F461595

General Info

Members Datasets Scaffolds Average Seq Length
543 262 543 393

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100040419|Ga0068864_1000404191
Length 428
Sequence VSREGSDQVHRRKGTLGTRFFGLRLVAHYFLVEKSRKAKDLRSFMPKLSIKDLNLSGQRVLVRVDFNVPIKDGKVEDDTRIRASLPTIEYALEHGAKVILASHLGRPKGQRVDKYSLKPVADHLSTLLKRPVLFADDCVDDEAEAMASKLALGEVLLLENLRFHPEEEKNDDGFAKKLARPCDVFVNDAFGAAHRAHASTVGVTKYVNKAAAGLLMEKELEYLGKCINHPEHPFVAILGGAKVSDKIPVINALIDRGVDKILIGGAMAYTFLKAEGFTVGKSLVEDNMLSTALAIKKRAEENDIDFLLPTDHQVVDSYEPIKGQQIVAKTIPIEFTNIGLVGLDIGIETVGHFSKALADARMIIWNGPMGVFEEPPFDQGTIGVAHAVAEAADRGAIVVVGGGDSVAAILEFLAGEELPGVAALTDKD

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
160 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
236 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
237 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.42
Nodule 0
Rhizoplane 1.84
Rhizosphere 90.61
Stem 0
Stem Tuber 0
Unclassified 3.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000040 3300000532 Bacteria 8742
2 JGI24751J29686_10000030 3300002459 Bacteria 92588
3 JGI25406J46586_10004412 3300003203 Bacteria 6553
4 Ga0065714_10064504 3300005288 Bacteria 46817
5 Ga0065712_10007288 3300005290 Bacteria 2600
6 Ga0065712_10015493 3300005290 Bacteria 2490
7 Ga0065712_10067766 3300005290 Bacteria 46828
8 Ga0065715_10089158 3300005293 Bacteria 13366
9 Ga0070676_10009459 3300005328 Bacteria 5265
10 Ga0070683_100000782 3300005329 Bacteria 23454
11 Ga0070683_100033711 3300005329 Bacteria 4670
12 Ga0070683_100260024 3300005329 Bacteria 1651
13 Ga0070683_100271933 3300005329 Unclassified 1612
14 Ga0070690_100029080 3300005330 Bacteria 3425
15 Ga0070670_100002791 3300005331 Bacteria 14445
16 Ga0070670_100129551 3300005331 Bacteria 2178
17 Ga0070670_100195300 3300005331 Bacteria 1758
18 Ga0068869_100031649 3300005334 Bacteria 3721
19 Ga0068869_100221871 3300005334 Bacteria 1499
20 Ga0070680_100000906 3300005336 Bacteria 20990
21 Ga0070680_100002278 3300005336 Bacteria 14193
22 Ga0070680_100188871 3300005336 Bacteria 1736
23 Ga0068868_100039981 3300005338 Bacteria 3647
24 Ga0068868_100063212 3300005338 Bacteria 2936
25 Ga0068868_100189998 3300005338 Bacteria 1708
26 Ga0070660_100110462 3300005339 Bacteria 2187
27 Ga0070689_100006471 3300005340 Bacteria 8110
28 Ga0070689_100059585 3300005340 Bacteria 2967
29 Ga0070692_10074309 3300005345 Bacteria 1818
30 Ga0070675_100157604 3300005354 Bacteria 1950
31 Ga0070673_100134851 3300005364 Bacteria 2077
32 Ga0070673_100225285 3300005364 Bacteria 1624
33 Ga0070659_100004306 3300005366 Bacteria 10162
34 Ga0070667_100208881 3300005367 Bacteria 1735
35 Ga0070714_100004206 3300005435 Bacteria 10839
36 Ga0070714_100014598 3300005435 Bacteria 6312
37 Ga0070713_100001935 3300005436 Bacteria 13372
38 Ga0070713_100033262 3300005436 Bacteria 4128
39 Ga0070713_100262500 3300005436 Bacteria 1579
40 Ga0070711_100023210 3300005439 Bacteria 4031
41 Ga0070711_100048099 3300005439 Bacteria 2914
42 Ga0070700_100000719 3300005441 Bacteria 16343
43 Ga0070694_100008855 3300005444 Bacteria 6165
44 Ga0070694_100131549 3300005444 Bacteria 1808
45 Ga0070708_100000288 3300005445 Bacteria 37866
46 Ga0070663_100081643 3300005455 Unclassified 2377
47 Ga0070681_10007327 3300005458 Bacteria 10774
48 Ga0070681_10007744 3300005458 Bacteria 10498
49 Ga0070681_10051872 3300005458 Bacteria 4091
50 Ga0070681_10287069 3300005458 Bacteria 1556
51 Ga0070706_100000125 3300005467 Bacteria 94689
52 Ga0070706_100002798 3300005467 Bacteria 17448
53 Ga0070706_100198172 3300005467 Bacteria 1876
54 Ga0070707_100003600 3300005468 Bacteria 14608
55 Ga0070707_100007466 3300005468 Bacteria 10152
56 Ga0070707_100269503 3300005468 Bacteria 1655
57 Ga0070707_100343404 3300005468 Bacteria 1450
58 Ga0070698_100005037 3300005471 Bacteria 14476
59 Ga0070698_100006865 3300005471 Bacteria 12329
60 Ga0070698_100026885 3300005471 Bacteria 5984
61 Ga0070699_100000880 3300005518 Bacteria 27937
62 Ga0070699_100094221 3300005518 Bacteria 2621
63 Ga0070679_100077077 3300005530 Bacteria 3322
64 Ga0070679_100081171 3300005530 Unclassified 3232
65 Ga0070684_100000004 3300005535 Bacteria 231043
66 Ga0070684_100018692 3300005535 Bacteria 5716
67 Ga0070684_100138444 3300005535 Bacteria 2200
68 Ga0070697_100108356 3300005536 Bacteria 2312
69 Ga0068853_100054585 3300005539 Bacteria 3443
70 Ga0070672_100016594 3300005543 Bacteria 5276
71 Ga0070672_100033246 3300005543 Bacteria 3904
72 Ga0070686_100022101 3300005544 Bacteria 3786
73 Ga0070696_100001812 3300005546 Bacteria 14026
74 Ga0070696_100148651 3300005546 Bacteria 1718
75 Ga0070693_100054472 3300005547 Bacteria 2300
76 Ga0070665_100096315 3300005548 Bacteria 2964
77 Ga0070704_100000897 3300005549 Bacteria 14913
78 Ga0068855_100007695 3300005563 Bacteria 13014
79 Ga0068855_100018074 3300005563 Bacteria 8473
80 Ga0068855_100021336 3300005563 Bacteria 7767
81 Ga0068855_100107352 3300005563 Bacteria 3207
82 Ga0068855_100141525 3300005563 Bacteria 2742
83 Ga0070664_100047571 3300005564 Bacteria 3624
84 Ga0070664_100075926 3300005564 Bacteria 2887
85 Ga0068856_100004681 3300005614 Bacteria 13582
86 Ga0068856_100039174 3300005614 Bacteria 4653
87 Ga0068856_100056752 3300005614 Bacteria 3865
88 Ga0068856_100367001 3300005614 Unclassified 1458
89 Ga0068856_100423527 3300005614 Bacteria 1351
90 Ga0070702_100010971 3300005615 Bacteria 4490
91 Ga0070702_100038951 3300005615 Bacteria 2650
92 Ga0068859_100009084 3300005617 Bacteria 10038
93 Ga0068859_100022162 3300005617 Bacteria 6369
94 Ga0068859_100054415 3300005617 Bacteria 4025
95 Ga0068859_100059991 3300005617 Bacteria 3833
96 Ga0068859_100072850 3300005617 Bacteria 3472
97 Ga0068864_100012799 3300005618 Bacteria 6936
98 Ga0068864_100016856 3300005618 Bacteria 6088
99 Ga0068864_100024814 3300005618 Bacteria 5043
100 Ga0068864_100036952 3300005618 Bacteria 4165
101 Ga0068864_100040419 3300005618 Bacteria 3990
102 Ga0068864_100045644 3300005618 Bacteria 3759
103 Ga0068866_10114216 3300005718 Bacteria 1511
104 Ga0068861_100047932 3300005719 Bacteria 3227
105 Ga0068861_100125700 3300005719 Bacteria 2074
106 Ga0068851_10010828 3300005834 Bacteria 4262
107 Ga0068863_100077675 3300005841 Bacteria 3142
108 Ga0068858_100015305 3300005842 Bacteria 7215
109 Ga0068858_100070213 3300005842 Bacteria 3246
110 Ga0068858_100360199 3300005842 Bacteria 1394
111 Ga0068860_100019352 3300005843 Bacteria 6604
112 Ga0068860_100089275 3300005843 Bacteria 2934
113 Ga0081455_10032863 3300005937 Bacteria 4669
114 Ga0081538_10007618 3300005981 Bacteria 9333
115 Ga0081538_10021911 3300005981 Bacteria 4646
116 Ga0081538_10034673 3300005981 Bacteria 3331
117 Ga0081539_10006601 3300005985 Bacteria 11020
118 Ga0070717_10029849 3300006028 Bacteria 4379
119 Ga0070717_10196318 3300006028 Bacteria 1765
120 Ga0075365_10000131 3300006038 Bacteria 22979
121 Ga0075365_10012716 3300006038 Bacteria 5009
122 Ga0075363_100014550 3300006048 Bacteria 3848
123 Ga0075364_10000706 3300006051 Bacteria 17509
124 Ga0075364_10001601 3300006051 Bacteria 12385
125 Ga0075364_10026996 3300006051 Bacteria 3666
126 Ga0075364_10208196 3300006051 Bacteria 1326
127 Ga0075362_10052795 3300006177 Bacteria 1823
128 Ga0075367_10002737 3300006178 Bacteria 8151
129 Ga0075369_10001648 3300006186 Bacteria 7695
130 Ga0075427_10000404 3300006194 Bacteria 4867
131 Ga0097621_100090191 3300006237 Bacteria 2564
132 Ga0075370_10000232 3300006353 Bacteria 19959
133 Ga0068871_100004539 3300006358 Bacteria 9680
134 Ga0068871_100006668 3300006358 Bacteria 8189
135 Ga0068871_100098014 3300006358 Bacteria 2452
136 Ga0075428_100009001 3300006844 Bacteria 11076
137 Ga0075428_100103241 3300006844 Bacteria 3109
138 Ga0075428_100178367 3300006844 Bacteria 2300
139 Ga0075430_100076170 3300006846 Bacteria 2811
140 Ga0075431_100207480 3300006847 Bacteria 2003
141 Ga0075431_100299919 3300006847 Bacteria 1623
