F461671

General Info

Members Datasets Scaffolds Average Seq Length
543 289 1087 134

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0538871|Ga0501031_0538871_204_656
Length 150
Sequence LSYKAAESVESQRMNPKIDWAELFFSSSGRAGQVASTLAAAVLLLILSLYEALTAGPLQLLTGWIVYPVLLFCGACVLSKRLHDRGRSGWWAAIILGAVIMVWPAPKGFFDFVAMMVLIWAVIDLCVMPGERGDNRYGPSLYKPAAPRDI

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
203 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
204 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
231 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
232 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
233 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
234 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
235 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
236 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
237 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
238 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
239 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
240 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
241 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
242 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
243 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
244 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
245 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
246 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
247 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
248 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
249 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
250 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
251 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
252 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
256 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
257 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
258 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
259 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
262 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
263 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
264 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
265 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
266 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
267 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
268 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
269 2643221583 Caulobacter sp. Root655 Isolate Unclassified
270 2643221584 Caulobacter sp. Root656 Isolate Unclassified
271 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
272 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
273 2643221640 Caulobacter sp. Root342 Isolate Unclassified
274 2643221642 Caulobacter sp. Root343 Isolate Unclassified
275 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
276 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
277 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
278 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
279 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
280 2818991435 Caulobacter henricii 536 Isolate Unclassified
281 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
282 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
283 2849560528 Caulobacter zeae 410 Isolate Unclassified
284 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
285 2851153111 Caulobacter radicis 736 Isolate Unclassified
286 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
287 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
288 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
289 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.84
Metatranscriptomes 0
Isolates 5.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.05
Nodule 0
Rhizoplane 3.5
Rhizosphere 67.59
Stem 0
Stem Tuber 0
Unclassified 1.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0538871 3300049568 Bacteria 752
2 rootH1_10032836 3300003316 Bacteria 3421
3 rootH1_10093935 3300003316 Bacteria 1991
4 rootH2_10029287 3300003320 Bacteria 3985
5 rootL2_10206680 3300003322 Bacteria 3869
6 rootL2_10213182 3300003322 Bacteria 1169
