteria | 4236 |
| 370 | Ga0495602_0078721 | 3300048088 | Bacteria | 2783 |
| 371 | Ga0496100_0015384 | 3300048903 | Bacteria | 4468 |
| 372 | Ga0496101_0229797 | 3300048904 | Bacteria | 1442 |
| 373 | Ga0496101_0302757 | 3300048904 | Bacteria | 1252 |
| 374 | Ga0496103_0071470 | 3300048906 | Bacteria | 2172 |
| 375 | Ga0496104_0000469 | 3300048907 | Bacteria | 34760 |
| 376 | Ga0496104_0001028 | 3300048907 | Bacteria | 23891 |
| 377 | Ga0496104_0007019 | 3300048907 | Bacteria | 9932 |
| 378 | Ga0496104_0540824 | 3300048907 | Bacteria | 1076 |
| 379 | Ga0496105_0011328 | 3300048908 | Bacteria | 7042 |
| 380 | Ga0496105_0011357 | 3300048908 | Bacteria | 7034 |
| 381 | Ga0496105_0028965 | 3300048908 | Bacteria | 4531 |
| 382 | Ga0496106_0033807 | 3300048909 | Bacteria | 3817 |
| 383 | Ga0496106_0231957 | 3300048909 | Bacteria | 1474 |
| 384 | Ga0496106_0549743 | 3300048909 | Unclassified | 926 |
| 385 | Ga0496107_0536309 | 3300048910 | Bacteria | 867 |
| 386 | Ga0496108_0005675 | 3300048911 | Bacteria | 10102 |
| 387 | Ga0496108_0047132 | 3300048911 | Bacteria | 3603 |
| 388 | Ga0496108_0163839 | 3300048911 | Bacteria | 1922 |
| 389 | Ga0496108_0229909 | 3300048911 | Bacteria | 1613 |
| 390 | Ga0496108_0259358 | 3300048911 | Bacteria | 1513 |
| 391 | Ga0496108_0279977 | 3300048911 | Bacteria | 1452 |
| 392 | Ga0496109_0034972 | 3300048912 | Bacteria | 4529 |
| 393 | Ga0496109_0046537 | 3300048912 | Bacteria | 3941 |
| 394 | Ga0496109_0262592 | 3300048912 | Bacteria | 1626 |
| 395 | Ga0496110_0024995 | 3300048913 | Bacteria | 5099 |
| 396 | Ga0496110_0031167 | 3300048913 | Bacteria | 4599 |
| 397 | Ga0496110_0122119 | 3300048913 | Bacteria | 2347 |
| 398 | Ga0496110_0139454 | 3300048913 | Bacteria | 2192 |
| 399 | Ga0496110_0170406 | 3300048913 | Bacteria | 1975 |
| 400 | Ga0496110_0528395 | 3300048913 | Bacteria | 1073 |
| 401 | Ga0496111_0007605 | 3300048914 | Bacteria | 7117 |
| 402 | Ga0496111_0438135 | 3300048914 | Bacteria | 965 |
| 403 | Ga0496112_0003993 | 3300048915 | Bacteria | 12365 |
| 404 | Ga0496112_0043430 | 3300048915 | Bacteria | 4401 |
| 405 | Ga0496112_0090589 | 3300048915 | Bacteria | 3027 |
| 406 | Ga0496112_0334345 | 3300048915 | Bacteria | 1458 |
| 407 | Ga0496112_0420660 | 3300048915 | Bacteria | 1275 |
| 408 | Ga0496112_0433076 | 3300048915 | Bacteria | 1253 |
| 409 | Ga0496113_0005743 | 3300048916 | Bacteria | 7773 |
| 410 | Ga0496113_0035652 | 3300048916 | Bacteria | 3639 |
| 411 | Ga0496113_0043329 | 3300048916 | Bacteria | 3330 |
| 412 | Ga0496114_0051882 | 3300048917 | Bacteria | 3416 |
| 413 | Ga0496114_0080413 | 3300048917 | Bacteria | 2752 |
| 414 | Ga0496115_0068824 | 3300048918 | Bacteria | 2866 |
| 415 | Ga0496115_0129498 | 3300048918 | Bacteria | 2079 |
| 416 | Ga0496122_0275728 | 3300048925 | Bacteria | 923 |
| 417 | Ga0501031_0040955 | 3300049568 | Bacteria | 3024 |
| 418 | Ga0501031_0137394 | 3300049568 | Bacteria | 1597 |
| 419 | Ga0501032_0008333 | 3300049569 | Bacteria | 7554 |
| 420 | Ga0501032_0012016 | 3300049569 | Bacteria | 6199 |
| 421 | Ga0501033_0249406 | 3300049570 | Bacteria | 1258 |
| 422 | Ga0501034_0000865 | 3300049571 | Bacteria | 44853 |
| 423 | Ga0501034_0058432 | 3300049571 | Bacteria | 3876 |
| 424 | Ga0501034_0133149 | 3300049571 | Bacteria | 2468 |
| 425 | Ga0501034_0177967 | 3300049571 | Bacteria | 2092 |
| 426 | Ga0501034_0217510 | 3300049571 | Bacteria | 1864 |
| 427 | Ga0501036_0049723 | 3300049572 | Bacteria | 3550 |
| 428 | Ga0501036_0079593 | 3300049572 | Bacteria | 2771 |
| 429 | Ga0501037_0020596 | 3300049573 | Bacteria | 4870 |
| 430 | Ga0501037_0045566 | 3300049573 | Bacteria | 3219 |
| 431 | Ga0501037_0223036 | 3300049573 | Bacteria | 1326 |
| 432 | Ga0501037_0235227 | 3300049573 | Bacteria | 1285 |
| 433 | Ga0501038_0155229 | 3300049574 | Unclassified | 1864 |