142 Ga0075433_10045889 3300006852 Unclassified 3799
143 Ga0075433_10313912 3300006852 Bacteria 1387
144 Ga0075434_100019404 3300006871 Bacteria 6580
145 Ga0075434_100035585 3300006871 Bacteria 4923
146 Ga0075434_100173547 3300006871 Bacteria 2176
147 Ga0075429_100003016 3300006880 Bacteria 14272
148 Ga0075429_100041444 3300006880 Bacteria 4010
149 Ga0075436_100016731 3300006914 Bacteria 5019
150 Ga0075436_100080015 3300006914 Bacteria 2264
151 Ga0097620_100009084 3300006931 Bacteria 10038
152 Ga0097620_100022163 3300006931 Bacteria 6369
153 Ga0097620_100054415 3300006931 Bacteria 4025
154 Ga0097620_100059986 3300006931 Bacteria 3833
155 Ga0097620_100072856 3300006931 Bacteria 3472
156 Ga0075435_100000569 3300007076 Bacteria 22675
157 Ga0105240_10000167 3300009093 Bacteria 133279
158 Ga0105240_10001386 3300009093 Bacteria 41666
159 Ga0105240_10001428 3300009093 Bacteria 40901
160 Ga0105240_10001660 3300009093 Bacteria 37767
161 Ga0105240_10011426 3300009093 Bacteria 12368
162 Ga0105240_10137155 3300009093 Bacteria 2929
163 Ga0105240_10158004 3300009093 Bacteria 2695
164 Ga0105240_10293426 3300009093 Bacteria 1863
165 Ga0111539_10078972 3300009094 Bacteria 3870
166 Ga0105245_10002831 3300009098 Bacteria 15586
167 Ga0105245_10032874 3300009098 Bacteria 4594
168 Ga0105245_10204841 3300009098 Bacteria 1896
169 Ga0105247_10001044 3300009101 Bacteria 20780
170 Ga0105247_10106465 3300009101 Bacteria 1799
171 Ga0114129_10021586 3300009147 Bacteria 9139
172 Ga0114129_10033645 3300009147 Bacteria 7242
173 Ga0114129_10578413 3300009147 Bacteria 1458
174 Ga0114129_10605711 3300009147 Bacteria 1419
175 Ga0105243_10000474 3300009148 Bacteria 41200
176 Ga0105243_10025565 3300009148 Bacteria 4514
177 Ga0105241_10022194 3300009174 Bacteria 4699
178 Ga0105241_10221177 3300009174 Bacteria 1592
179 Ga0105241_10245040 3300009174 Bacteria 1517
180 Ga0105242_10005047 3300009176 Bacteria 10192
181 Ga0105242_10015883 3300009176 Bacteria 5849
182 Ga0105242_10154263 3300009176 Bacteria 2005
183 Ga0105242_10209748 3300009176 Bacteria 1735
184 Ga0105248_10007483 3300009177 Bacteria 11979
185 Ga0105248_10008842 3300009177 Bacteria 11064
186 Ga0105248_10023062 3300009177 Bacteria 6913
187 Ga0105248_10028561 3300009177 Bacteria 6215
188 Ga0105248_10069702 3300009177 Bacteria 3948
189 Ga0105248_10099217 3300009177 Bacteria 3281
190 Ga0105248_10103613 3300009177 Bacteria 3207
191 Ga0105248_10174288 3300009177 Bacteria 2425
192 Ga0105248_10222334 3300009177 Bacteria 2126
193 Ga0105237_10000829 3300009545 Bacteria 42345
194 Ga0105237_10012727 3300009545 Bacteria 8851
195 Ga0105237_10016752 3300009545 Bacteria 7609
196 Ga0105237_10063758 3300009545 Bacteria 3683
197 Ga0105238_10012864 3300009551 Bacteria 8444
198 Ga0105238_10017522 3300009551 Bacteria 7283
199 Ga0105238_10065839 3300009551 Bacteria 3625
200 Ga0105238_10262421 3300009551 Unclassified 1707
201 Ga0105249_10042107 3300009553 Bacteria 4152
202 Ga0105239_10060038 3300010375 Bacteria 4173
203 Ga0105239_10115797 3300010375 Bacteria 2974
204 Ga0105239_10246599 3300010375 Bacteria 2006
205 Ga0105246_10155413 3300011119 Bacteria 1736
206 Ga0157373_10044616 3300013100 Bacteria 3165
207 Ga0157373_10145533 3300013100 Bacteria 1667
208 Ga0157370_10002862 3300013104 Bacteria 20601
209 Ga0157370_10003363 3300013104 Bacteria 18832
210 Ga0157370_10006287 3300013104 Bacteria 13141
211 Ga0157369_10003673 3300013105 Bacteria 18224
212 Ga0157369_10007008 3300013105 Bacteria 13006
213 Ga0157369_10253444 3300013105 Bacteria 1836
214 Ga0157369_10359119 3300013105 Bacteria 1513
215 Ga0157374_10020037 3300013296 Bacteria 5930
216 Ga0157374_10079474 3300013296 Bacteria 3108
217 Ga0157378_10000048 3300013297 Bacteria 104914
218 Ga0157378_10113691 3300013297 Bacteria 2486
219 Ga0157378_10285054 3300013297 Bacteria 1594
220 Ga0157378_10495468 3300013297 Unclassified 1220
221 Ga0163162_10001226 3300013306 Bacteria 23960
222 Ga0163162_10051608 3300013306 Bacteria 4127
223 Ga0157372_10008271 3300013307 Bacteria 11061
224 Ga0157372_10009953 3300013307 Bacteria 10112
225 Ga0157372_10020556 3300013307 Bacteria 7123
226 Ga0157372_10061979 3300013307 Bacteria 4189
227 Ga0157372_10436681 3300013307 Bacteria 1526
228 Ga0157375_10006519 3300013308 Bacteria 10158
229 Ga0157375_10016090 3300013308 Bacteria 6710
230 Ga0157375_10092066 3300013308 Bacteria 3095
231 Ga0157375_10181807 3300013308 Bacteria 2254
232 Ga0157375_10283018 3300013308 Bacteria 1821
233 Ga0163163_10000156 3300014325 Bacteria 70968
234 Ga0163163_10001640 3300014325 Bacteria 18838
235 Ga0163163_10012445 3300014325 Bacteria 7751
236 Ga0163163_10055468 3300014325 Bacteria 3916
237 Ga0163163_10074422 3300014325 Bacteria 3388
238 Ga0163163_10086733 3300014325 Bacteria 3140
239 Ga0163163_10110398 3300014325 Bacteria 2778
240 Ga0163163_10118636 3300014325 Bacteria 2678
241 Ga0163163_10159202 3300014325 Bacteria 2303
242 Ga0163163_10199489 3300014325 Bacteria 2049
243 Ga0157380_10338839 3300014326 Bacteria 1402
244 Ga0157379_10115066 3300014968 Bacteria 2418
245 Ga0157376_10041415 3300014969 Bacteria 3770
246 Ga0157376_10070740 3300014969 Bacteria 2962
247 Ga0157376_10337230 3300014969 Bacteria 1439
248 Ga0213876_10033944 3300021384 Bacteria 2690
249 Ga0213875_10003665 3300021388 Bacteria 8678
250 Ga0213875_10017491 3300021388 Bacteria 3462
251 Ga0213875_10036350 3300021388 Bacteria 2323
252 Ga0213875_10049995 3300021388 Unclassified 1959
253 Ga0213871_10000014 3300021441 Bacteria 11633
254 Ga0207697_10012891 3300025315 Bacteria 3495
255 Ga0207656_10005843 3300025321 Bacteria 4384
256 Ga0207642_10025243 3300025899 Bacteria 2401
257 Ga0207710_10002769 3300025900 Bacteria 8015
258 Ga0207688_10084682 3300025901 Bacteria 1815
259 Ga0207643_10099183 3300025908 Bacteria 1707
260 Ga0207643_10110418 3300025908 Bacteria 1620
261 Ga0207684_10000130 3300025910 Bacteria 137931
262 Ga0207654_10002715 3300025911 Bacteria 8982
263 Ga0207654_10150104 3300025911 Bacteria 1495
264 Ga0207707_10007109 3300025912 Bacteria 9751
265 Ga0207707_10009246 3300025912 Bacteria 8551
266 Ga0207707_10164853 3300025912 Bacteria 1937
267 Ga0207695_10000735 3300025913 Bacteria 63549
268 Ga0207695_10003343 3300025913 Bacteria 22693
269 Ga0207695_10004632 3300025913 Bacteria 18649
270 Ga0207695_10017603 3300025913 Bacteria 8305
271 Ga0207695_10266307 3300025913 Bacteria 1610
272 Ga0207695_10272370 3300025913 Bacteria 1588
273 Ga0207671_10011368 3300025914 Bacteria 7251
274 Ga0207671_10028990 3300025914 Bacteria 4135
275 Ga0207663_10032914 3300025916 Bacteria 3082
276 Ga0207660_10006402 3300025917 Bacteria 7631
277 Ga0207657_10079238 3300025919 Bacteria 2764
278 Ga0207652_10043700 3300025921 Bacteria 3815
279 Ga0207646_10004920 3300025922 Bacteria 14288
280 Ga0207646_10076346 3300025922 Bacteria 2994
281 Ga0207681_10014247 3300025923 Bacteria 4936
282 Ga0207681_10111353 3300025923 Bacteria 1992
283 Ga0207694_10010833 3300025924 Bacteria 6882
284 Ga0207694_10093532 3300025924 Bacteria 2375
285 Ga0207694_10119397 3300025924 Bacteria 2104
286 Ga0207650_10000010 3300025925 Bacteria 454110
287 Ga0207650_10251584 3300025925 Bacteria 1431
288 Ga0207659_10091918 3300025926 Bacteria 2268
289 Ga0207687_10001155 3300025927 Bacteria 18001
290 Ga0207687_10019742 3300025927 Bacteria 4467
291 Ga0207687_10318592 3300025927 Bacteria 1258
292 Ga0207700_10002092 3300025928 Bacteria 11391
293 Ga0207700_10045360 3300025928 Bacteria 3243
294 Ga0207686_10006948 3300025934 Bacteria 6093
295 Ga0207686_10009804 3300025934 Bacteria 5204
296 Ga0207686_10010553 3300025934 Bacteria 5032
297 Ga0207686_10016548 3300025934 Bacteria 4139
298 Ga0207686_10053520 3300025934 Bacteria 2524
299 Ga0207686_10157152 3300025934 Bacteria 1590
300 Ga0207709_10029126 3300025935 Bacteria 3199
301 Ga0207670_10004103 3300025936 Bacteria 7799