7 rootH1_10008830 3300003323 Bacteria 4156
8 rootH1_10035872 3300003316 Unclassified 3431
9 rootH1_10035872 3300003323 Bacteria 6513
10 rootH1_10088882 3300003323 Bacteria 1472
11 Ga0055526_1022903 3300003771 Bacteria 2104
12 Ga0055524_1020856 3300003775 Bacteria 2192
13 Ga0055536_1008251 3300003781 Bacteria 4513
14 Ga0055536_1015268 3300003781 Bacteria 2641
15 Ga0055528_1004737 3300003790 Bacteria 6488
16 Ga0055528_1011576 3300003790 Bacteria 3490
17 Ga0055530_10005763 3300003791 Bacteria 5755
18 Ga0055530_10012636 3300003791 Bacteria 2930
19 Ga0055530_10016447 3300003791 Bacteria 2362
20 Ga0055540_1034497 3300003792 Bacteria 1138
21 Ga0055531_10002085 3300003794 Bacteria 13732
22 Ga0055531_10017200 3300003794 Bacteria 3067
23 Ga0055531_10026500 3300003794 Bacteria 2066
24 Ga0055543_1010005 3300004625 Bacteria 2010
25 Ga0065165_1000506 3300005262 Bacteria 60005
26 Ga0065165_1001706 3300005262 Bacteria 22057
27 Ga0070658_10024306 3300005327 Bacteria 4861
28 Ga0070658_10054643 3300005327 Bacteria 3242
29 Ga0070658_11441049 3300005327 Bacteria 597
30 Ga0070683_100363182 3300005329 Bacteria 1379
31 Ga0070670_100534640 3300005331 Bacteria 1045
32 Ga0068869_100105104 3300005334 Bacteria 2141
33 Ga0068869_100332791 3300005334 Bacteria 1234
34 Ga0070666_11293719 3300005335 Bacteria 544
35 Ga0070680_100002679 3300005336 Bacteria 13197
36 Ga0070682_100456017 3300005337 Bacteria 980
37 Ga0068868_100562774 3300005338 Bacteria 1006
38 Ga0070660_100085850 3300005339 Bacteria 2476
39 Ga0070660_100998312 3300005339 Bacteria 707
40 Ga0070691_10007752 3300005341 Bacteria 4915
41 Ga0070669_100520179 3300005353 Bacteria 989
42 Ga0070671_100050444 3300005355 Bacteria 3461
43 Ga0070671_100172804 3300005355 Bacteria 1828
44 Ga0070659_100002377 3300005366 Bacteria 13375
45 Ga0070659_100011164 3300005366 Bacteria 6636
46 Ga0070659_100023772 3300005366 Bacteria 4692
47 Ga0070667_100257941 3300005367 Bacteria 1560
48 Ga0070714_100927149 3300005435 Bacteria 846
49 Ga0070678_100052825 3300005456 Bacteria 2952
50 Ga0070678_101144956 3300005456 Bacteria 720
51 Ga0070662_100146847 3300005457 Bacteria 1832
52 Ga0070681_10041940 3300005458 Bacteria 4587
53 Ga0070681_10222133 3300005458 Bacteria 1804
54 Ga0068867_100834262 3300005459 Bacteria 825
55 Ga0070679_100007990 3300005530 Bacteria 9931
56 Ga0070679_100182634 3300005530 Bacteria 2070
57 Ga0070679_101206638 3300005530 Unclassified 702
58 Ga0068853_100007684 3300005539 Bacteria 8647
59 Ga0068853_100066978 3300005539 Bacteria 3119
60 Ga0068853_100644726 3300005539 Bacteria 1008
61 Ga0070665_100000121 3300005548 Bacteria 147683
62 Ga0070665_100036176 3300005548 Bacteria 4967
63 Ga0070665_100071300 3300005548 Bacteria 3481
64 Ga0070665_101149582 3300005548 Bacteria 787
65 Ga0068855_100066792 3300005563 Bacteria 4192
66 Ga0068855_100100352 3300005563 Bacteria 3333
67 Ga0068855_100155178 3300005563 Bacteria 2602
68 Ga0068855_100178658 3300005563 Bacteria 2400
69 Ga0068855_100378451 3300005563 Bacteria 1555
70 Ga0070664_100089462 3300005564 Bacteria 2664
71 Ga0068857_101438482 3300005577 Bacteria 671
72 Ga0068854_100365729 3300005578 Bacteria 1184
73 Ga0068856_100118542 3300005614 Bacteria 2648
74 Ga0068856_100685831 3300005614 Bacteria 1045
75 Ga0068856_101012825 3300005614 Bacteria 849
76 Ga0068856_101196099 3300005614 Bacteria 776
77 Ga0068852_100892564 3300005616 Bacteria 906
78 Ga0068852_101069301 3300005616 Bacteria 827
79 Ga0068852_102262367 3300005616 Bacteria 565
80 Ga0068859_102149943 3300005617 Bacteria 616
81 Ga0068864_100046100 3300005618 Bacteria 3740
82 Ga0068864_100364349 3300005618 Bacteria 1367
83 Ga0068864_100670771 3300005618 Bacteria 1011
84 Ga0068861_102021955 3300005719 Bacteria 575
85 Ga0068863_100271221 3300005841 Bacteria 1642
86 Ga0068863_100509332 3300005841 Bacteria 1186
87 Ga0068863_100520706 3300005841 Bacteria 1172
88 Ga0068863_100663851 3300005841 Bacteria 1035
89 Ga0075369_10002234 3300006186 Bacteria 6862
90 Ga0075366_10006285 3300006195 Bacteria 6498
91 Ga0075366_10163633 3300006195 Bacteria 1349
92 Ga0097621_100528040 3300006237 Bacteria 1072
93 Ga0097621_100716774 3300006237 Bacteria 922
94 Ga0075370_10168834 3300006353 Bacteria 1285