| 434 | Ga0501038_0540272 | 3300049574 | Bacteria | 887 |
| 435 | Ga0501039_0174082 | 3300049575 | Bacteria | 1692 |
| 436 | Ga0501039_0217740 | 3300049575 | Bacteria | 1501 |
| 437 | Ga0501039_0279156 | 3300049575 | Bacteria | 1313 |
| 438 | Ga0501039_0292387 | 3300049575 | Bacteria | 1281 |
| 439 | Ga0501039_0295203 | 3300049575 | Bacteria | 1274 |
| 440 | Ga0501042_0142319 | 3300049578 | Bacteria | 1729 |
| 441 | Ga0501043_0036755 | 3300049579 | Bacteria | 3853 |
| 442 | Ga0501043_0476402 | 3300049579 | Unclassified | 935 |
| 443 | Ga0501046_0050602 | 3300049580 | Bacteria | 3281 |
| 444 | Ga0501046_0318952 | 3300049580 | Bacteria | 1133 |
| 445 | Ga0501047_0031990 | 3300049581 | Bacteria | 5076 |
| 446 | Ga0501047_0356469 | 3300049581 | Unclassified | 1299 |
| 447 | Ga0501047_0386606 | 3300049581 | Bacteria | 1233 |
| 448 | Ga0501047_0433706 | 3300049581 | Unclassified | 1145 |
| 449 | Ga0501047_0864913 | 3300049581 | Unclassified | 718 |
| 450 | Ga0501067_0017709 | 3300049583 | Bacteria | 3944 |
| 451 | Ga0501067_0017895 | 3300049583 | Bacteria | 3923 |
| 452 | Ga0501067_0115397 | 3300049583 | Unclassified | 1494 |
| 453 | Ga0501068_0036057 | 3300049584 | Bacteria | 2955 |
| 454 | Ga0501070_0073350 | 3300049586 | Bacteria | 2832 |
| 455 | Ga0501070_0342870 | 3300049586 | Bacteria | 1213 |
| 456 | Ga0501071_0037226 | 3300049587 | Bacteria | 3473 |
| 457 | Ga0501073_0778818 | 3300049589 | Unclassified | 659 |
| 458 | Ga0501074_0001731 | 3300049590 | Bacteria | 14911 |
| 459 | Ga0501074_0035798 | 3300049590 | Bacteria | 3597 |
| 460 | Ga0501075_0236616 | 3300049591 | Bacteria | 1392 |
| 461 | Ga0501076_0089535 | 3300049592 | Bacteria | 2474 |
| 462 | Ga0501076_0093980 | 3300049592 | Bacteria | 2414 |
| 463 | Ga0501076_0097150 | 3300049592 | Bacteria | 2373 |
| 464 | Ga0501077_0046832 | 3300049593 | Unclassified | 2747 |
| 465 | Ga0501077_0179950 | 3300049593 | Bacteria | 1344 |
| 466 | Ga0501079_0079126 | 3300049741 | Bacteria | 2542 |
| 467 | Ga0501080_0106962 | 3300049742 | Bacteria | 2592 |
| 468 | Ga0501080_0110277 | 3300049742 | Bacteria | 2550 |
| 469 | Ga0501080_0236819 | 3300049742 | Bacteria | 1667 |
| 470 | Ga0501080_0550687 | 3300049742 | Bacteria | 1027 |
| 471 | Ga0501080_0576081 | 3300049742 | Unclassified | 1001 |
| 472 | Ga0501083_0019785 | 3300049744 | Bacteria | 4684 |
| 473 | Ga0501083_0031802 | 3300049744 | Bacteria | 3621 |
| 474 | Ga0501083_0156090 | 3300049744 | Bacteria | 1494 |
| 475 | Ga0501083_0363901 | 3300049744 | Unclassified | 940 |
| 476 | Ga0501035_0098603 | 3300049822 | Bacteria | 2565 |
| 477 | Ga0501035_0141493 | 3300049822 | Bacteria | 2091 |
| 478 | Ga0501044_0000122 | 3300049823 | Bacteria | 93246 |
| 479 | Ga0501044_0140937 | 3300049823 | Bacteria | 2399 |
| 480 | Ga0501044_0257684 | 3300049823 | Unclassified | 1683 |
| 481 | Ga0501044_0533992 | 3300049823 | Bacteria | 1071 |
| 482 | Ga0501044_0639912 | 3300049823 | Bacteria | 953 |
| 483 | Ga0501045_0007533 | 3300049824 | Bacteria | 7565 |
| 484 | nmdc:mga03n38_137880_c1 | 3300050490 | Bacteria | 1216 |
| 485 | nmdc:mga03n38_302427_c1 | 3300050490 | Unclassified | 859 |
| 486 | nmdc:mga00v17_78616_c1 | 3300050491 | Bacteria | 2056 |
| 487 | nmdc:mga00v17_95901_c1 | 3300050491 | Unclassified | 1868 |
| 488 | nmdc:mga0yw44_51761_c1 | 3300050492 | Bacteria | 2487 |
| 489 | nmdc:mga0yw44_517726_c1 | 3300050492 | Bacteria | 809 |
| 490 | nmdc:mga0k408_24659_c1 | 3300050493 | Bacteria | 3401 |
| 491 | nmdc:mga06z11_2287_c1 | 3300050494 | Bacteria | 7282 |
| 492 | nmdc:mga06z11_323263_c1 | 3300050494 | Unclassified | 921 |
| 493 | nmdc:mga06z11_59709_c1 | 3300050494 | Unclassified | 1983 |
| 494 | nmdc:mga04h51_435_c1 | 3300050495 | Bacteria | 10032 |
| 495 | nmdc:mga04h51_8692_c1 | 3300050495 | Bacteria | 2724 |