302 Ga0207704_10090651 3300025938 Bacteria 2007
303 Ga0207691_10013743 3300025940 Bacteria 7735
304 Ga0207691_10078508 3300025940 Bacteria 2972
305 Ga0207711_10008004 3300025941 Bacteria 8842
306 Ga0207711_10015006 3300025941 Bacteria 6435
307 Ga0207711_10018972 3300025941 Bacteria 5721
308 Ga0207711_10036430 3300025941 Bacteria 4175
309 Ga0207711_10077141 3300025941 Bacteria 2904
310 Ga0207711_10256802 3300025941 Bacteria 1605
311 Ga0207711_10347458 3300025941 Bacteria 1373
312 Ga0207689_10014510 3300025942 Bacteria 6701
313 Ga0207689_10027470 3300025942 Bacteria 4763
314 Ga0207661_10000055 3300025944 Bacteria 86544
315 Ga0207661_10003574 3300025944 Bacteria 10812
316 Ga0207661_10025265 3300025944 Bacteria 4513
317 Ga0207661_10217742 3300025944 Bacteria 1686
318 Ga0207679_10060131 3300025945 Bacteria 2822
319 Ga0207667_10008109 3300025949 Bacteria 12517
320 Ga0207667_10020982 3300025949 Bacteria 7245
321 Ga0207667_10031888 3300025949 Bacteria 5683
322 Ga0207667_10037561 3300025949 Bacteria 5176
323 Ga0207667_10207542 3300025949 Bacteria 2008
324 Ga0207651_10000958 3300025960 Bacteria 12747
325 Ga0207712_10058160 3300025961 Bacteria 2731
326 Ga0207640_10124404 3300025981 Bacteria 1854
327 Ga0207658_10036943 3300025986 Bacteria 3505
328 Ga0207658_10139318 3300025986 Bacteria 1961
329 Ga0207658_10255876 3300025986 Bacteria 1490
330 Ga0207677_10119503 3300026023 Bacteria 1979
331 Ga0207703_10050255 3300026035 Bacteria 3374
332 Ga0207703_10096192 3300026035 Bacteria 2500
333 Ga0207703_10115430 3300026035 Bacteria 2297
334 Ga0207703_10148083 3300026035 Bacteria 2044
335 Ga0207703_10267996 3300026035 Bacteria 1546
336 Ga0207639_10041861 3300026041 Bacteria 3431
337 Ga0207678_10146740 3300026067 Bacteria 2014
338 Ga0207708_10001694 3300026075 Bacteria 16322
339 Ga0207702_10016738 3300026078 Bacteria 6069
340 Ga0207702_10021680 3300026078 Bacteria 5319
341 Ga0207702_10093190 3300026078 Bacteria 2641
342 Ga0207641_10052455 3300026088 Bacteria 3454
343 Ga0207641_10199549 3300026088 Bacteria 1844
344 Ga0207648_10114592 3300026089 Bacteria 2368
345 Ga0207676_10019146 3300026095 Bacteria 4989
346 Ga0207676_10019238 3300026095 Bacteria 4978
347 Ga0207676_10024955 3300026095 Bacteria 4431
348 Ga0207676_10045205 3300026095 Bacteria 3401
349 Ga0207676_10074544 3300026095 Bacteria 2734
350 Ga0207676_10138959 3300026095 Bacteria 2077
351 Ga0207674_10002399 3300026116 Bacteria 23688
352 Ga0207674_10012887 3300026116 Bacteria 9330
353 Ga0207675_100012425 3300026118 Bacteria 7956
354 Ga0207675_100094306 3300026118 Bacteria 2815
355 Ga0207675_100141622 3300026118 Bacteria 2285
356 Ga0207698_10040434 3300026142 Bacteria 3465
357 Ga0207698_10172799 3300026142 Bacteria 1905
358 Ga0268266_10286879 3300028379 Bacteria 1532
359 Ga0268264_10110084 3300028381 Bacteria 2411
360 Ga0268264_10144356 3300028381 Bacteria 2126
361 Ga0265323_10002678 3300028653 Bacteria 8045
362 Ga0265330_10025425 3300031235 Bacteria 2684
363 Ga0265328_10028138 3300031239 Bacteria 2104
364 Ga0265320_10000588 3300031240 Bacteria 27970
365 Ga0265325_10009463 3300031241 Bacteria 5686
366 Ga0265329_10011967 3300031242 Bacteria 3139
367 Ga0265329_10022277 3300031242 Bacteria 2121
368 Ga0265331_10002043 3300031250 Bacteria 13988
369 Ga0265331_10011289 3300031250 Bacteria 4898
370 Ga0265316_10001444 3300031344 Bacteria 25507
371 Ga0265316_10007310 3300031344 Bacteria 10419
372 Ga0265316_10027880 3300031344 Bacteria 4668
373 Ga0265316_10040714 3300031344 Bacteria 3723
374 Ga0265316_10050083 3300031344 Bacteria 3287
375 Ga0265316_10052849 3300031344 Bacteria 3185
376 Ga0265316_10067696 3300031344 Bacteria 2761
377 Ga0307408_100111679 3300031548 Bacteria 2100
378 Ga0265314_10000722 3300031711 Bacteria 39958
379 Ga0265314_10002745 3300031711 Bacteria 17599
380 Ga0265314_10005236 3300031711 Bacteria 11755
381 Ga0265314_10075441 3300031711 Bacteria 2243
382 Ga0265342_10135332 3300031712 Bacteria 1377
383 Ga0307405_10054866 3300031731 Bacteria 2490
384 Ga0307406_10031996 3300031901 Bacteria 3207
385 Ga0307406_10182882 3300031901 Bacteria 1528
386 Ga0307406_10220325 3300031901 Unclassified 1410
387 Ga0307412_10054712 3300031911 Bacteria 2650
388 Ga0307416_100274392 3300032002 Bacteria 1658
389 Ga0307414_10096307 3300032004 Bacteria 2214
390 Ga0373934_0018997 3300035086 Bacteria 2635
391 Ga0373934_0039861 3300035086 Bacteria 1852
392 Ga0373951_0000898 3300035091 Bacteria 8019
393 Ga0373923_0037861 3300035111 Bacteria 1974
394 Ga0373953_0016524 3300035117 Bacteria 2696
395 Ga0373954_0014269 3300035118 Bacteria 3543
396 Ga0373954_0028919 3300035118 Bacteria 2550
397 Ga0373954_0032434 3300035118 Bacteria 2414
398 Ga0373955_0046335 3300035172 Bacteria 2350
399 Ga0373955_0053265 3300035172 Bacteria 2209
400 Ga0373955_0142081 3300035172 Bacteria 1408
401 Ga0373924_0035004 3300035410 Bacteria 2036
402 Ga0373935_0100661 3300035692 Bacteria 1904
403 Ga0373935_0134972 3300035692 Bacteria 1662
404 Ga0373927_0003004 3300035695 Bacteria 12242
405 Ga0373927_0011587 3300035695 Bacteria 5873
406 Ga0373927_0016577 3300035695 Bacteria 4860
407 Ga0373927_0041065 3300035695 Bacteria 3000
408 Ga0373927_0133537 3300035695 Bacteria 1622
409 Ga0373947_0000400 3300035725 Bacteria 24469
410 Ga0373947_0032881 3300035725 Bacteria 3059
411 Ga0373947_0078770 3300035725 Unclassified 2035
412 Ga0373947_0131194 3300035725 Bacteria 1600
413 Ga0373937_0007280 3300036401 Bacteria 9578
414 Ga0373937_0019972 3300036401 Bacteria 6000
415 Ga0373937_0145970 3300036401 Bacteria 2215
416 Ga0373937_0147946 3300036401 Unclassified 2199
417 Ga0373925_0002373 3300037068 Bacteria 15107
418 Ga0373925_0088436 3300037068 Bacteria 2366
419 Ga0373925_0113117 3300037068 Bacteria 2099
420 Ga0436364_0014106 3300037853 Bacteria 9980
421 Ga0436364_0134857 3300037853 Bacteria 9145
422 Ga0436364_0228674 3300037853 Bacteria 21208
423 Ga0436364_0249540 3300037853 Bacteria 14870
424 Ga0436364_0334927 3300037853 Bacteria 4737
425 Ga0436364_0664274 3300037853 Bacteria 3067
426 Ga0436364_1394527 3300037853 Unclassified 1506
427 Ga0436365_0920056 3300039437 Bacteria 3750
428 Ga0436365_1006026 3300039437 Bacteria 4446
429 Ga0436365_1473770 3300039437 Bacteria 3152
430 Ga0436365_1689565 3300039437 Bacteria 1285
431 Ga0436365_1786451 3300039437 Bacteria 6119
432 Ga0436360_0906455 3300039438 Bacteria 16469
433 Ga0436361_0563692 3300039447 Bacteria 2258
434 Ga0436362_0892206 3300039453 Bacteria 6715
435 Ga0439458_0020633 3300042157 Bacteria 1522
436 Ga0451576_0074572 3300045051 Bacteria 3531
437 Ga0495592_0011626 3300046454 Bacteria 6666
438 Ga0495592_0055828 3300046454 Bacteria 2920
439 Ga0495592_0127309 3300046454 Bacteria 1785
440 Ga0495629_0140596 3300046459 Bacteria 1680
441 Ga0495651_0116071 3300046462 Bacteria 1973
442 Ga0495580_0003716 3300046472 Bacteria 12928
443 Ga0495580_0004230 3300046472 Bacteria 12074
444 Ga0495580_0211368 3300046472 Bacteria 1335
445 Ga0495582_0066794 3300046473 Bacteria 1987
446 Ga0495582_0164171 3300046473 Bacteria 1264
447 Ga0495664_0006026 3300046477 Bacteria 6683
448 Ga0495608_0174466 3300046511 Bacteria 1362
449 Ga0495628_0002968 3300046516 Bacteria 15218
450 Ga0495628_0060952 3300046516 Bacteria 2960
451 Ga0495665_0027644 3300046531 Bacteria 3044
452 Ga0495665_0079787 3300046531 Bacteria 1722
453 Ga0495645_0000916 3300046543 Bacteria 20098
454 Ga0495645_0009649 3300046543 Bacteria 6750
455 Ga0495645_0046484 3300046543 Bacteria 3164
456 Ga0495667_0011457 3300046559 Bacteria 6001
457 Ga0495667_0027050 3300046559 Bacteria 3866
458 Ga0495667_0100973 3300046559 Bacteria 1867
459 Ga0495635_0136398 3300046663 Bacteria 1672
460 Ga0495599_0003826 3300046678 Bacteria 8838
461 Ga0495623_0150097 3300046679 Bacteria 1378
462 Ga0495623_0160035 3300046679 Bacteria 1324
463 Ga0495646_0013469 3300046680 Bacteria 5198
464 Ga0495581_0150740 3300047315 Unclassified 1358