95 Ga0068865_100036456 3300006881 Bacteria 3316
96 Ga0097620_102149480 3300006931 Bacteria 616
97 Ga0105240_10028222 3300009093 Bacteria 7334
98 Ga0105240_10036598 3300009093 Bacteria 6311
99 Ga0105240_10054132 3300009093 Bacteria 5030
100 Ga0105240_10348427 3300009093 Bacteria 1681
101 Ga0105240_10381977 3300009093 Bacteria 1591
102 Ga0105240_10425399 3300009093 Bacteria 1491
103 Ga0105240_10483068 3300009093 Bacteria 1381
104 Ga0105245_10728348 3300009098 Bacteria 1026
105 Ga0105241_10610227 3300009174 Bacteria 987
106 Ga0105241_11714220 3300009174 Bacteria 611
107 Ga0105242_10097338 3300009176 Bacteria 2487
108 Ga0105248_10006644 3300009177 Bacteria 12684
109 Ga0105248_10427825 3300009177 Bacteria 1491
110 Ga0105248_10874248 3300009177 Bacteria 1015
111 Ga0105248_11560944 3300009177 Bacteria 748
112 Ga0105237_10390157 3300009545 Bacteria 1397
113 Ga0105238_10076633 3300009551 Bacteria 3335
114 Ga0105238_10162486 3300009551 Bacteria 2209
115 Ga0105238_10960367 3300009551 Bacteria 875
116 Ga0105238_11462051 3300009551 Bacteria 711
117 Ga0105249_10941706 3300009553 Bacteria 931
118 Ga0105249_11625040 3300009553 Bacteria 719
119 Ga0105239_10115776 3300010375 Bacteria 2974
120 Ga0105239_11141046 3300010375 Bacteria 898
121 Ga0105239_11991252 3300010375 Bacteria 674
122 Ga0105239_12440401 3300010375 Bacteria 609
123 Ga0157373_10002927 3300013100 Bacteria 12934
124 Ga0157373_10004669 3300013100 Bacteria 10305
125 Ga0157370_10235741 3300013104 Bacteria 1693
126 Ga0157369_10578643 3300013105 Bacteria 1160
127 Ga0157369_11264040 3300013105 Bacteria 753
128 Ga0157374_10391946 3300013296 Bacteria 1384
129 Ga0157374_10587971 3300013296 Bacteria 1122
130 Ga0163162_10308869 3300013306 Bacteria 1714
131 Ga0157372_12064359 3300013307 Bacteria 655
132 Ga0157375_10368472 3300013308 Bacteria 1603
133 Ga0157375_10745390 3300013308 Bacteria 1131
134 Ga0163163_10040602 3300014325 Bacteria 4544
135 Ga0163163_10212101 3300014325 Bacteria 1986
136 Ga0163163_10217458 3300014325 Bacteria 1960
137 Ga0157376_12162231 3300014969 Bacteria 595
138 Ga0183365_10006 3300015684 Bacteria 225936
139 Ga0163161_10665785 3300017792 Bacteria 864
140 Ga0213876_10000414 3300021384 Bacteria 35795
141 Ga0213876_10107551 3300021384 Bacteria 1480
142 Ga0213876_10137503 3300021384 Bacteria 1300
143 Ga0213875_10243914 3300021388 Bacteria 847
144 Ga0213875_10393095 3300021388 Unclassified 661
145 Ga0213871_10027097 3300021441 Bacteria 1470
146 Ga0209026_1001518 3300025250 Bacteria 10140
147 Ga0209026_1030837 3300025250 Bacteria 795
148 Ga0209565_1000467 3300025263 Bacteria 30354
149 Ga0209455_1047591 3300025272 Bacteria 617
150 Ga0209673_1000763 3300025273 Bacteria 43675
151 Ga0209673_1035648 3300025273 Bacteria 1487
152 Ga0209673_1052655 3300025273 Bacteria 1067
153 Ga0209675_1008740 3300025291 Bacteria 3671
154 Ga0209676_1000422 3300025292 Bacteria 74541
155 Ga0209676_1002072 3300025292 Bacteria 15577
156 Ga0209564_1001751 3300025295 Bacteria 20266
157 Ga0209564_1022949 3300025295 Bacteria 2186
158 Ga0209564_1028626 3300025295 Bacteria 1776
159 Ga0209564_1071254 3300025295 Bacteria 721
160 Ga0209758_1001521 3300025297 Bacteria 26876
161 Ga0209758_1002717 3300025297 Bacteria 17421
162 Ga0209758_1005883 3300025297 Bacteria 9149
163 Ga0209050_1000161 3300025298 Bacteria 155713
164 Ga0209050_1000463 3300025298 Bacteria 72380
165 Ga0209050_1001754 3300025298 Bacteria 21523
166 Ga0209050_1038081 3300025298 Bacteria 1377
167 Ga0209256_1001657 3300025299 Bacteria 21640
168 Ga0209256_1004085 3300025299 Bacteria 9471
169 Ga0209051_1000957 3300025303 Bacteria 28343
170 Ga0209257_1000252 3300025304 Bacteria 123718
171 Ga0209257_1000696 3300025304 Bacteria 52123
172 Ga0209257_1001679 3300025304 Bacteria 24960
173 Ga0209257_1003341 3300025304 Bacteria 13882
174 Ga0209257_1003897 3300025304 Bacteria 12165
175 Ga0207680_10538925 3300025903 Bacteria 833
176 Ga0207705_10009605 3300025909 Bacteria 7035
177 Ga0207705_10237910 3300025909 Bacteria 1386
178 Ga0207654_10193638 3300025911 Bacteria 1334
179 Ga0207654_10583720 3300025911 Bacteria 796
180 Ga0207707_10148909 3300025912 Bacteria 2046