| 496 | nmdc:mga07m45_95340_c1 | 3300050496 | Bacteria | 1707 |
| 497 | nmdc:mga05p37_290334_c1 | 3300050507 | Bacteria | 1947 |
| 498 | nmdc:mga05p37_305_c1 | 3300050507 | Bacteria | 51585 |
| 499 | nmdc:mga09592_6564_c1 | 3300050508 | Bacteria | 9472 |
| 500 | nmdc:mga06r32_1208_c1 | 3300050510 | Bacteria | 23270 |
| 501 | nmdc:mga08y16_280853_c1 | 3300050511 | Bacteria | 1717 |
| 502 | nmdc:mga08y16_3003_c1 | 3300050511 | Bacteria | 17407 |
| 503 | nmdc:mga08y16_93765_c1 | 3300050511 | Bacteria | 3128 |
| 504 | Ga0495601_0000016 | 3300053077 | Bacteria | 207486 |
| 505 | Ga0495601_0004177 | 3300053077 | Bacteria | 8330 |
| 506 | Ga0495601_0027468 | 3300053077 | Bacteria | 3518 |
| 507 | Ga0495601_0041204 | 3300053077 | Bacteria | 2894 |
| 508 | Ga0495601_0222976 | 3300053077 | Bacteria | 1231 |
| 509 | Ga0495612_0000380 | 3300053078 | Bacteria | 17744 |
| 510 | Ga0495612_0019776 | 3300053078 | Bacteria | 2698 |
| 511 | Ga0495612_0026270 | 3300053078 | Unclassified | 2340 |
| 512 | Ga0495612_0095808 | 3300053078 | Bacteria | 1260 |
| 513 | Ga0495655_0000249 | 3300053083 | Bacteria | 10050 |
| 514 | Ga0495595_0000048 | 3300053084 | Bacteria | 60581 |
| 515 | Ga0495595_0002807 | 3300053084 | Bacteria | 6852 |
| 516 | Ga0495595_0054326 | 3300053084 | Bacteria | 1862 |
| 517 | Ga0495595_0145166 | 3300053084 | Bacteria | 1165 |
| 518 | Ga0495619_0000050 | 3300053085 | Bacteria | 101361 |
| 519 | Ga0495619_0003867 | 3300053085 | Bacteria | 9629 |
| 520 | Ga0495619_0103512 | 3300053085 | Bacteria | 1939 |
| 521 | Ga0495619_0228207 | 3300053085 | Bacteria | 1290 |
| 522 | Ga0500641_0022114 | 3300053096 | Bacteria | 2432 |
| 523 | Ga0500593_186435 | 3300053117 | Bacteria | 764 |
| 524 | Ga0500595_036401 | 3300053119 | Unclassified | 1612 |
| 525 | Ga0500616_0009602 | 3300053153 | Bacteria | 5869 |
| 526 | Ga0501084_0020137 | 3300054114 | Bacteria | 5562 |
| 527 | Ga0501084_0021239 | 3300054114 | Bacteria | 5413 |
| 528 | Ga0501084_0064310 | 3300054114 | Bacteria | 3070 |
| 529 | Ga0501084_0118177 | 3300054114 | Bacteria | 2229 |
| 530 | Ga0501084_0121966 | 3300054114 | Bacteria | 2192 |
| 531 | Ga0501084_0125624 | 3300054114 | Bacteria | 2158 |
| 532 | Ga0501084_0484123 | 3300054114 | Bacteria | 1046 |
| 533 | Ga0501082_0003010 | 3300060353 | Bacteria | 14719 |
| 534 | Ga0501082_0039699 | 3300060353 | Bacteria | 4060 |
| 535 | Ga0501082_0077844 | 3300060353 | Bacteria | 2859 |
| 536 | Ga0501082_0130337 | 3300060353 | Bacteria | 2182 |
| 537 | Ga0501082_0265040 | 3300060353 | Bacteria | 1495 |
| 538 | Ga0501082_0463362 | 3300060353 | Bacteria | 1108 |
| 539 | Ga0530510_0123175 | 3300061734 | Bacteria | 1904 |
| 540 | Ga0530510_0544781 | 3300061734 | Unclassified | 881 |
| 541 | 2643758156 | 2643221547 | Bacteria | 4740017 |
| 542 | 2643911976 | 2643221580 | Bacteria | 3816678 |
| 543 | 2644412356 | 2643221674 | Bacteria | 3919126 |
| 544 | Ga0070681_10091538 | |||
| 545 | JGI25153J46596_10007254 | |||
| 546 | Ga0070658_10015046 | |||
| 547 | Ga0070676_10027631 | |||
| 548 | Ga0070676_10030041 | |||
| 549 | Ga0070690_100001691 | |||
| 550 | Ga0070670_100001662 | |||
| 551 | Ga0070670_100645431 | |||
| 552 | Ga0068868_100504855 | |||
| 553 | Ga0070660_100134988 | |||
| 554 | Ga0070689_100009348 | |||
| 555 | Ga0070689_100043735 | |||
| 556 | Ga0070689_100060134 | |||
| 557 | Ga0070689_100372513 | |||
| 558 | Ga0070689_100464693 | |||
| 559 | Ga0070691_10183599 | |||
| 560 | Ga0070687_100060286 | |||
| 561 | Ga0070661_100270535 | |||
| 562 | Ga0070668_100169662 | |||
| 563 | Ga0070669_100329381 | |||
| 564 | Ga0070675_100354828 | |||
| 565 | Ga0070671_100016631 | |||
| 566 | Ga0070671_100132713 | |||
| 567 | Ga0070673_100003240 | |||
| 568 | Ga0070688_100214269 | |||
| 569 | Ga0070659_100121547 | |||
| 570 | Ga0070667_100014419 | |||