465 Ga0495604_0106488 3300047317 Bacteria 2051
466 Ga0495604_0185464 3300047317 Bacteria 1453
467 Ga0495674_0036685 3300047319 Bacteria 4411
468 Ga0495674_0049276 3300047319 Bacteria 3723
469 Ga0495674_0098392 3300047319 Unclassified 2491
470 Ga0495674_0118678 3300047319 Bacteria 2236
471 Ga0495674_0123336 3300047319 Bacteria 2188
472 Ga0495674_0213082 3300047319 Bacteria 1599
473 Ga0495684_0021554 3300047471 Bacteria 4961
474 Ga0495684_0086770 3300047471 Bacteria 2372
475 Ga0495602_0011355 3300048088 Bacteria 9215
476 Ga0496102_0037982 3300048905 Bacteria 4344
477 Ga0496104_0019778 3300048907 Bacteria 6165
478 Ga0496104_0047165 3300048907 Bacteria 4060
479 Ga0496104_0196422 3300048907 Bacteria 1930
480 Ga0496106_0069286 3300048909 Bacteria 2692
481 Ga0496108_0086892 3300048911 Bacteria 2655
482 Ga0496109_0031919 3300048912 Bacteria 4731
483 Ga0496112_0042226 3300048915 Bacteria 4461
484 Ga0496112_0191250 3300048915 Bacteria 2009
485 Ga0496112_0458881 3300048915 Bacteria 1212
486 Ga0501031_0020229 3300049568 Bacteria 4339
487 Ga0501032_0001362 3300049569 Bacteria 19394
488 Ga0501033_0022462 3300049570 Bacteria 4759
489 Ga0501036_0003624 3300049572 Bacteria 12349
490 Ga0501037_0001371 3300049573 Bacteria 17877
491 Ga0501038_0007946 3300049574 Bacteria 9775
492 Ga0501038_0018223 3300049574 Bacteria 6337
493 Ga0501039_0044857 3300049575 Bacteria 3415
494 Ga0501043_0004619 3300049579 Bacteria 11164
495 Ga0501046_0001140 3300049580 Bacteria 25891
496 Ga0501068_0002735 3300049584 Bacteria 9371
497 Ga0501069_0000135 3300049585 Bacteria 32299
498 Ga0501070_0004226 3300049586 Bacteria 12349
499 Ga0501072_0001379 3300049588 Bacteria 18248
500 Ga0501073_0001638 3300049589 Bacteria 16604
501 Ga0501074_0000835 3300049590 Bacteria 19579
502 Ga0501076_0056345 3300049592 Bacteria 3119
503 Ga0501077_0021108 3300049593 Bacteria 4120
504 Ga0501216_005724 3300049660 Bacteria 1883
505 Ga0501217_012341 3300049661 Bacteria 1902
506 Ga0501223_001670 3300049663 Bacteria 5094
507 Ga0501079_0005814 3300049741 Bacteria 9223
508 Ga0501080_0000101 3300049742 Bacteria 58881
509 Ga0501283_000325 3300049779 Bacteria 6309
510 Ga0501035_0027391 3300049822 Bacteria 5209
511 nmdc:mga03683_17375_c1 3300050489 Bacteria 2722
512 nmdc:mga03n38_430_c1 3300050490 Bacteria 10448
513 nmdc:mga00v17_127721_c1 3300050491 Bacteria 1623
514 nmdc:mga00v17_1445_c2 3300050491 Bacteria 10448
515 nmdc:mga00v17_1936_c1 3300050491 Bacteria 10705
516 nmdc:mga00v17_69_c1 3300050491 Bacteria 62156
517 nmdc:mga0yw44_107_c1 3300050492 Bacteria 29094
518 nmdc:mga0yw44_6475_c1 3300050492 Bacteria 5665
519 nmdc:mga06z11_5683_c1 3300050494 Bacteria 5023
520 nmdc:mga06z11_808_c1 3300050494 Bacteria 11440
521 nmdc:mga07m45_27_c1 3300050496 Bacteria 91154
522 nmdc:mga05p37_115117_c1 3300050507 Bacteria 3305
523 nmdc:mga09592_104835_c1 3300050508 Bacteria 2424
524 nmdc:mga09592_2716_c1 3300050508 Bacteria 14301
525 nmdc:mga0qj67_13451_c1 3300050509 Bacteria 6172
526 nmdc:mga0qj67_263446_c1 3300050509 Bacteria 1398
527 nmdc:mga0qj67_59373_c1 3300050509 Bacteria 3033
528 nmdc:mga08y16_13835_c1 3300050511 Bacteria 8493
529 nmdc:mga08y16_188097_c1 3300050511 Bacteria 2142
530 nmdc:mga0n895_89055_c1 3300050512 Unclassified 3087
531 nmdc:mga0rr50_8864_c1 3300050513 Bacteria 6283
532 nmdc:mga08x19_1203_c1 3300050514 Bacteria 16167
533 nmdc:mga08x19_89806_c1 3300050514 Bacteria 2027
534 nmdc:mga0a205_106821_c1 3300050515 Bacteria 2697
535 nmdc:mga0a205_72336_c1 3300050515 Bacteria 3331
536 nmdc:mga0a205_88175_c1 3300050515 Unclassified 2998
537 nmdc:mga0sz30_18_c2 3300050516 Bacteria 68595
538 Ga0495601_0026294 3300053077 Bacteria 3593
539 Ga0495619_0058143 3300053085 Bacteria 2566
540 Ga0500568_0000349 3300053139 Bacteria 35838
541 Ga0501084_0000244 3300054114 Bacteria 41061
542 Ga0501082_0000149 3300060353 Bacteria 58834
543 Ga0530510_0049310 3300061734 Bacteria 3043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10000131 Ga0075365_100001313 330
2 3300006051 Ga0075364_10000706 Ga0075364_1000070613 330
3 3300050491 nmdc:mga00v17_69_c1 nmdc:mga00v17_69_c1_28024_29256 330
4 3300050492 nmdc:mga0yw44_107_c1 nmdc:mga0yw44_107_c1_19585_20817 330
5 3300050494 nmdc:mga06z11_5683_c1 nmdc:mga06z11_5683_c1_2269_3501 330
6 3300005614 Ga0068856_100423527 Ga0068856_1004235271 335
7 3300006194 Ga0075427_10000404 Ga0075427_100004045 340
8 3300006048 Ga0075363_100014550 Ga0075363_1000145503 342
9 3300006051 Ga0075364_10026996 Ga0075364_100269963 342
10 3300006177 Ga0075362_10052795 Ga0075362_100527952 342
11 3300006178 Ga0075367_10002737 Ga0075367_100027373 342
12 3300006186 Ga0075369_10001648 Ga0075369_100016485 342
13 3300006353 Ga0075370_10000232 Ga0075370_100002328 342
14 3300006880 Ga0075429_100003016 Ga0075429_10000301614 342
15 3300050489 nmdc:mga03683_17375_c1 nmdc:mga03683_17375_c1_1060_2244 342
16 3300050490 nmdc:mga03n38_430_c1 nmdc:mga03n38_430_c1_4361_5545 342
17 3300050491 nmdc:mga00v17_1936_c1 nmdc:mga00v17_1936_c1_3988_5172 342
18 3300050494 nmdc:mga06z11_808_c1 nmdc:mga06z11_808_c1_5327_6511 342
19 3300050496 nmdc:mga07m45_27_c1 nmdc:mga07m45_27_c1_58994_60178 342
20 3300050508 nmdc:mga09592_2716_c1 nmdc:mga09592_2716_c1_432_1616 342
21 3300050516 nmdc:mga0sz30_18_c2 nmdc:mga0sz30_18_c2_64384_65568 342
22 3300021388 Ga0213875_10017491 Ga0213875_100174912 358
23 3300035695 Ga0373927_0003004 Ga0373927_0003004_6767_7936 363
24 3300035725 Ga0373947_0000400 Ga0373947_0000400_13101_14270 363
25 3300006028 Ga0070717_10196318 Ga0070717_101963181 365
26 3300009177 Ga0105248_10023062 Ga0105248_100230626 367
27 3300025908 Ga0207643_10099183 Ga0207643_100991832 369
28 3300039437 Ga0436365_1689565 Ga0436365_1689565_41_1156 369
29 3300031711 Ga0265314_10002745 Ga0265314_1000274515 370
30 3300025926 Ga0207659_10091918 Ga0207659_100919182 371
31 3300005614 Ga0068856_100056752 Ga0068856_1000567525 372
32 3300005329 Ga0070683_100260024 Ga0070683_1002600241 376
33 3300009174 Ga0105241_10221177 Ga0105241_102211772 376
34 3300025928 Ga0207700_10045360 Ga0207700_100453603 376
35 3300025944 Ga0207661_10217742 Ga0207661_102177421 376
36 3300035695 Ga0373927_0133537 Ga0373927_0133537_60_1244 377
37 3300046516 Ga0495628_0060952 Ga0495628_0060952_1620_2771 378
38 3300005354 Ga0070675_100157604 Ga0070675_1001576042 379
39 3300025941 Ga0207711_10347458 Ga0207711_103474581 379
40 3300005338 Ga0068868_100039981 Ga0068868_1000399812 383
41 3300005617 Ga0068859_100022162 Ga0068859_1000221625 383
42 3300005618 Ga0068864_100040419 Ga0068864_1000404191 383
43 3300005843 Ga0068860_100019352 Ga0068860_1000193523 383
44 3300006237 Ga0097621_100090191 Ga0097621_1000901912 383
45 3300006931 Ga0097620_100022163 Ga0097620_1000221635 383
46 3300009177 Ga0105248_10028561 Ga0105248_100285613 383
47 3300013296 Ga0157374_10020037 Ga0157374_100200375 383
48 3300013297 Ga0157378_10113691 Ga0157378_101136911 383
49 3300013306 Ga0163162_10001226 Ga0163162_1000122614 383
50 3300013308 Ga0157375_10092066 Ga0157375_100920662 383
51 3300013308 Ga0157375_10181807 Ga0157375_101818072 383
52 3300014325 Ga0163163_10074422 Ga0163163_100744222 383
53 3300014325 Ga0163163_10118636 Ga0163163_101186362 383
54 3300014969 Ga0157376_10070740 Ga0157376_100707402 383
55 3300025941 Ga0207711_10008004 Ga0207711_100080045 383
56 3300026095 Ga0207676_10019238 Ga0207676_100192385 383
57 3300045051 Ga0451576_0074572 Ga0451576_0074572_648_1811 383
58 3300009093 Ga0105240_10001428 Ga0105240_1000142825 384
59 3300009101 Ga0105247_10001044 Ga0105247_100010442 384
60 3300025900 Ga0207710_10002769 Ga0207710_100027696 384
61 3300025913 Ga0207695_10017603 Ga0207695_1001760312 384
62 3300014969 Ga0157376_10337230 Ga0157376_103372302 385
63 3300005329 Ga0070683_100000782 Ga0070683_1000007829 386
64 3300005436 Ga0070713_100033262 Ga0070713_1000332621 386
65 3300005535 Ga0070684_100000004 Ga0070684_100000004157 386