181 Ga0207707_10546713 3300025912 Bacteria 984
182 Ga0207695_10000575 3300025913 Bacteria 74997
183 Ga0207695_10001510 3300025913 Bacteria 38653
184 Ga0207695_10021802 3300025913 Bacteria 7297
185 Ga0207695_10033702 3300025913 Bacteria 5579
186 Ga0207695_10193532 3300025913 Bacteria 1950
187 Ga0207660_10002905 3300025917 Bacteria 11189
188 Ga0207660_10346835 3300025917 Bacteria 1189
189 Ga0207657_10011609 3300025919 Bacteria 8737
190 Ga0207657_10088304 3300025919 Bacteria 2592
191 Ga0207652_10003109 3300025921 Bacteria 13838
192 Ga0207652_10310021 3300025921 Bacteria 1424
193 Ga0207652_10548941 3300025921 Bacteria 1038
194 Ga0207681_10692693 3300025923 Bacteria 847
195 Ga0207694_10216806 3300025924 Bacteria 1560
196 Ga0207694_10985339 3300025924 Bacteria 713
197 Ga0207650_10148952 3300025925 Bacteria 1845
198 Ga0207644_10192953 3300025931 Bacteria 1602
199 Ga0207690_10000322 3300025932 Bacteria 32043
200 Ga0207690_10011268 3300025932 Bacteria 5341
201 Ga0207690_10866262 3300025932 Bacteria 748
202 Ga0207706_10100943 3300025933 Bacteria 2538
203 Ga0207686_11263118 3300025934 Bacteria 605
204 Ga0207704_10000995 3300025938 Bacteria 12568
205 Ga0207711_10001728 3300025941 Bacteria 20047
206 Ga0207711_10423024 3300025941 Bacteria 1239
207 Ga0207689_10122205 3300025942 Bacteria 2141
208 Ga0207689_10961007 3300025942 Bacteria 721
209 Ga0207661_10288239 3300025944 Bacteria 1469
210 Ga0207661_10886540 3300025944 Bacteria 822
211 Ga0207679_10093876 3300025945 Bacteria 2328
212 Ga0207679_11578537 3300025945 Bacteria 601
213 Ga0207667_10022278 3300025949 Bacteria 7002
214 Ga0207667_10043491 3300025949 Bacteria 4766
215 Ga0207667_10231306 3300025949 Bacteria 1893
216 Ga0207667_10494255 3300025949 Bacteria 1241
217 Ga0207667_11301479 3300025949 Bacteria 703
218 Ga0207668_10033421 3300025972 Bacteria 3407
219 Ga0207668_11085231 3300025972 Bacteria 717
220 Ga0207640_10508976 3300025981 Bacteria 1004
221 Ga0207658_10231556 3300025986 Bacteria 1560
222 Ga0207658_10387098 3300025986 Bacteria 1226
223 Ga0207677_11427976 3300026023 Bacteria 638
224 Ga0207703_11875863 3300026035 Bacteria 575
225 Ga0207639_10034754 3300026041 Bacteria 3728
226 Ga0207639_10057562 3300026041 Bacteria 2985
227 Ga0207639_10173551 3300026041 Bacteria 1828
228 Ga0207639_10433997 3300026041 Bacteria 1190
229 Ga0207639_10500627 3300026041 Bacteria 1110
230 Ga0207639_10905182 3300026041 Bacteria 825
231 Ga0207702_10120560 3300026078 Bacteria 2347
232 Ga0207641_10274527 3300026088 Bacteria 1583
233 Ga0207641_10588523 3300026088 Bacteria 1088
234 Ga0207641_10680026 3300026088 Bacteria 1012
235 Ga0207676_10002809 3300026095 Bacteria 12382
236 Ga0207674_10436939 3300026116 Bacteria 1265
237 Ga0207674_11638818 3300026116 Bacteria 612
238 Ga0207675_101084369 3300026118 Bacteria 820
239 Ga0207683_10041246 3300026121 Bacteria 4030
240 Ga0207698_10889435 3300026142 Bacteria 897
241 Ga0268266_10000106 3300028379 Bacteria 175109
242 Ga0268266_10097145 3300028379 Bacteria 2590
243 Ga0268266_10221305 3300028379 Bacteria 1740
244 Ga0268266_10994976 3300028379 Bacteria 811
245 Ga0268266_11954601 3300028379 Bacteria 560
246 Ga0268265_10060989 3300028380 Bacteria 2893
247 Ga0268265_10174255 3300028380 Bacteria 1842
248 Ga0307517_10045644 3300028786 Bacteria 4596
249 Ga0307517_10108925 3300028786 Bacteria 2123
250 Ga0307517_10139835 3300028786 Bacteria 1704
251 Ga0307515_10064212 3300028794 Bacteria 5136
252 Ga0307515_10073343 3300028794 Bacteria 4602
253 Ga0307515_10241954 3300028794 Bacteria 1573
254 Ga0265338_10555526 3300028800 Bacteria 803
255 Ga0265327_10001040 3300031251 Bacteria 39084
256 Ga0265327_10173562 3300031251 Bacteria 989
257 Ga0307513_10000162 3300031456 Bacteria 96000
258 Ga0307513_10002524 3300031456 Bacteria 25289
259 Ga0307513_10005851 3300031456 Bacteria 16161
260 Ga0307513_10101942 3300031456 Bacteria 2891
261 Ga0307410_10410020 3300031852 Bacteria 1097
262 Ga0307410_10889750 3300031852 Bacteria 762
263 Ga0307407_10474613 3300031903 Bacteria 912
264 Ga0307409_100042358 3300031995 Bacteria 3409
265 Ga0307409_102053788 3300031995 Unclassified 601
266 Ga0307416_100388854 3300032002 Bacteria 1428
267 Ga0307416_101524159 3300032002 Bacteria 774