| 571 | Ga0070667_100041015 | |||
| 572 | Ga0070714_100284658 | |||
| 573 | Ga0070714_100288415 | |||
| 574 | Ga0070713_100255562 | |||
| 575 | Ga0070711_100132752 | |||
| 576 | Ga0070711_100675614 | |||
| 577 | Ga0070663_100459300 | |||
| 578 | Ga0070678_100562282 | |||
| 579 | Ga0070662_100069036 | |||
| 580 | Ga0070681_10778334 | |||
| 581 | Ga0068867_100061365 | |||
| 582 | Ga0070679_100034450 | |||
| 583 | Ga0070679_100290352 | |||
| 584 | Ga0068853_100316570 | |||
| 585 | Ga0070672_100091436 | |||
| 586 | Ga0070672_100097836 | |||
| 587 | Ga0070686_100128546 | |||
| 588 | Ga0070686_100242089 | |||
| 589 | Ga0070695_100112737 | |||
| 590 | Ga0070693_100116318 | |||
| 591 | Ga0070665_100213607 | |||
| 592 | Ga0070665_100268625 | |||
| 593 | Ga0068855_100120529 | |||
| 594 | Ga0068855_100258605 | |||
| 595 | Ga0070664_100515418 | |||
| 596 | Ga0068856_100163679 | |||
| 597 | Ga0068856_100246597 | |||
| 598 | Ga0068856_100440857 | |||
| 599 | Ga0068852_100041929 | |||
| 600 | Ga0068852_100043915 | |||
| 601 | Ga0068852_100064399 | |||
| 602 | Ga0068859_100211240 | |||
| 603 | Ga0068859_100369839 | |||
| 604 | Ga0068861_100056223 | |||
| 605 | Ga0068861_100330288 | |||
| 606 | Ga0068870_10117007 | |||
| 607 | Ga0068858_100104955 | |||
| 608 | Ga0068860_100198400 | |||
| 609 | Ga0068860_100408684 | |||
| 610 | Ga0068860_100859950 | |||
| 611 | Ga0068862_100202600 | |||
| 612 | Ga0081539_10010883 | |||
| 613 | Ga0081539_10015864 | |||
| 614 | Ga0070717_10029553 | |||
| 615 | Ga0070717_10342273 | |||
| 616 | Ga0070717_10368431 | |||
| 617 | Ga0075365_10051928 | |||
| 618 | Ga0075368_10001545 | |||
| 619 | Ga0075368_10013543 | |||
| 620 | Ga0075363_100051142 | |||
| 621 | Ga0075363_100109344 | |||
| 622 | Ga0075364_10557367 | |||
| 623 | Ga0070712_100016450 | |||
| 624 | Ga0070712_100208184 | |||
| 625 | Ga0075367_10001726 | |||
| 626 | Ga0075367_10001884 | |||
| 627 | Ga0075367_10013375 | |||
| 628 | Ga0075367_10262012 | |||
| 629 | Ga0075367_10304101 | |||
| 630 | Ga0075366_10019753 | |||
| 631 | Ga0075366_10160596 | |||
| 632 | Ga0075366_10347224 | |||
| 633 | Ga0075370_10020682 | |||
| 634 | Ga0075428_100013925 | |||
| 635 | Ga0075428_100190104 | |||
| 636 | Ga0075430_100042618 | |||
| 637 | Ga0075431_100013846 | |||
| 638 | Ga0075433_10005783 | |||
| 639 | Ga0075429_100086069 | |||
| 640 | Ga0097620_100211248 | |||
| 641 | Ga0097620_100369785 | |||
| 642 | Ga0111539_10017172 | |||
| 643 | Ga0111539_10042912 | |||
| 644 | Ga0111539_10755945 | |||
| 645 | Ga0105245_10084018 | |||
| 646 | Ga0105245_10312728 | |||
| 647 | Ga0105245_10444159 | |||
| 648 | Ga0105245_10929888 | |||
| 649 | Ga0105247_10185915 | |||
| 650 | Ga0114129_10024191 | |||
| 651 | Ga0114129_11083707 | |||
| 652 | Ga0105242_10438371 | |||
| 653 | Ga0105248_10460400 | |||
| 654 | Ga0105238_10043594 | |||
| 655 | Ga0105238_10636455 | |||
| 656 | Ga0099796_10065414 | |||
| 657 | Ga0105239_11166055 | |||
| 658 | Ga0105246_10151474 | |||
| 659 | Ga0163162_10144158 | |||
| 660 | Ga0163162_10178574 | |||
| 661 | Ga0157375_10278863 | |||
| 662 | Ga0157375_10466928 | |||
| 663 | Ga0157375_10590643 | |||
| 664 | Ga0163163_10029817 | |||
| 665 | Ga0163163_10286236 | |||
| 666 | Ga0163163_10753483 | |||
| 667 | Ga0157380_10178831 | |||
| 668 | Ga0157380_10386758 | |||
| 669 | Ga0157377_10181534 | |||
| 670 | Ga0157379_10395949 | |||
| 671 | Ga0157376_10236429 | |||
| 672 | Ga0163161_10045315 | |||
| 673 | Ga0206353_11628533 | |||
| 674 | Ga0213876_10172859 | |||
| 675 | Ga0228598_1026186 | |||
| 676 | Ga0209758_1000351 | |||
| 677 | Ga0207692_10145176 | |||
| 678 | Ga0207680_10392696 | |||
| 679 | Ga0207699_10161596 | |||
| 680 | Ga0207645_10029552 | |||
| 681 | Ga0207705_10010088 | |||
| 682 | Ga0207693_10215483 | |||
| 683 | Ga0207663_10217780 | |||