66 3300005563 Ga0068855_100107352 Ga0068855_1001073522 386
67 3300005842 Ga0068858_100360199 Ga0068858_1003601991 386
68 3300006038 Ga0075365_10012716 Ga0075365_100127162 386
69 3300006051 Ga0075364_10001601 Ga0075364_1000160111 386
70 3300009093 Ga0105240_10293426 Ga0105240_102934262 386
71 3300009177 Ga0105248_10099217 Ga0105248_100992171 386
72 3300009177 Ga0105248_10103613 Ga0105248_101036132 386
73 3300013105 Ga0157369_10359119 Ga0157369_103591191 386
74 3300014969 Ga0157376_10041415 Ga0157376_100414153 386
75 3300021388 Ga0213875_10036350 Ga0213875_100363502 386
76 3300025927 Ga0207687_10318592 Ga0207687_103185921 386
77 3300025934 Ga0207686_10010553 Ga0207686_100105536 386
78 3300025941 Ga0207711_10036430 Ga0207711_100364302 386
79 3300025941 Ga0207711_10256802 Ga0207711_102568022 386
80 3300025944 Ga0207661_10000055 Ga0207661_1000005569 386
81 3300025944 Ga0207661_10025265 Ga0207661_100252654 386
82 3300025949 Ga0207667_10037561 Ga0207667_100375613 386
83 3300025986 Ga0207658_10255876 Ga0207658_102558761 386
84 3300026142 Ga0207698_10172799 Ga0207698_101727992 386
85 3300031250 Ga0265331_10011289 Ga0265331_100112895 386
86 3300031344 Ga0265316_10001444 Ga0265316_1000144428 386
87 3300031344 Ga0265316_10027880 Ga0265316_100278804 386
88 3300031344 Ga0265316_10040714 Ga0265316_100407142 386
89 3300031344 Ga0265316_10050083 Ga0265316_100500832 386
90 3300031344 Ga0265316_10067696 Ga0265316_100676962 386
91 3300031711 Ga0265314_10000722 Ga0265314_1000072215 386
92 3300031711 Ga0265314_10005236 Ga0265314_1000523610 386
93 3300031712 Ga0265342_10135332 Ga0265342_101353322 386
94 3300035692 Ga0373935_0134972 Ga0373935_0134972_119_1285 386
95 3300035695 Ga0373927_0011587 Ga0373927_0011587_764_1930 386
96 3300037853 Ga0436364_0334927 Ga0436364_0334927_305_1483 386
97 3300037853 Ga0436364_0664274 Ga0436364_0664274_1730_2905 386
98 3300046454 Ga0495592_0011626 Ga0495592_0011626_2911_4086 386
99 3300046454 Ga0495592_0127309 Ga0495592_0127309_562_1737 386
100 3300046472 Ga0495580_0003716 Ga0495580_0003716_10222_11397 386
101 3300046472 Ga0495580_0211368 Ga0495580_0211368_81_1247 386
102 3300046473 Ga0495582_0164171 Ga0495582_0164171_17_1225 386
103 3300046477 Ga0495664_0006026 Ga0495664_0006026_4199_5374 386
104 3300046511 Ga0495608_0174466 Ga0495608_0174466_22_1197 386
105 3300046516 Ga0495628_0002968 Ga0495628_0002968_699_1874 386
106 3300046531 Ga0495665_0027644 Ga0495665_0027644_1718_2893 386
107 3300046543 Ga0495645_0000916 Ga0495645_0000916_15717_16892 386
108 3300046543 Ga0495645_0046484 Ga0495645_0046484_712_1887 386
109 3300046559 Ga0495667_0011457 Ga0495667_0011457_3508_4683 386
110 3300046559 Ga0495667_0027050 Ga0495667_0027050_259_1434 386
111 3300046663 Ga0495635_0136398 Ga0495635_0136398_258_1433 386
112 3300046678 Ga0495599_0003826 Ga0495599_0003826_58_1233 386
113 3300046679 Ga0495623_0160035 Ga0495623_0160035_120_1295 386
114 3300046680 Ga0495646_0013469 Ga0495646_0013469_3062_4237 386
115 3300047315 Ga0495581_0150740 Ga0495581_0150740_58_1233 386
116 3300047317 Ga0495604_0106488 Ga0495604_0106488_314_1489 386
117 3300047317 Ga0495604_0185464 Ga0495604_0185464_82_1257 386
118 3300047319 Ga0495674_0036685 Ga0495674_0036685_1234_2409 386
119 3300047319 Ga0495674_0118678 Ga0495674_0118678_659_1834 386
120 3300047471 Ga0495684_0086770 Ga0495684_0086770_971_2146 386
121 3300050491 nmdc:mga00v17_1445_c2 nmdc:mga00v17_1445_c2_4895_6076 386
122 3300050492 nmdc:mga0yw44_6475_c1 nmdc:mga0yw44_6475_c1_3966_5147 386
123 3300005329 Ga0070683_100033711 Ga0070683_1000337114 387
124 3300005336 Ga0070680_100000906 Ga0070680_10000090613 387
125 3300005336 Ga0070680_100002278 Ga0070680_1000022788 387
126 3300005367 Ga0070667_100208881 Ga0070667_1002088812 387
127 3300005435 Ga0070714_100004206 Ga0070714_10000420611 387
128 3300005435 Ga0070714_100014598 Ga0070714_1000145984 387
129 3300005436 Ga0070713_100001935 Ga0070713_1000019356 387
130 3300005436 Ga0070713_100262500 Ga0070713_1002625001 387
131 3300005439 Ga0070711_100023210 Ga0070711_1000232102 387
132 3300005439 Ga0070711_100048099 Ga0070711_1000480992 387
133 3300005455 Ga0070663_100081643 Ga0070663_1000816431 387
134 3300005458 Ga0070681_10007327 Ga0070681_1000732710 387
135 3300005458 Ga0070681_10007744 Ga0070681_100077445 387
136 3300005458 Ga0070681_10287069 Ga0070681_102870692 387
137 3300005518 Ga0070699_100094221 Ga0070699_1000942211 387
138 3300005530 Ga0070679_100081171 Ga0070679_1000811712 387
139 3300005535 Ga0070684_100018692 Ga0070684_1000186922 387
140 3300005546 Ga0070696_100001812 Ga0070696_10000181210 387
141 3300005548 Ga0070665_100096315 Ga0070665_1000963153 387
142 3300005563 Ga0068855_100007695 Ga0068855_1000076958 387
143 3300005563 Ga0068855_100018074 Ga0068855_1000180746 387
144 3300005563 Ga0068855_100021336 Ga0068855_1000213369 387
145 3300005563 Ga0068855_100141525 Ga0068855_1001415253 387
146 3300005564 Ga0070664_100075926 Ga0070664_1000759262 387
147 3300005614 Ga0068856_100004681 Ga0068856_1000046817 387
148 3300005614 Ga0068856_100039174 Ga0068856_1000391743 387
149 3300005614 Ga0068856_100367001 Ga0068856_1003670011 387
150 3300005617 Ga0068859_100054415 Ga0068859_1000544156 387
151 3300005618 Ga0068864_100036952 Ga0068864_1000369524 387
152 3300006028 Ga0070717_10029849 Ga0070717_100298493 387
153 3300006358 Ga0068871_100004539 Ga0068871_1000045395 387
154 3300006358 Ga0068871_100006668 Ga0068871_1000066687 387
155 3300006358 Ga0068871_100098014 Ga0068871_1000980143 387
156 3300006844 Ga0075428_100009001 Ga0075428_1000090012 387
157 3300006847 Ga0075431_100299919 Ga0075431_1002999192 387
158 3300006914 Ga0075436_100016731 Ga0075436_1000167316 387
159 3300006914 Ga0075436_100080015 Ga0075436_1000800152 387
160 3300006931 Ga0097620_100054415 Ga0097620_1000544156 387
161 3300009093 Ga0105240_10000167 Ga0105240_1000016717 387
162 3300009093 Ga0105240_10001386 Ga0105240_1000138634 387
163 3300009093 Ga0105240_10001660 Ga0105240_1000166025 387
164 3300009093 Ga0105240_10011426 Ga0105240_100114267 387
165 3300009093 Ga0105240_10137155 Ga0105240_101371552 387
166 3300009098 Ga0105245_10002831 Ga0105245_100028312 387
167 3300009098 Ga0105245_10032874 Ga0105245_100328744 387
168 3300009098 Ga0105245_10204841 Ga0105245_102048412 387
169 3300009101 Ga0105247_10106465 Ga0105247_101064651 387
170 3300009147 Ga0114129_10033645 Ga0114129_100336456 387
171 3300009174 Ga0105241_10022194 Ga0105241_100221942 387
172 3300009176 Ga0105242_10015883 Ga0105242_100158832 387
173 3300009176 Ga0105242_10154263 Ga0105242_101542633 387
174 3300009176 Ga0105242_10209748 Ga0105242_102097482 387
175 3300009177 Ga0105248_10174288 Ga0105248_101742882 387
176 3300009545 Ga0105237_10012727 Ga0105237_100127276 387
177 3300009545 Ga0105237_10016752 Ga0105237_100167524 387
178 3300009545 Ga0105237_10063758 Ga0105237_100637583 387
179 3300009551 Ga0105238_10012864 Ga0105238_100128644 387
180 3300009551 Ga0105238_10065839 Ga0105238_100658393 387
181 3300009551 Ga0105238_10262421 Ga0105238_102624212 387
182 3300010375 Ga0105239_10115797 Ga0105239_101157972 387
183 3300010375 Ga0105239_10246599 Ga0105239_102465993 387
184 3300011119 Ga0105246_10155413 Ga0105246_101554132 387
185 3300013104 Ga0157370_10002862 Ga0157370_1000286213 387
186 3300013104 Ga0157370_10003363 Ga0157370_1000336311 387
187 3300013104 Ga0157370_10006287 Ga0157370_100062877 387
188 3300013105 Ga0157369_10003673 Ga0157369_100036738 387
189 3300013105 Ga0157369_10007008 Ga0157369_100070087 387
190 3300013105 Ga0157369_10253444 Ga0157369_102534442 387
191 3300013296 Ga0157374_10079474 Ga0157374_100794743 387
192 3300013297 Ga0157378_10285054 Ga0157378_102850541 387
193 3300013297 Ga0157378_10495468 Ga0157378_104954681 387
194 3300013307 Ga0157372_10008271 Ga0157372_100082716 387