268 Ga0307411_10954684 3300032005 Bacteria 765
269 Ga0307415_100248047 3300032126 Bacteria 1445
270 Ga0307415_101476220 3300032126 Bacteria 650
271 Ga0307415_101510468 3300032126 Bacteria 643
272 Ga0307510_10021804 3300033180 Bacteria 7456
273 Ga0373936_0001549 3300035113 Bacteria 8369
274 Ga0373943_0033961 3300035170 Bacteria 2432
275 Ga0373943_0736736 3300035170 Bacteria 585
276 Ga0373946_0070409 3300035171 Bacteria 1509
277 Ga0373955_0379051 3300035172 Bacteria 858
278 Ga0373931_0621006 3300035691 Bacteria 708
279 Ga0373927_0001191 3300035695 Bacteria 19735
280 Ga0373933_0391460 3300035724 Bacteria 906
281 Ga0373937_0468068 3300036401 Bacteria 1197
282 Ga0373925_0002699 3300037068 Bacteria 14073
283 Ga0373925_0055168 3300037068 Bacteria 2974
284 Ga0395899_0005055 3300037312 Bacteria 10260
285 Ga0395899_0198165 3300037312 Bacteria 1402
286 Ga0395899_0399899 3300037312 Bacteria 909
287 Ga0395900_0001461 3300037418 Bacteria 28191
288 Ga0395900_0295587 3300037418 Bacteria 1607
289 Ga0395900_0643822 3300037418 Bacteria 997
290 Ga0395898_0011138 3300037466 Bacteria 9363
291 Ga0395898_0314136 3300037466 Bacteria 1495
292 Ga0395905_0001028 3300037471 Bacteria 35552
293 Ga0395905_0003958 3300037471 Bacteria 15587
294 Ga0395905_0022284 3300037471 Bacteria 5993
295 Ga0395905_0026694 3300037471 Bacteria 5445
296 Ga0395905_0046204 3300037471 Bacteria 4083
297 Ga0395905_0075651 3300037471 Bacteria 3156
298 Ga0395905_0109786 3300037471 Bacteria 2590
299 Ga0395905_0216361 3300037471 Bacteria 1794
300 Ga0395905_0237361 3300037471 Bacteria 1704
301 Ga0395905_0634711 3300037471 Bacteria 970
302 Ga0395905_1734093 3300037471 Bacteria 530
303 Ga0436364_0554945 3300037853 Bacteria 1024
304 Ga0436364_1445164 3300037853 Bacteria 759
305 Ga0395901_0000342 3300038443 Bacteria 56754
306 Ga0395901_0414101 3300038443 Bacteria 1383
307 Ga0436365_0376847 3300039437 Bacteria 89580
308 Ga0436365_0753899 3300039437 Bacteria 1469
309 Ga0436365_0758008 3300039437 Bacteria 1461
310 Ga0436360_0617420 3300039438 Bacteria 1715
311 Ga0436363_0056776 3300039450 Bacteria 2454
312 Ga0451791_1831215 3300041451 Bacteria 685
313 Ga0451853_3329164 3300041512 Bacteria 875
314 Ga0439445_0071516 3300042004 Bacteria 960
315 Ga0439459_0008222 3300042438 Bacteria 1778
316 Ga0466969_0003577 3300044656 Bacteria 8269
317 Ga0466965_0182999 3300044683 Bacteria 1106
318 Ga0466966_0001653 3300044684 Bacteria 14373
319 Ga0466961_0002529 3300044693 Bacteria 11337
320 Ga0466961_0414988 3300044693 Bacteria 816
321 Ga0466963_0115791 3300044694 Bacteria 1842
322 Ga0453684_1005591 3300044712 Bacteria 886
323 Ga0466971_0000691 3300044719 Bacteria 13488
324 Ga0466970_0366755 3300044765 Bacteria 818
325 Ga0466957_0005270 3300044842 Bacteria 7243
326 Ga0466959_0000162 3300045049 Bacteria 44052
327 Ga0466959_0692322 3300045049 Unclassified 683
328 Ga0466958_0000155 3300045836 Bacteria 24034
329 Ga0495627_003065 3300046453 Bacteria 7603
330 Ga0495592_0362354 3300046454 Bacteria 927
331 Ga0495590_0002552 3300046457 Bacteria 7530
332 Ga0495638_0002741 3300046460 Bacteria 14152
333 Ga0495638_0002772 3300046460 Bacteria 14084
334 Ga0495638_0006806 3300046460 Bacteria 8255
335 Ga0495638_0019764 3300046460 Bacteria 4452
336 Ga0495638_0030227 3300046460 Bacteria 3488
337 Ga0495638_0078740 3300046460 Bacteria 2005
338 Ga0495650_0000020 3300046471 Bacteria 533839
339 Ga0495650_0036027 3300046471 Bacteria 2171
340 Ga0495650_0042687 3300046471 Bacteria 1929
341 Ga0495607_0109788 3300046501 Bacteria 1464
342 Ga0495583_0000069 3300046506 Bacteria 186863
343 Ga0495583_0065138 3300046506 Bacteria 1615
344 Ga0495606_0004033 3300046507 Bacteria 14977
345 Ga0495606_0044542 3300046507 Bacteria 2950
346 Ga0495606_0476349 3300046507 Bacteria 635
347 Ga0495610_0000092 3300046512 Bacteria 105874
348 Ga0495610_0006904 3300046512 Bacteria 7690
349 Ga0495610_0014954 3300046512 Bacteria 4534
350 Ga0495616_0000205 3300046513 Bacteria 49007
351 Ga0495616_0054772 3300046513 Bacteria 1977
352 Ga0495631_0028006 3300046518 Bacteria 2573
353 Ga0495631_0035210 3300046518 Bacteria 2241
354 Ga0495632_0014669 3300046519 Bacteria 4424