| 684 | Ga0207657_10118280 | |||
| 685 | Ga0207657_10304705 | |||
| 686 | Ga0207657_10397286 | |||
| 687 | Ga0207649_10224857 | |||
| 688 | Ga0207652_10009939 | |||
| 689 | Ga0207652_10060781 | |||
| 690 | Ga0207652_10424670 | |||
| 691 | Ga0207681_10081945 | |||
| 692 | Ga0207681_10173933 | |||
| 693 | Ga0207681_10328747 | |||
| 694 | Ga0207694_10062573 | |||
| 695 | Ga0207694_10298245 | |||
| 696 | Ga0207650_10224092 | |||
| 697 | Ga0207687_10153979 | |||
| 698 | Ga0207664_10162167 | |||
| 699 | Ga0207644_10000776 | |||
| 700 | Ga0207709_10356994 | |||
| 701 | Ga0207670_10003308 | |||
| 702 | Ga0207670_10011845 | |||
| 703 | Ga0207670_10038338 | |||
| 704 | Ga0207669_10008411 | |||
| 705 | Ga0207669_10292018 | |||
| 706 | Ga0207691_10111651 | |||
| 707 | Ga0207691_10136589 | |||
| 708 | Ga0207711_10272457 | |||
| 709 | Ga0207661_10100140 | |||
| 710 | Ga0207667_10038306 | |||
| 711 | Ga0207667_10121395 | |||
| 712 | Ga0207667_10768047 | |||
| 713 | Ga0207651_10187848 | |||
| 714 | Ga0207668_10150121 | |||
| 715 | Ga0207658_10294031 | |||
| 716 | Ga0207677_10131513 | |||
| 717 | Ga0207703_10064554 | |||
| 718 | Ga0207639_10346759 | |||
| 719 | Ga0207678_10803515 | |||
| 720 | Ga0207708_10311077 | |||
| 721 | Ga0207702_10063575 | |||
| 722 | Ga0207702_10217150 | |||
| 723 | Ga0207702_10271915 | |||
| 724 | Ga0207648_10052087 | |||
| 725 | Ga0207648_10084112 | |||
| 726 | Ga0207676_10034980 | |||
| 727 | Ga0207675_100479016 | |||
| 728 | Ga0207683_10813146 | |||
| 729 | Ga0207698_10141398 | |||
| 730 | Ga0209813_10000451 | |||
| 731 | Ga0209813_10023612 | |||
| 732 | Ga0209813_10029447 | |||
| 733 | Ga0207428_10013290 | |||
| 734 | Ga0268265_10041258 | |||
| 735 | Ga0268265_10093978 | |||
| 736 | Ga0268264_10472965 | |||
| 737 | Ga0268264_10952772 | |||
| 738 | Ga0265318_10046763 | |||
| 739 | Ga0265338_10275429 | |||
| 740 | Ga0265330_10033379 | |||
| 741 | Ga0265332_10002432 | |||
| 742 | Ga0265332_10053631 | |||
| 743 | Ga0265320_10024129 | |||
| 744 | Ga0265325_10000031 | |||
| 745 | Ga0265325_10032113 | |||
| 746 | Ga0265325_10053909 | |||
| 747 | Ga0265325_10075142 | |||
| 748 | Ga0265325_10138591 | |||
| 749 | Ga0265340_10002265 | |||
| 750 | Ga0265340_10025753 | |||
| 751 | Ga0265340_10047406 | |||
| 752 | Ga0265339_10008343 | |||
| 753 | Ga0265339_10098020 | |||
| 754 | Ga0265331_10098973 | |||
| 755 | Ga0265331_10117455 | |||
| 756 | Ga0265316_10012332 | |||
| 757 | Ga0265316_10118911 | |||
| 758 | Ga0265316_10336453 | |||
| 759 | Ga0265316_10413299 | |||
| 760 | Ga0265313_10004833 | |||
| 761 | Ga0265313_10059341 | |||
| 762 | Ga0265313_10109229 | |||
| 763 | Ga0316579_10006101 | |||
| 764 | Ga0265314_10037520 | |||
| 765 | Ga0265342_10000034 | |||
| 766 | Ga0265342_10004075 | |||
| 767 | Ga0307414_10086114 | |||
| 768 | Ga0307414_10112073 | |||
| 769 | Ga0307414_10118424 | |||
| 770 | Ga0307414_10214413 | |||
| 771 | Ga0307414_10363104 | |||
| 772 | Ga0373950_0022462 | |||
| 773 | Ga0373926_0061713 | |||
| 774 | Ga0373934_0006961 | |||
| 775 | Ga0373934_0177345 | |||
| 776 | Ga0373934_0221716 | |||
| 777 | Ga0373940_0005945 | |||
| 778 | Ga0373949_0006177 | |||
| 779 | Ga0373949_0059604 | |||
| 780 | Ga0373952_0001811 | |||
| 781 | Ga0373923_0000861 | |||
| 782 | Ga0373923_0003118 | |||
| 783 | Ga0373932_0042336 | |||
| 784 | Ga0373932_0080330 | |||
| 785 | Ga0373939_0000782 | |||
| 786 | Ga0373939_0105640 | |||
| 787 | Ga0373941_0010601 | |||
| 788 | Ga0373953_0005270 | |||
| 789 | Ga0373954_0009566 | |||
| 790 | Ga0373954_0055830 | |||
| 791 | Ga0373956_0063722 | |||
| 792 | Ga0373957_0002286 | |||
| 793 | Ga0373957_0018734 | |||
| 794 | Ga0373957_0170336 | |||
| 795 | Ga0373955_0001096 | |||
| 796 | Ga0373955_0001851 | |||
| 797 | Ga0373955_0161263 | |||
| 798 | Ga0373955_0200503 | |||
| 799 | Ga0373961_0018257 | |||