195 3300013307 Ga0157372_10020556 Ga0157372_100205564 387
196 3300013307 Ga0157372_10061979 Ga0157372_100619792 387
197 3300013308 Ga0157375_10016090 Ga0157375_100160906 387
198 3300013308 Ga0157375_10283018 Ga0157375_102830182 387
199 3300014325 Ga0163163_10001640 Ga0163163_1000164021 387
200 3300014325 Ga0163163_10012445 Ga0163163_100124452 387
201 3300014325 Ga0163163_10159202 Ga0163163_101592022 387
202 3300021384 Ga0213876_10033944 Ga0213876_100339441 387
203 3300021388 Ga0213875_10003665 Ga0213875_100036655 387
204 3300021388 Ga0213875_10049995 Ga0213875_100499952 387
205 3300021441 Ga0213871_10000014 Ga0213871_100000147 387
206 3300025911 Ga0207654_10002715 Ga0207654_100027158 387
207 3300025911 Ga0207654_10150104 Ga0207654_101501042 387
208 3300025912 Ga0207707_10007109 Ga0207707_100071096 387
209 3300025912 Ga0207707_10009246 Ga0207707_100092464 387
210 3300025912 Ga0207707_10164853 Ga0207707_101648531 387
211 3300025913 Ga0207695_10000735 Ga0207695_1000073528 387
212 3300025913 Ga0207695_10003343 Ga0207695_1000334319 387
213 3300025913 Ga0207695_10004632 Ga0207695_100046328 387
214 3300025913 Ga0207695_10272370 Ga0207695_102723702 387
215 3300025914 Ga0207671_10011368 Ga0207671_100113682 387
216 3300025914 Ga0207671_10028990 Ga0207671_100289902 387
217 3300025916 Ga0207663_10032914 Ga0207663_100329143 387
218 3300025917 Ga0207660_10006402 Ga0207660_100064028 387
219 3300025924 Ga0207694_10010833 Ga0207694_100108336 387
220 3300025927 Ga0207687_10001155 Ga0207687_1000115511 387
221 3300025927 Ga0207687_10019742 Ga0207687_100197424 387
222 3300025928 Ga0207700_10002092 Ga0207700_100020926 387
223 3300025934 Ga0207686_10006948 Ga0207686_100069485 387
224 3300025934 Ga0207686_10009804 Ga0207686_100098047 387
225 3300025934 Ga0207686_10157152 Ga0207686_101571521 387
226 3300025942 Ga0207689_10014510 Ga0207689_100145102 387
227 3300025944 Ga0207661_10003574 Ga0207661_100035747 387
228 3300025945 Ga0207679_10060131 Ga0207679_100601313 387
229 3300025949 Ga0207667_10008109 Ga0207667_100081096 387
230 3300025949 Ga0207667_10020982 Ga0207667_100209822 387
231 3300025949 Ga0207667_10031888 Ga0207667_100318883 387
232 3300025949 Ga0207667_10207542 Ga0207667_102075422 387
233 3300026023 Ga0207677_10119503 Ga0207677_101195033 387
234 3300026035 Ga0207703_10148083 Ga0207703_101480831 387
235 3300026035 Ga0207703_10267996 Ga0207703_102679961 387
236 3300026041 Ga0207639_10041861 Ga0207639_100418614 387
237 3300026078 Ga0207702_10016738 Ga0207702_100167382 387
238 3300026078 Ga0207702_10021680 Ga0207702_100216807 387
239 3300026078 Ga0207702_10093190 Ga0207702_100931902 387
240 3300026095 Ga0207676_10019146 Ga0207676_100191465 387
241 3300026116 Ga0207674_10012887 Ga0207674_100128876 387
242 3300028379 Ga0268266_10286879 Ga0268266_102868791 387
243 3300028653 Ga0265323_10002678 Ga0265323_100026787 387
244 3300031235 Ga0265330_10025425 Ga0265330_100254253 387
245 3300031239 Ga0265328_10028138 Ga0265328_100281383 387
246 3300031240 Ga0265320_10000588 Ga0265320_1000058814 387
247 3300031241 Ga0265325_10009463 Ga0265325_100094636 387
248 3300031242 Ga0265329_10011967 Ga0265329_100119672 387
249 3300031242 Ga0265329_10022277 Ga0265329_100222773 387
250 3300031250 Ga0265331_10002043 Ga0265331_1000204311 387
251 3300031344 Ga0265316_10007310 Ga0265316_100073109 387
252 3300031344 Ga0265316_10052849 Ga0265316_100528494 387
253 3300031711 Ga0265314_10075441 Ga0265314_100754412 387
254 3300035086 Ga0373934_0018997 Ga0373934_0018997_1215_2399 387
255 3300035086 Ga0373934_0039861 Ga0373934_0039861_380_1549 387
256 3300035111 Ga0373923_0037861 Ga0373923_0037861_694_1863 387
257 3300035117 Ga0373953_0016524 Ga0373953_0016524_639_1808 387
258 3300035118 Ga0373954_0014269 Ga0373954_0014269_403_1587 387
259 3300035118 Ga0373954_0028919 Ga0373954_0028919_1051_2235 387
260 3300035118 Ga0373954_0032434 Ga0373954_0032434_668_1837 387
261 3300035172 Ga0373955_0053265 Ga0373955_0053265_56_1225 387
262 3300035172 Ga0373955_0142081 Ga0373955_0142081_60_1229 387
263 3300035692 Ga0373935_0100661 Ga0373935_0100661_107_1276 387
264 3300035695 Ga0373927_0016577 Ga0373927_0016577_1188_2357 387
265 3300035695 Ga0373927_0041065 Ga0373927_0041065_33_1202 387
266 3300035725 Ga0373947_0032881 Ga0373947_0032881_714_1883 387
267 3300035725 Ga0373947_0078770 Ga0373947_0078770_587_1759 387
268 3300035725 Ga0373947_0131194 Ga0373947_0131194_329_1498 387
269 3300036401 Ga0373937_0007280 Ga0373937_0007280_7371_8540 387
270 3300036401 Ga0373937_0019972 Ga0373937_0019972_34_1218 387
271 3300036401 Ga0373937_0145970 Ga0373937_0145970_284_1459 387
272 3300036401 Ga0373937_0147946 Ga0373937_0147946_964_2136 387
273 3300037068 Ga0373925_0088436 Ga0373925_0088436_988_2205 387
274 3300037068 Ga0373925_0113117 Ga0373925_0113117_148_1317 387
275 3300037853 Ga0436364_0014106 Ga0436364_0014106_3241_4428 387
276 3300037853 Ga0436364_0134857 Ga0436364_0134857_1487_2671 387
277 3300037853 Ga0436364_0228674 Ga0436364_0228674_12427_13602 387
278 3300037853 Ga0436364_0249540 Ga0436364_0249540_7937_9121 387
279 3300037853 Ga0436364_1394527 Ga0436364_1394527_150_1319 387
280 3300039437 Ga0436365_0920056 Ga0436365_0920056_1482_2702 387
281 3300039437 Ga0436365_1006026 Ga0436365_1006026_1889_3058 387
282 3300039437 Ga0436365_1473770 Ga0436365_1473770_166_1341 387
283 3300039437 Ga0436365_1786451 Ga0436365_1786451_3947_5131 387
284 3300039438 Ga0436360_0906455 Ga0436360_0906455_9244_10428 387
285 3300039447 Ga0436361_0563692 Ga0436361_0563692_1031_2221 387
286 3300039453 Ga0436362_0892206 Ga0436362_0892206_1529_2704 387
287 3300046454 Ga0495592_0055828 Ga0495592_0055828_1381_2556 387
288 3300046459 Ga0495629_0140596 Ga0495629_0140596_462_1631 387
289 3300046462 Ga0495651_0116071 Ga0495651_0116071_640_1809 387
290 3300046472 Ga0495580_0004230 Ga0495580_0004230_7682_8851 387
291 3300046473 Ga0495582_0066794 Ga0495582_0066794_451_1620 387
292 3300046531 Ga0495665_0079787 Ga0495665_0079787_378_1547 387
293 3300046679 Ga0495623_0150097 Ga0495623_0150097_35_1204 387
294 3300047319 Ga0495674_0098392 Ga0495674_0098392_701_1870 387
295 3300047319 Ga0495674_0123336 Ga0495674_0123336_59_1228 387
296 3300047471 Ga0495684_0021554 Ga0495684_0021554_3052_4221 387
297 3300048088 Ga0495602_0011355 Ga0495602_0011355_2194_3369 387
298 3300048907 Ga0496104_0019778 Ga0496104_0019778_1086_2258 387
299 3300048915 Ga0496112_0458881 Ga0496112_0458881_17_1180 387
300 3300049568 Ga0501031_0020229 Ga0501031_0020229_1622_2791 387
301 3300049569 Ga0501032_0001362 Ga0501032_0001362_14299_15468 387
302 3300049570 Ga0501033_0022462 Ga0501033_0022462_1099_2268 387
303 3300049572 Ga0501036_0003624 Ga0501036_0003624_4823_5992 387
304 3300049573 Ga0501037_0001371 Ga0501037_0001371_11195_12364 387
305 3300049574 Ga0501038_0018223 Ga0501038_0018223_3364_4533 387
306 3300049575 Ga0501039_0044857 Ga0501039_0044857_167_1336 387
307 3300049579 Ga0501043_0004619 Ga0501043_0004619_1677_2846 387
308 3300049580 Ga0501046_0001140 Ga0501046_0001140_18464_19633 387
309 3300049584 Ga0501068_0002735 Ga0501068_0002735_1108_2277 387
310 3300049585 Ga0501069_0000135 Ga0501069_0000135_4890_6059 387
311 3300049586 Ga0501070_0004226 Ga0501070_0004226_4823_5992 387
312 3300049588 Ga0501072_0001379 Ga0501072_0001379_14321_15490 387
313 3300049589 Ga0501073_0001638 Ga0501073_0001638_1677_2846 387
314 3300049590 Ga0501074_0000835 Ga0501074_0000835_1677_2846 387
315 3300049592 Ga0501076_0056345 Ga0501076_0056345_616_1785 387
316 3300049593 Ga0501077_0021108 Ga0501077_0021108_1378_2547 387
317 3300049741 Ga0501079_0005814 Ga0501079_0005814_920_2089 387
318 3300049742 Ga0501080_0000101 Ga0501080_0000101_43703_44872 387
319 3300049822 Ga0501035_0027391 Ga0501035_0027391_1677_2846 387
320 3300050511 nmdc:mga08y16_188097_c1 nmdc:mga08y16_188097_c1_620_1828 387