355 Ga0495632_0064091 3300046519 Bacteria 1778
356 Ga0495637_0005537 3300046520 Bacteria 6412
357 Ga0495637_0148168 3300046520 Bacteria 887
358 Ga0495637_0176087 3300046520 Bacteria 795
359 Ga0495643_0074552 3300046522 Bacteria 1777
360 Ga0495643_0111963 3300046522 Bacteria 1387
361 Ga0495643_0160654 3300046522 Bacteria 1106
362 Ga0495644_0189427 3300046523 Bacteria 792
363 Ga0495648_0006099 3300046524 Bacteria 9883
364 Ga0495648_0082236 3300046524 Bacteria 1829
365 Ga0495663_0044823 3300046525 Bacteria 1355
366 Ga0495642_0018738 3300046528 Bacteria 2709
367 Ga0495652_0313071 3300046529 Bacteria 1137
368 Ga0495652_0456862 3300046529 Bacteria 893
369 Ga0495654_0000010 3300046530 Bacteria 378481
370 Ga0495609_0018852 3300046538 Bacteria 3196
371 Ga0495621_0071569 3300046539 Bacteria 1278
372 Ga0495597_0051046 3300046542 Bacteria 1824
373 Ga0495597_0174724 3300046542 Bacteria 870
374 Ga0495597_0300396 3300046542 Bacteria 623
375 Ga0495645_0011498 3300046543 Bacteria 6231
376 Ga0495668_0000060 3300046616 Bacteria 193823
377 Ga0495668_0008967 3300046616 Bacteria 6178
378 Ga0495668_0019157 3300046616 Bacteria 3948
379 Ga0495668_0041650 3300046616 Bacteria 2557
380 Ga0495668_0097354 3300046616 Bacteria 1610
381 Ga0495668_0188513 3300046616 Bacteria 1129
382 Ga0495668_0389200 3300046616 Bacteria 766
383 Ga0495668_0759180 3300046616 Bacteria 537
384 Ga0495611_0002026 3300046648 Bacteria 9569
385 Ga0495625_0000295 3300046660 Bacteria 77306
386 Ga0495625_0005488 3300046660 Bacteria 11546
387 Ga0495625_0016869 3300046660 Bacteria 5732
388 Ga0495625_0027456 3300046660 Bacteria 4285
389 Ga0495625_0031655 3300046660 Bacteria 3931
390 Ga0495625_0246383 3300046660 Bacteria 1161
391 Ga0495669_0000044 3300046684 Bacteria 85633
392 Ga0495669_0011743 3300046684 Bacteria 3723
393 Ga0495669_0131740 3300046684 Bacteria 1177
394 Ga0495670_0354163 3300046691 Bacteria 790
395 Ga0495671_0271091 3300046692 Bacteria 818
396 Ga0495671_0296727 3300046692 Bacteria 777
397 Ga0495671_0327072 3300046692 Bacteria 736
398 Ga0495589_0253590 3300046794 Bacteria 821
399 Ga0495660_0032042 3300046810 Bacteria 2953
400 Ga0495660_0064715 3300046810 Bacteria 1953
401 Ga0495660_0083741 3300046810 Bacteria 1668
402 Ga0495660_0199637 3300046810 Bacteria 956
403 Ga0495672_0002626 3300047320 Bacteria 16231
404 Ga0495672_0039530 3300047320 Bacteria 2868
405 Ga0495672_0051246 3300047320 Bacteria 2432
406 Ga0495679_014415 3300047446 Bacteria 2930
407 Ga0495673_0000195 3300047469 Bacteria 95428
408 Ga0495673_0000272 3300047469 Bacteria 71031
409 Ga0495673_0003251 3300047469 Bacteria 10824
410 Ga0495681_0086749 3300047470 Bacteria 1388
411 Ga0495686_0003661 3300047472 Bacteria 13153
412 Ga0495686_0005537 3300047472 Bacteria 9936
413 Ga0495686_0043295 3300047472 Bacteria 2855
414 Ga0495686_0428962 3300047472 Bacteria 705
415 Ga0496100_0209305 3300048903 Bacteria 1426
416 Ga0496100_1225203 3300048903 Bacteria 592
417 Ga0496106_0001132 3300048909 Bacteria 19731
418 Ga0496107_0000140 3300048910 Bacteria 35910
419 Ga0496107_0951740 3300048910 Bacteria 625
420 Ga0496108_0088190 3300048911 Bacteria 2636
421 Ga0496109_0055139 3300048912 Bacteria 3626
422 Ga0496110_0273267 3300048913 Bacteria 1539
423 Ga0496112_0043102 3300048915 Bacteria 4417
424 Ga0496112_0118935 3300048915 Bacteria 2612
425 Ga0496112_0177078 3300048915 Bacteria 2097
426 Ga0496112_1746582 3300048915 Bacteria 534
427 Ga0496113_0248385 3300048916 Bacteria 1420
428 Ga0496115_0005976 3300048918 Bacteria 8886
429 Ga0496115_0007301 3300048918 Bacteria 8127
430 Ga0496115_0156984 3300048918 Bacteria 1879
431 Ga0496115_0206751 3300048918 Bacteria 1622
432 Ga0496115_0338518 3300048918 Bacteria 1228
433 Ga0496121_0010215 3300048924 Bacteria 10625
434 Ga0496121_0214027 3300048924 Bacteria 1363
435 Ga0496121_0584505 3300048924 Bacteria 692
436 Ga0496124_0018993 3300048927 Bacteria 6416
437 Ga0496125_0009514 3300048928 Bacteria 9974
438 Ga0496126_0038915 3300048929 Bacteria 4419
439 Ga0496126_0201624 3300048929 Bacteria 1680
440 Ga0501033_0015284 3300049570 Bacteria 5823
441 Ga0501033_0101106 3300049570 Bacteria 2103
442 Ga0501033_0267414 3300049570 Bacteria 1209