| 800 | Ga0373924_0017522 | |||
| 801 | Ga0373931_0001118 | |||
| 802 | Ga0373931_0014779 | |||
| 803 | Ga0373931_0027525 | |||
| 804 | Ga0373931_0071986 | |||
| 805 | Ga0373935_0000973 | |||
| 806 | Ga0373935_0149173 | |||
| 807 | Ga0373927_0032785 | |||
| 808 | Ga0373927_0150792 | |||
| 809 | Ga0373927_0163593 | |||
| 810 | Ga0373933_0002105 | |||
| 811 | Ga0373933_0014332 | |||
| 812 | Ga0373933_0216219 | |||
| 813 | Ga0373947_0001220 | |||
| 814 | Ga0373947_0004829 | |||
| 815 | Ga0373947_0012687 | |||
| 816 | Ga0373947_0286202 | |||
| 817 | Ga0373937_0001087 | |||
| 818 | Ga0373937_0064197 | |||
| 819 | Ga0373937_0140783 | |||
| 820 | Ga0373937_0438571 | |||
| 821 | Ga0373937_0449383 | |||
| 822 | Ga0373925_0000081 | |||
| 823 | Ga0373925_0031512 | |||
| 824 | Ga0373925_0175150 | |||
| 825 | Ga0373925_0401120 | |||
| 826 | Ga0436364_0802096 | |||
| 827 | Ga0436364_1178803 | |||
| 828 | Ga0436365_0633936 | |||
| 829 | Ga0436360_1277773 | |||
| 830 | Ga0436363_0076456 | |||
| 831 | Ga0466957_0004324 | |||
| 832 | Ga0466958_0019727 | |||
| 833 | Ga0495592_0000526 | |||
| 834 | Ga0495592_0014345 | |||
| 835 | Ga0495592_0049886 | |||
| 836 | Ga0495603_0109237 | |||
| 837 | Ga0495629_0001747 | |||
| 838 | Ga0495629_0001974 | |||
| 839 | Ga0495629_0039498 | |||
| 840 | Ga0495651_0000828 | |||
| 841 | Ga0495651_0024798 | |||
| 842 | Ga0495653_0003441 | |||
| 843 | Ga0495653_0283709 | |||
| 844 | Ga0495582_0041954 | |||
| 845 | Ga0495662_0011697 | |||
| 846 | Ga0495664_0000016 | |||
| 847 | Ga0495584_0020758 | |||
| 848 | Ga0495608_0000289 | |||
| 849 | Ga0495608_0000452 | |||
| 850 | Ga0495608_0081319 | |||
| 851 | Ga0495618_0000774 | |||
| 852 | Ga0495618_0008584 | |||
| 853 | Ga0495628_0000018 | |||
| 854 | Ga0495628_0031423 | |||
| 855 | Ga0495628_0244777 | |||
| 856 | Ga0495630_0002741 | |||
| 857 | Ga0495652_0000005 | |||
| 858 | Ga0495652_0007469 | |||
| 859 | Ga0495652_0046325 | |||
| 860 | Ga0495652_0072432 | |||
| 861 | Ga0495652_0288532 | |||
| 862 | Ga0495665_0278544 | |||
| 863 | Ga0495640_0000976 | |||
| 864 | Ga0495640_0002278 | |||
| 865 | Ga0495640_0182888 | |||
| 866 | Ga0495640_0397275 | |||
| 867 | Ga0495587_0000005 | |||
| 868 | Ga0495587_0001579 | |||
| 869 | Ga0495597_0099041 | |||
| 870 | Ga0495645_0000007 | |||
| 871 | Ga0495645_0015600 | |||
| 872 | Ga0495645_0100876 | |||
| 873 | Ga0495645_0133476 | |||
| 874 | Ga0495667_0000745 | |||
| 875 | Ga0495667_0001085 | |||
| 876 | Ga0495667_0251006 | |||
| 877 | Ga0495634_0030922 | |||
| 878 | Ga0495634_0114799 | |||
| 879 | Ga0495635_0000045 | |||
| 880 | Ga0495635_0000288 | |||
| 881 | Ga0495588_0246619 | |||
| 882 | Ga0495657_0135713 | |||
| 883 | Ga0495599_0000201 | |||
| 884 | Ga0495599_0018953 | |||
| 885 | Ga0495623_0002014 | |||
| 886 | Ga0495623_0002320 | |||
| 887 | Ga0495623_0016342 | |||
| 888 | Ga0495646_0000027 | |||
| 889 | Ga0495646_0206549 | |||
| 890 | Ga0495658_0212265 | |||
| 891 | Ga0495624_0151406 | |||
| 892 | Ga0495589_0104779 | |||
| 893 | Ga0495600_0001518 | |||
| 894 | Ga0495600_0019594 | |||
| 895 | Ga0495604_0000014 | |||
| 896 | Ga0495604_0002473 | |||
| 897 | Ga0495604_0039216 | |||
| 898 | Ga0495604_0111967 | |||
| 899 | Ga0495674_0000014 | |||
| 900 | Ga0495674_0005148 | |||
| 901 | Ga0495680_0000871 | |||
| 902 | Ga0495680_0002779 | |||
| 903 | Ga0495675_0002726 | |||
| 904 | Ga0495675_0210937 | |||
| 905 | Ga0495675_0357577 | |||
| 906 | Ga0495685_015828 | |||
| 907 | Ga0495684_0003288 | |||
| 908 | Ga0495684_0487357 | |||
| 909 | Ga0495684_0542686 | |||
| 910 | Ga0495593_0179775 | |||
| 911 | Ga0495602_0006048 | |||
| 912 | Ga0495602_0040975 | |||
| 913 | Ga0495602_0078721 | |||
| 914 | Ga0496100_0015384 | |||
| 915 | Ga0496101_0229797 | |||
| 916 | Ga0496101_0302757 | |||
| 917 | Ga0496103_0071470 | |||