321 3300050514 nmdc:mga08x19_1203_c1 nmdc:mga08x19_1203_c1_14055_15224 387
322 3300050514 nmdc:mga08x19_89806_c1 nmdc:mga08x19_89806_c1_371_1579 387
323 3300053139 Ga0500568_0000349 Ga0500568_0000349_6865_8037 387
324 3300054114 Ga0501084_0000244 Ga0501084_0000244_21843_23012 387
325 3300060353 Ga0501082_0000149 Ga0501082_0000149_2854_4032 387
326 3300005618 Ga0068864_100024814 Ga0068864_1000248142 388
327 3300005842 Ga0068858_100015305 Ga0068858_1000153052 388
328 3300009177 Ga0105248_10007483 Ga0105248_100074836 388
329 3300014968 Ga0157379_10115066 Ga0157379_101150662 388
330 3300025941 Ga0207711_10015006 Ga0207711_100150064 388
331 3300025981 Ga0207640_10124404 Ga0207640_101244042 388
332 3300026088 Ga0207641_10052455 Ga0207641_100524552 388
333 3300026095 Ga0207676_10045205 Ga0207676_100452052 388
334 3300026142 Ga0207698_10040434 Ga0207698_100404341 388
335 3300035172 Ga0373955_0046335 Ga0373955_0046335_465_1640 388
336 3300035410 Ga0373924_0035004 Ga0373924_0035004_88_1263 388
337 3300046543 Ga0495645_0009649 Ga0495645_0009649_1725_2900 388
338 3300046559 Ga0495667_0100973 Ga0495667_0100973_459_1634 388
339 3300047319 Ga0495674_0049276 Ga0495674_0049276_361_1533 388
340 3300047319 Ga0495674_0213082 Ga0495674_0213082_219_1394 388
341 3300048907 Ga0496104_0047165 Ga0496104_0047165_2714_3883 388
342 3300048911 Ga0496108_0086892 Ga0496108_0086892_922_2091 388
343 3300048912 Ga0496109_0031919 Ga0496109_0031919_2815_3987 388
344 3300053077 Ga0495601_0026294 Ga0495601_0026294_579_1754 388
345 3300053085 Ga0495619_0058143 Ga0495619_0058143_674_1843 388
346 3300005338 Ga0068868_100063212 Ga0068868_1000632125 389
347 3300014325 Ga0163163_10086733 Ga0163163_100867332 389
348 3300025923 Ga0207681_10111353 Ga0207681_101113532 389
349 3300025986 Ga0207658_10139318 Ga0207658_101393182 389
350 3300049779 Ga0501283_000325 Ga0501283_000325_3342_4547 389
351 3300005328 Ga0070676_10009459 Ga0070676_100094592 390
352 3300005334 Ga0068869_100221871 Ga0068869_1002218711 390
353 3300005330 Ga0070690_100029080 Ga0070690_1000290802 391
354 3300005340 Ga0070689_100059585 Ga0070689_1000595854 391
355 3300005543 Ga0070672_100033246 Ga0070672_1000332463 391
356 3300005546 Ga0070696_100148651 Ga0070696_1001486511 391
357 3300005615 Ga0070702_100038951 Ga0070702_1000389513 391
358 3300006844 Ga0075428_100178367 Ga0075428_1001783672 391
359 3300006880 Ga0075429_100041444 Ga0075429_1000414443 391
360 3300007076 Ga0075435_100000569 Ga0075435_1000005694 391
361 3300009094 Ga0111539_10078972 Ga0111539_100789723 391
362 3300009553 Ga0105249_10042107 Ga0105249_100421072 391
363 3300014326 Ga0157380_10338839 Ga0157380_103388391 391
364 3300025908 Ga0207643_10110418 Ga0207643_101104182 391
365 3300025938 Ga0207704_10090651 Ga0207704_100906512 391
366 3300025940 Ga0207691_10078508 Ga0207691_100785084 391
367 3300025960 Ga0207651_10000958 Ga0207651_100009584 391
368 3300026088 Ga0207641_10199549 Ga0207641_101995492 391
369 3300028381 Ga0268264_10110084 Ga0268264_101100842 391
370 3300050508 nmdc:mga09592_104835_c1 nmdc:mga09592_104835_c1_930_2117 391
371 3300050511 nmdc:mga08y16_13835_c1 nmdc:mga08y16_13835_c1_444_1631 391
372 3300050513 nmdc:mga0rr50_8864_c1 nmdc:mga0rr50_8864_c1_1521_2720 391
373 3300037068 Ga0373925_0002373 Ga0373925_0002373_8737_9960 392
374 3300048915 Ga0496112_0042226 Ga0496112_0042226_1418_2623 392
375 3300005937 Ga0081455_10032863 Ga0081455_100328632 393
376 3300005981 Ga0081538_10007618 Ga0081538_100076182 393
377 3300005981 Ga0081538_10021911 Ga0081538_100219113 393
378 3300005981 Ga0081538_10034673 Ga0081538_100346732 393
379 3300006852 Ga0075433_10313912 Ga0075433_103139121 393
380 3300050509 nmdc:mga0qj67_13451_c1 nmdc:mga0qj67_13451_c1_1133_2341 393
381 3300006051 Ga0075364_10208196 Ga0075364_102081961 394
382 3300050491 nmdc:mga00v17_127721_c1 nmdc:mga00v17_127721_c1_350_1579 394
383 3300009147 Ga0114129_10605711 Ga0114129_106057111 395
384 3300050515 nmdc:mga0a205_106821_c1 nmdc:mga0a205_106821_c1_202_1410 395
385 3300005985 Ga0081539_10006601 Ga0081539_100066017 401
386 3300000532 CNAas_1000040 CNAas_10000407 402
387 3300002459 JGI24751J29686_10000030 JGI24751J29686_1000003036 402
388 3300003203 JGI25406J46586_10004412 JGI25406J46586_100044125 402
389 3300005288 Ga0065714_10064504 Ga0065714_1006450422 402
390 3300005290 Ga0065712_10007288 Ga0065712_100072882 402
391 3300005290 Ga0065712_10015493 Ga0065712_100154932 402
392 3300005290 Ga0065712_10067766 Ga0065712_1006776622 402
393 3300005293 Ga0065715_10089158 Ga0065715_1008915810 402
394 3300005329 Ga0070683_100271933 Ga0070683_1002719331 402
395 3300005331 Ga0070670_100002791 Ga0070670_10000279110 402
396 3300005331 Ga0070670_100129551 Ga0070670_1001295512 402
397 3300005331 Ga0070670_100195300 Ga0070670_1001953001 402
398 3300005334 Ga0068869_100031649 Ga0068869_1000316492 402
399 3300005336 Ga0070680_100188871 Ga0070680_1001888712 402
400 3300005338 Ga0068868_100189998 Ga0068868_1001899982 402
401 3300005339 Ga0070660_100110462 Ga0070660_1001104622 402
402 3300005340 Ga0070689_100006471 Ga0070689_1000064712 402
403 3300005345 Ga0070692_10074309 Ga0070692_100743092 402
404 3300005364 Ga0070673_100134851 Ga0070673_1001348512 402
405 3300005364 Ga0070673_100225285 Ga0070673_1002252852 402
406 3300005366 Ga0070659_100004306 Ga0070659_1000043065 402
407 3300005441 Ga0070700_100000719 Ga0070700_1000007194 402
408 3300005444 Ga0070694_100008855 Ga0070694_1000088554 402
409 3300005444 Ga0070694_100131549 Ga0070694_1001315492 402
410 3300005445 Ga0070708_100000288 Ga0070708_10000028815 402
411 3300005458 Ga0070681_10051872 Ga0070681_100518725 402
412 3300005467 Ga0070706_100000125 Ga0070706_10000012565 402
413 3300005467 Ga0070706_100002798 Ga0070706_10000279815 402
414 3300005467 Ga0070706_100198172 Ga0070706_1001981722 402
415 3300005468 Ga0070707_100003600 Ga0070707_1000036004 402
416 3300005468 Ga0070707_100007466 Ga0070707_1000074667 402
417 3300005468 Ga0070707_100269503 Ga0070707_1002695032 402
418 3300005468 Ga0070707_100343404 Ga0070707_1003434041 402
419 3300005471 Ga0070698_100005037 Ga0070698_1000050373 402
420 3300005471 Ga0070698_100006865 Ga0070698_1000068658 402
421 3300005471 Ga0070698_100026885 Ga0070698_1000268853 402
422 3300005518 Ga0070699_100000880 Ga0070699_10000088015 402
423 3300005530 Ga0070679_100077077 Ga0070679_1000770772 402
424 3300005535 Ga0070684_100138444 Ga0070684_1001384442 402
425 3300005536 Ga0070697_100108356 Ga0070697_1001083562 402
426 3300005539 Ga0068853_100054585 Ga0068853_1000545852 402
427 3300005543 Ga0070672_100016594 Ga0070672_1000165943 402
428 3300005544 Ga0070686_100022101 Ga0070686_1000221015 402
429 3300005547 Ga0070693_100054472 Ga0070693_1000544723 402
430 3300005549 Ga0070704_100000897 Ga0070704_10000089710 402
431 3300005564 Ga0070664_100047571 Ga0070664_1000475715 402
432 3300005615 Ga0070702_100010971 Ga0070702_1000109711 402
433 3300005617 Ga0068859_100009084 Ga0068859_1000090843 402
434 3300005617 Ga0068859_100059991 Ga0068859_1000599914 402
435 3300005617 Ga0068859_100072850 Ga0068859_1000728502 402
436 3300005618 Ga0068864_100012799 Ga0068864_1000127995 402
437 3300005618 Ga0068864_100016856 Ga0068864_1000168564 402
438 3300005618 Ga0068864_100045644 Ga0068864_1000456442 402
439 3300005718 Ga0068866_10114216 Ga0068866_101142161 402
440 3300005719 Ga0068861_100047932 Ga0068861_1000479322 402
441 3300005719 Ga0068861_100125700 Ga0068861_1001257002 402
442 3300005834 Ga0068851_10010828 Ga0068851_100108284 402
443 3300005841 Ga0068863_100077675 Ga0068863_1000776751 402
444 3300005842 Ga0068858_100070213 Ga0068858_1000702132 402
445 3300005843 Ga0068860_100089275 Ga0068860_1000892752 402
446 3300006844 Ga0075428_100103241 Ga0075428_1001032412 402
447 3300006846 Ga0075430_100076170 Ga0075430_1000761703 402
448 3300006847 Ga0075431_100207480 Ga0075431_1002074802 402