443 Ga0501033_0881826 3300049570 Bacteria 602
444 Ga0501034_0023999 3300049571 Bacteria 6205
445 Ga0501034_0045193 3300049571 Bacteria 4451
446 Ga0501034_0095124 3300049571 Bacteria 2976
447 Ga0501037_0024773 3300049573 Bacteria 4437
448 Ga0501037_0154241 3300049573 Bacteria 1640
449 Ga0501047_0089727 3300049581 Bacteria 2951
450 Ga0501047_0155441 3300049581 Bacteria 2161
451 Ga0501047_0199361 3300049581 Bacteria 1863
452 Ga0501047_0338201 3300049581 Bacteria 1343
453 Ga0501048_0467337 3300049582 Bacteria 904
454 Ga0501238_001142 3300049671 Bacteria 3017
455 Ga0501238_024679 3300049671 Bacteria 859
456 Ga0501080_0527774 3300049742 Bacteria 1053
457 Ga0501035_0075853 3300049822 Bacteria 2974
458 Ga0501035_0135642 3300049822 Bacteria 2143
459 Ga0501035_0581890 3300049822 Bacteria 914
460 Ga0501035_0752247 3300049822 Unclassified 782
461 Ga0501044_0005373 3300049823 Bacteria 14231
462 Ga0501044_0020905 3300049823 Bacteria 6987
463 nmdc:mga0k408_397255_c1 3300050493 Bacteria 821
464 nmdc:mga0k408_97842_c1 3300050493 Bacteria 1729
465 nmdc:mga07m45_115058_c1 3300050496 Bacteria 1551
466 nmdc:mga07m45_388135_c1 3300050496 Bacteria 811
467 nmdc:mga07m45_657133_c1 3300050496 Bacteria 604
468 Ga0500635_0001825 3300053080 Bacteria 5201
469 Ga0500578_0003007 3300053086 Bacteria 13076
470 Ga0500643_003002 3300053087 Bacteria 8356
471 Ga0500643_110833 3300053087 Bacteria 741
472 Ga0500644_0001942 3300053088 Bacteria 5281
473 Ga0500644_0004193 3300053088 Bacteria 3597
474 Ga0500644_0375550 3300053088 Bacteria 617
475 Ga0500647_0001118 3300053091 Bacteria 8745
476 Ga0500641_0026882 3300053096 Bacteria 2237
477 Ga0500650_0264732 3300053098 Bacteria 768
478 Ga0500554_010642 3300053102 Bacteria 2250
479 Ga0500555_046627 3300053103 Bacteria 1194
480 Ga0500556_0001319 3300053104 Bacteria 11043
481 Ga0500562_000816 3300053108 Bacteria 7596
482 Ga0500562_002408 3300053108 Bacteria 4695
483 Ga0500562_152700 3300053108 Bacteria 629
484 Ga0500572_000391 3300053111 Bacteria 15512
485 Ga0500593_175873 3300053117 Bacteria 801
486 Ga0500594_0000265 3300053118 Bacteria 12235
487 Ga0500608_000007 3300053122 Bacteria 100296
488 Ga0500608_074511 3300053122 Bacteria 1610
489 Ga0500614_051464 3300053123 Bacteria 1083
490 Ga0500618_000996 3300053125 Bacteria 14323
491 Ga0500652_218899 3300053131 Bacteria 766
492 Ga0500658_0001497 3300053134 Bacteria 9348
493 Ga0500559_0000232 3300053136 Bacteria 44275
494 Ga0500559_0004136 3300053136 Bacteria 6960
495 Ga0500559_0018514 3300053136 Bacteria 2943
496 Ga0500559_0230585 3300053136 Unclassified 873
497 Ga0500564_000054 3300053138 Bacteria 29883
498 Ga0500577_0005314 3300053142 Bacteria 3462
499 Ga0500590_262129 3300053148 Bacteria 678
500 Ga0500616_0043775 3300053153 Bacteria 2391
501 Ga0500616_0161868 3300053153 Bacteria 1025
502 Ga0500616_0368057 3300053153 Bacteria 581
503 Ga0500622_0001898 3300053156 Bacteria 15778
504 Ga0500622_0005891 3300053156 Bacteria 7236
505 Ga0500622_0007547 3300053156 Bacteria 6164
506 Ga0500622_0007985 3300053156 Bacteria 5958
507 Ga0500622_0008795 3300053156 Bacteria 5621
508 Ga0500634_0320816 3300053161 Bacteria 605
509 Ga0500611_001977 3300053727 Bacteria 2374
510 Ga0500645_002600 3300053730 Bacteria 7931
511 Ga0500645_005978 3300053730 Bacteria 4401
512 Ga0500609_000248 3300053731 Bacteria 7830
513 Ga0500552_001688 3300053733 Bacteria 2110
514 Ga0501084_0350781 3300054114 Unclassified 1247
515 Ga0466962_0004757 3300061719 Bacteria 6525
516 Ga0466962_0707972 3300061719 Bacteria 517
517 2511123342 2510917020 Bacteria 5657507
518 2585146926 2582581279 Bacteria 4980720
519 2585155715 2582581280 Bacteria 5994497
520 2585198333 2582581293 Bacteria 5907401
521 2587919400 2585428106 Bacteria 5179711
522 2643750816 2643221545 Bacteria 5083237
523 2643779228 2643221552 Bacteria 5708754
524 2643925687 2643221583 Bacteria 5218014
525 2643931404 2643221584 Bacteria 5511711
526 2644000496 2643221598 Bacteria 4578346
527 2644084735 2643221614 Bacteria 4260023
528 2644225229 2643221640 Bacteria 5258820
529 2644232537 2643221642 Bacteria 5357871
530 2644342287 2643221661 Bacteria 4267604
531 2644365587 2643221666 Bacteria 4265935
532 2644509890 2643221691 Bacteria 5093099