| 918 | Ga0496104_0000469 | |||
| 919 | Ga0496104_0001028 | |||
| 920 | Ga0496104_0007019 | |||
| 921 | Ga0496104_0540824 | |||
| 922 | Ga0496105_0011328 | |||
| 923 | Ga0496105_0011357 | |||
| 924 | Ga0496105_0028965 | |||
| 925 | Ga0496106_0033807 | |||
| 926 | Ga0496106_0231957 | |||
| 927 | Ga0496106_0549743 | |||
| 928 | Ga0496107_0536309 | |||
| 929 | Ga0496108_0005675 | |||
| 930 | Ga0496108_0047132 | |||
| 931 | Ga0496108_0163839 | |||
| 932 | Ga0496108_0229909 | |||
| 933 | Ga0496108_0259358 | |||
| 934 | Ga0496108_0279977 | |||
| 935 | Ga0496109_0034972 | |||
| 936 | Ga0496109_0046537 | |||
| 937 | Ga0496109_0262592 | |||
| 938 | Ga0496110_0024995 | |||
| 939 | Ga0496110_0031167 | |||
| 940 | Ga0496110_0122119 | |||
| 941 | Ga0496110_0139454 | |||
| 942 | Ga0496110_0170406 | |||
| 943 | Ga0496110_0528395 | |||
| 944 | Ga0496111_0007605 | |||
| 945 | Ga0496111_0438135 | |||
| 946 | Ga0496112_0003993 | |||
| 947 | Ga0496112_0043430 | |||
| 948 | Ga0496112_0090589 | |||
| 949 | Ga0496112_0334345 | |||
| 950 | Ga0496112_0420660 | |||
| 951 | Ga0496112_0433076 | |||
| 952 | Ga0496113_0005743 | |||
| 953 | Ga0496113_0035652 | |||
| 954 | Ga0496113_0043329 | |||
| 955 | Ga0496114_0051882 | |||
| 956 | Ga0496114_0080413 | |||
| 957 | Ga0496115_0068824 | |||
| 958 | Ga0496115_0129498 | |||
| 959 | Ga0496122_0275728 | |||
| 960 | Ga0501031_0040955 | |||
| 961 | Ga0501031_0137394 | |||
| 962 | Ga0501032_0008333 | |||
| 963 | Ga0501032_0012016 | |||
| 964 | Ga0501033_0249406 | |||
| 965 | Ga0501034_0000865 | |||
| 966 | Ga0501034_0058432 | |||
| 967 | Ga0501034_0133149 | |||
| 968 | Ga0501034_0177967 | |||
| 969 | Ga0501034_0217510 | |||
| 970 | Ga0501036_0049723 | |||
| 971 | Ga0501036_0079593 | |||
| 972 | Ga0501037_0020596 | |||
| 973 | Ga0501037_0045566 | |||
| 974 | Ga0501037_0223036 | |||
| 975 | Ga0501037_0235227 | |||
| 976 | Ga0501038_0155229 | |||
| 977 | Ga0501038_0540272 | |||
| 978 | Ga0501039_0174082 | |||
| 979 | Ga0501039_0217740 | |||
| 980 | Ga0501039_0279156 | |||
| 981 | Ga0501039_0292387 | |||
| 982 | Ga0501039_0295203 | |||
| 983 | Ga0501042_0142319 | |||
| 984 | Ga0501043_0036755 | |||
| 985 | Ga0501043_0476402 | |||
| 986 | Ga0501046_0050602 | |||
| 987 | Ga0501046_0318952 | |||
| 988 | Ga0501047_0031990 | |||
| 989 | Ga0501047_0356469 | |||
| 990 | Ga0501047_0386606 | |||
| 991 | Ga0501047_0433706 | |||
| 992 | Ga0501047_0864913 | |||
| 993 | Ga0501067_0017709 | |||
| 994 | Ga0501067_0017895 | |||
| 995 | Ga0501067_0115397 | |||
| 996 | Ga0501068_0036057 | |||
| 997 | Ga0501070_0073350 | |||
| 998 | Ga0501070_0342870 | |||
| 999 | Ga0501071_0037226 | |||
| 1000 | Ga0501073_0778818 | |||
| 1001 | Ga0501074_0001731 | |||
| 1002 | Ga0501074_0035798 | |||
| 1003 | Ga0501075_0236616 | |||
| 1004 | Ga0501076_0089535 | |||
| 1005 | Ga0501076_0093980 | |||
| 1006 | Ga0501076_0097150 | |||
| 1007 | Ga0501077_0046832 | |||
| 1008 | Ga0501077_0179950 | |||
| 1009 | Ga0501079_0079126 | |||
| 1010 | Ga0501080_0106962 | |||
| 1011 | Ga0501080_0110277 | |||
| 1012 | Ga0501080_0236819 | |||
| 1013 | Ga0501080_0550687 | |||
| 1014 | Ga0501080_0576081 | |||
| 1015 | Ga0501083_0019785 | |||
| 1016 | Ga0501083_0031802 | |||
| 1017 | Ga0501083_0156090 | |||
| 1018 | Ga0501083_0363901 | |||
| 1019 | Ga0501035_0098603 | |||
| 1020 | Ga0501035_0141493 | |||
| 1021 | Ga0501044_0000122 | |||
| 1022 | Ga0501044_0140937 | |||
| 1023 | Ga0501044_0257684 | |||
| 1024 | Ga0501044_0533992 | |||
| 1025 | Ga0501044_0639912 | |||
| 1026 | Ga0501045_0007533 | |||
| 1027 | nmdc:mga03n38_137880_c1 | |||
| 1028 | nmdc:mga03n38_302427_c1 | |||
| 1029 | nmdc:mga00v17_78616_c1 | |||
| 1030 | nmdc:mga00v17_95901_c1 | |||
| 1031 | nmdc:mga0yw44_51761_c1 | |||
| 1032 | nmdc:mga0yw44_517726_c1 | |||
| 1033 | nmdc:mga0k408_24659_c1 | |||