449 3300006852 Ga0075433_10045889 Ga0075433_100458893 402
450 3300006871 Ga0075434_100019404 Ga0075434_1000194044 402
451 3300006871 Ga0075434_100035585 Ga0075434_1000355854 402
452 3300006871 Ga0075434_100173547 Ga0075434_1001735472 402
453 3300006931 Ga0097620_100009084 Ga0097620_1000090849 402
454 3300006931 Ga0097620_100059986 Ga0097620_1000599864 402
455 3300006931 Ga0097620_100072856 Ga0097620_1000728562 402
456 3300009093 Ga0105240_10158004 Ga0105240_101580042 402
457 3300009147 Ga0114129_10021586 Ga0114129_100215867 402
458 3300009147 Ga0114129_10578413 Ga0114129_105784131 402
459 3300009148 Ga0105243_10000474 Ga0105243_100004746 402
460 3300009148 Ga0105243_10025565 Ga0105243_100255652 402
461 3300009174 Ga0105241_10245040 Ga0105241_102450402 402
462 3300009176 Ga0105242_10005047 Ga0105242_100050477 402
463 3300009177 Ga0105248_10008842 Ga0105248_100088427 402
464 3300009177 Ga0105248_10069702 Ga0105248_100697023 402
465 3300009177 Ga0105248_10222334 Ga0105248_102223341 402
466 3300009545 Ga0105237_10000829 Ga0105237_1000082915 402
467 3300009551 Ga0105238_10017522 Ga0105238_100175222 402
468 3300010375 Ga0105239_10060038 Ga0105239_100600383 402
469 3300013100 Ga0157373_10044616 Ga0157373_100446162 402
470 3300013100 Ga0157373_10145533 Ga0157373_101455331 402
471 3300013297 Ga0157378_10000048 Ga0157378_1000004822 402
472 3300013306 Ga0163162_10051608 Ga0163162_100516082 402
473 3300013307 Ga0157372_10009953 Ga0157372_100099532 402
474 3300013307 Ga0157372_10436681 Ga0157372_104366811 402
475 3300013308 Ga0157375_10006519 Ga0157375_100065199 402
476 3300014325 Ga0163163_10000156 Ga0163163_1000015646 402
477 3300014325 Ga0163163_10055468 Ga0163163_100554682 402
478 3300014325 Ga0163163_10110398 Ga0163163_101103982 402
479 3300014325 Ga0163163_10199489 Ga0163163_101994892 402
480 3300025315 Ga0207697_10012891 Ga0207697_100128913 402
481 3300025321 Ga0207656_10005843 Ga0207656_100058433 402
482 3300025899 Ga0207642_10025243 Ga0207642_100252432 402
483 3300025901 Ga0207688_10084682 Ga0207688_100846822 402
484 3300025910 Ga0207684_10000130 Ga0207684_10000130107 402
485 3300025913 Ga0207695_10266307 Ga0207695_102663072 402
486 3300025919 Ga0207657_10079238 Ga0207657_100792383 402
487 3300025921 Ga0207652_10043700 Ga0207652_100437002 402
488 3300025922 Ga0207646_10004920 Ga0207646_100049208 402
489 3300025922 Ga0207646_10076346 Ga0207646_100763463 402
490 3300025923 Ga0207681_10014247 Ga0207681_100142473 402
491 3300025924 Ga0207694_10093532 Ga0207694_100935322 402
492 3300025924 Ga0207694_10119397 Ga0207694_101193972 402
493 3300025925 Ga0207650_10000010 Ga0207650_10000010307 402
494 3300025925 Ga0207650_10251584 Ga0207650_102515841 402
495 3300025934 Ga0207686_10016548 Ga0207686_100165482 402
496 3300025934 Ga0207686_10053520 Ga0207686_100535203 402
497 3300025935 Ga0207709_10029126 Ga0207709_100291262 402
498 3300025936 Ga0207670_10004103 Ga0207670_100041033 402
499 3300025940 Ga0207691_10013743 Ga0207691_100137432 402
500 3300025941 Ga0207711_10018972 Ga0207711_100189724 402
501 3300025941 Ga0207711_10077141 Ga0207711_100771414 402
502 3300025942 Ga0207689_10027470 Ga0207689_100274703 402
503 3300025961 Ga0207712_10058160 Ga0207712_100581602 402
504 3300025986 Ga0207658_10036943 Ga0207658_100369432 402
505 3300026035 Ga0207703_10050255 Ga0207703_100502552 402
506 3300026035 Ga0207703_10096192 Ga0207703_100961923 402
507 3300026035 Ga0207703_10115430 Ga0207703_101154302 402
508 3300026067 Ga0207678_10146740 Ga0207678_101467401 402
509 3300026075 Ga0207708_10001694 Ga0207708_100016943 402
510 3300026089 Ga0207648_10114592 Ga0207648_101145922 402
511 3300026095 Ga0207676_10024955 Ga0207676_100249554 402
512 3300026095 Ga0207676_10074544 Ga0207676_100745442 402
513 3300026095 Ga0207676_10138959 Ga0207676_101389592 402
514 3300026116 Ga0207674_10002399 Ga0207674_1000239916 402
515 3300026118 Ga0207675_100012425 Ga0207675_1000124255 402
516 3300026118 Ga0207675_100094306 Ga0207675_1000943062 402
517 3300026118 Ga0207675_100141622 Ga0207675_1001416222 402
518 3300028381 Ga0268264_10144356 Ga0268264_101443562 402
519 3300031548 Ga0307408_100111679 Ga0307408_1001116792 402
520 3300031731 Ga0307405_10054866 Ga0307405_100548662 402
521 3300031901 Ga0307406_10031996 Ga0307406_100319964 402
522 3300031901 Ga0307406_10182882 Ga0307406_101828821 402
523 3300031901 Ga0307406_10220325 Ga0307406_102203251 402
524 3300031911 Ga0307412_10054712 Ga0307412_100547122 402
525 3300032002 Ga0307416_100274392 Ga0307416_1002743922 402
526 3300032004 Ga0307414_10096307 Ga0307414_100963072 402
527 3300035091 Ga0373951_0000898 Ga0373951_0000898_2989_4197 402
528 3300042157 Ga0439458_0020633 Ga0439458_0020633_191_1402 402
529 3300048905 Ga0496102_0037982 Ga0496102_0037982_594_1802 402
530 3300048907 Ga0496104_0196422 Ga0496104_0196422_46_1254 402
531 3300048909 Ga0496106_0069286 Ga0496106_0069286_1289_2512 402
532 3300048915 Ga0496112_0191250 Ga0496112_0191250_368_1576 402
533 3300049574 Ga0501038_0007946 Ga0501038_0007946_6570_7793 402
534 3300049660 Ga0501216_005724 Ga0501216_005724_630_1841 402
535 3300049661 Ga0501217_012341 Ga0501217_012341_562_1770 402
536 3300049663 Ga0501223_001670 Ga0501223_001670_2114_3325 402
537 3300050507 nmdc:mga05p37_115117_c1 nmdc:mga05p37_115117_c1_681_1889 402
538 3300050509 nmdc:mga0qj67_263446_c1 nmdc:mga0qj67_263446_c1_117_1325 402
539 3300050509 nmdc:mga0qj67_59373_c1 nmdc:mga0qj67_59373_c1_1452_2669 402
540 3300050512 nmdc:mga0n895_89055_c1 nmdc:mga0n895_89055_c1_832_2040 402
541 3300050515 nmdc:mga0a205_72336_c1 nmdc:mga0a205_72336_c1_416_1624 402
542 3300050515 nmdc:mga0a205_88175_c1 nmdc:mga0a205_88175_c1_302_1510 402
543 3300061734 Ga0530510_0049310 Ga0530510_0049310_432_1643 402

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00162

PGK

Phosphoglycerate kinase

50

418

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1php-assembly1.cif.gz_A structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms 0.9761 1 402
3uwd-assembly1.cif.gz_A crystal structure of phosphoglycerate kinase from bacillus anthracis 0.9756 1 402
1php-assembly1.cif.gz_A structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms 0.9737 1 402
3uwd-assembly1.cif.gz_A crystal structure of phosphoglycerate kinase from bacillus anthracis 0.9732 1 402
1v6s-assembly2.cif.gz_B crystal structure of phosphoglycerate kinase from thermus thermophilus hb8 0.9706 4 399
ID Description Score Start End Superfamily
3q3vB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain 0.9652 179 388 3.40.50.1260
af_A0A0P0V994_190_315_3.40.50.1260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain 0.9622 185 314 3.40.50.1260
af_P0A799_178_379_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9578 184 396 3.30.200.20
af_E9AGU0_8_189_3.40.50.1260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain 0.9559 5 171 3.40.50.1260
af_A0A1D6FSN1_1_174_3.40.50.1260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain 0.9546 223 400 3.40.50.1260
ID Description Score Start End GO Terms
AF-A0A5C8MQH9-F1-model_v4 Phosphoglycerate kinase (EC 2.7.2.3) 0.9853 1 265 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0043531
AF-A0A7C5UQJ2-F1-model_v4 Phosphoglycerate kinase (EC 2.7.2.3) 0.9843 75 401 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0043531
AF-X1N9S6-F1-model_v4 phosphoglycerate kinase (EC 2.7.2.3) 0.9837 77 337 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0043531
AF-A0A059LCB8-F1-model_v4 phosphoglycerate kinase (EC 2.7.2.3) 0.9825 49 255 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0043531
AF-A0A382Y1K5-F1-model_v4 phosphoglycerate kinase (EC 2.7.2.3) 0.9824 3 177 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0043531

Feature Viewer

pLDDT pTM Quality
93.76 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map