| 1034 | nmdc:mga06z11_2287_c1 | |||
| 1035 | nmdc:mga06z11_323263_c1 | |||
| 1036 | nmdc:mga06z11_59709_c1 | |||
| 1037 | nmdc:mga04h51_435_c1 | |||
| 1038 | nmdc:mga04h51_8692_c1 | |||
| 1039 | nmdc:mga07m45_95340_c1 | |||
| 1040 | nmdc:mga05p37_290334_c1 | |||
| 1041 | nmdc:mga05p37_305_c1 | |||
| 1042 | nmdc:mga09592_6564_c1 | |||
| 1043 | nmdc:mga06r32_1208_c1 | |||
| 1044 | nmdc:mga08y16_280853_c1 | |||
| 1045 | nmdc:mga08y16_3003_c1 | |||
| 1046 | nmdc:mga08y16_93765_c1 | |||
| 1047 | Ga0495601_0000016 | |||
| 1048 | Ga0495601_0004177 | |||
| 1049 | Ga0495601_0027468 | |||
| 1050 | Ga0495601_0041204 | |||
| 1051 | Ga0495601_0222976 | |||
| 1052 | Ga0495612_0000380 | |||
| 1053 | Ga0495612_0019776 | |||
| 1054 | Ga0495612_0026270 | |||
| 1055 | Ga0495612_0095808 | |||
| 1056 | Ga0495655_0000249 | |||
| 1057 | Ga0495595_0000048 | |||
| 1058 | Ga0495595_0002807 | |||
| 1059 | Ga0495595_0054326 | |||
| 1060 | Ga0495595_0145166 | |||
| 1061 | Ga0495619_0000050 | |||
| 1062 | Ga0495619_0003867 | |||
| 1063 | Ga0495619_0103512 | |||
| 1064 | Ga0495619_0228207 | |||
| 1065 | Ga0500641_0022114 | |||
| 1066 | Ga0500593_186435 | |||
| 1067 | Ga0500595_036401 | |||
| 1068 | Ga0500616_0009602 | |||
| 1069 | Ga0501084_0020137 | |||
| 1070 | Ga0501084_0021239 | |||
| 1071 | Ga0501084_0064310 | |||
| 1072 | Ga0501084_0118177 | |||
| 1073 | Ga0501084_0121966 | |||
| 1074 | Ga0501084_0125624 | |||
| 1075 | Ga0501084_0484123 | |||
| 1076 | Ga0501082_0003010 | |||
| 1077 | Ga0501082_0039699 | |||
| 1078 | Ga0501082_0077844 | |||
| 1079 | Ga0501082_0130337 | |||
| 1080 | Ga0501082_0265040 | |||
| 1081 | Ga0501082_0463362 | |||
| 1082 | Ga0530510_0123175 | |||
| 1083 | Ga0530510_0544781 | |||
| 1084 | 2643758156 | |||
| 1085 | 2643911976 | |||
| 1086 | 2644412356 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3re1-assembly2.cif.gz_B | crystal structure of uroporphyrinogen iii synthase from pseudomonas syringae pv. tomato dc3000 | 0.7537 | 2 | 235 |
| 4es6-assembly1.cif.gz_A | crystal structure of hemd (pa5259) from pseudomonas aeruginosa (pao1) at 2.22 a resolution | 0.7517 | 2 | 231 |
| 3re1-assembly2.cif.gz_B | crystal structure of uroporphyrinogen iii synthase from pseudomonas syringae pv. tomato dc3000 | 0.7482 | 2 | 235 |
| 3re1-assembly1.cif.gz_A | crystal structure of uroporphyrinogen iii synthase from pseudomonas syringae pv. tomato dc3000 | 0.7411 | 2 | 231 |
| 4es6-assembly1.cif.gz_A | crystal structure of hemd (pa5259) from pseudomonas aeruginosa (pao1) at 2.22 a resolution | 0.7354 | 2 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9W3B3_40_172_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.852 | 47 | 149 | 3.40.50.10090 |
| af_Q800W7_38_174_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8361 | 47 | 149 | 3.40.50.10090 |
| af_P87214_36_168_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8138 | 47 | 149 | 3.40.50.10090 |
| af_Q2FXR2_34_131_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.81 | 45 | 137 | 3.40.50.10090 |
| af_B4FD25_174_289_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8084 | 123 | 231 | 3.40.50.10090 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537Q350-F1-model_v4 | Uroporphyrinogen-III synthase (EC 4.2.1.75) | 0.9759 | 1 | 231 |
GO:0004852
GO:0006780 GO:0006782 |
| AF-A0A0Q7TCK9-F1-model_v4 | Uroporphyrinogen-III synthase (EC 4.2.1.75) | 0.9679 | 1 | 231 |
GO:0004852
GO:0006780 GO:0006782 |
| AF-A0A833G2C6-F1-model_v4 | Uroporphyrinogen-III synthase (EC 4.2.1.75) | 0.9642 | 1 | 230 |
GO:0004852
GO:0006780 GO:0006782 |
| AF-A0A081B6B3-F1-model_v4 | Uroporphyrinogen III synthase HEM4 | 0.9591 | 1 | 234 |
GO:0004852
GO:0033014 |
| AF-A0A537Q350-F1-model_v4 | Uroporphyrinogen-III synthase (EC 4.2.1.75) | 0.9555 | 1 | 231 |
GO:0004852
GO:0006780 GO:0006782 |