533 2739790138 2739367756 Bacteria 4553612
534 2792461117 2791355048 Bacteria 5832535
535 2819540051 2818991435 Bacteria 5433759
536 2819648949 2818991454 Bacteria 5563326
537 2843749403 2843744320 Bacteria 5659202
538 2849562623 2849560528 Bacteria 5393480
539 2849578439 2849573788 Bacteria 5421256
540 2851156047 2851153111 Bacteria 5542585
541 2857504640 2857504554 Bacteria 5369913
542 2884965162 2884960567 Bacteria 5437054
543 2898333991 2898329390 Bacteria 5168154
544 2928534357 2928531327 Bacteria 5101314
545 Ga0501031_0538871
546 rootH1_10032836
547 rootH1_10093935
548 rootH2_10029287
549 rootL2_10206680
550 rootL2_10213182
551 rootH1_10008830
552 rootH1_10035872
553 rootH1_10088882
554 Ga0055526_1022903
555 Ga0055524_1020856
556 Ga0055536_1008251
557 Ga0055536_1015268
558 Ga0055528_1004737
559 Ga0055528_1011576
560 Ga0055530_10005763
561 Ga0055530_10012636
562 Ga0055530_10016447
563 Ga0055540_1034497
564 Ga0055531_10002085
565 Ga0055531_10017200
566 Ga0055531_10026500
567 Ga0055543_1010005
568 Ga0065165_1000506
569 Ga0065165_1001706
570 Ga0070658_10024306
571 Ga0070658_10054643
572 Ga0070658_11441049
573 Ga0070683_100363182
574 Ga0070670_100534640
575 Ga0068869_100105104
576 Ga0068869_100332791
577 Ga0070666_11293719
578 Ga0070680_100002679
579 Ga0070682_100456017
580 Ga0068868_100562774
581 Ga0070660_100085850
582 Ga0070660_100998312
583 Ga0070691_10007752
584 Ga0070669_100520179
585 Ga0070671_100050444
586 Ga0070671_100172804
587 Ga0070659_100002377
588 Ga0070659_100011164
589 Ga0070659_100023772
590 Ga0070667_100257941
591 Ga0070714_100927149
592 Ga0070678_100052825
593 Ga0070678_101144956
594 Ga0070662_100146847
595 Ga0070681_10041940
596 Ga0070681_10222133
597 Ga0068867_100834262
598 Ga0070679_100007990
599 Ga0070679_100182634
600 Ga0070679_101206638
601 Ga0068853_100007684
602 Ga0068853_100066978
603 Ga0068853_100644726
604 Ga0070665_100000121
605 Ga0070665_100036176
606 Ga0070665_100071300
607 Ga0070665_101149582
608 Ga0068855_100066792
609 Ga0068855_100100352
610 Ga0068855_100155178
611 Ga0068855_100178658
612 Ga0068855_100378451
613 Ga0070664_100089462
614 Ga0068857_101438482
615 Ga0068854_100365729
616 Ga0068856_100118542
617 Ga0068856_100685831
618 Ga0068856_101012825
619 Ga0068856_101196099
620 Ga0068852_100892564
621 Ga0068852_101069301
622 Ga0068852_102262367
623 Ga0068859_102149943
624 Ga0068864_100046100
625 Ga0068864_100364349
626 Ga0068864_100670771
627 Ga0068861_102021955
628 Ga0068863_100271221
629 Ga0068863_100509332
630 Ga0068863_100520706
631 Ga0068863_100663851
632 Ga0075369_10002234
633 Ga0075366_10006285
634 Ga0075366_10163633
635 Ga0097621_100528040
636 Ga0097621_100716774
637 Ga0075370_10168834
638 Ga0068865_100036456
639 Ga0097620_102149480
640 Ga0105240_10028222
641 Ga0105240_10036598
642 Ga0105240_10054132
643 Ga0105240_10348427
644 Ga0105240_10381977
645 Ga0105240_10425399
646 Ga0105240_10483068
647 Ga0105245_10728348
648 Ga0105241_10610227
649 Ga0105241_11714220
650 Ga0105242_10097338
651 Ga0105248_10006644
652 Ga0105248_10427825
653 Ga0105248_10874248
654 Ga0105248_11560944
655 Ga0105237_10390157
656 Ga0105238_10076633
657 Ga0105238_10162486
658 Ga0105238_10960367
659 Ga0105238_11462051
660 Ga0105249_10941706
661 Ga0105249_11625040
662 Ga0105239_10115776
663 Ga0105239_11141046
664 Ga0105239_11991252
665 Ga0105239_12440401
666 Ga0157373_10002927
667 Ga0157373_10004669
668 Ga0157370_10235741
669 Ga0157369_10578643
670 Ga0157369_11264040
671 Ga0157374_10391946
672 Ga0157374_10587971
673 Ga0163162_10308869
674 Ga0157372_12064359
675 Ga0157375_10368472
676 Ga0157375_10745390
677 Ga0163163_10040602
678 Ga0163163_10212101
679 Ga0163163_10217458
680 Ga0157376_12162231
681 Ga0183365_10006
682 Ga0163161_10665785
683 Ga0213876_10000414
684 Ga0213876_10107551
685 Ga0213876_10137503
686 Ga0213875_10243914
687 Ga0213875_10393095
688 Ga0213871_10027097
689 Ga0209026_1001518
690 Ga0209026_1030837
691 Ga0209565_1000467
692 Ga0209455_1047591
693 Ga0209673_1000763
694 Ga0209673_1035648
695 Ga0209673_1052655
696 Ga0209675_1008740
697 Ga0209676_1000422
698 Ga0209676_1002072
699 Ga0209564_1001751
700 Ga0209564_1022949
701 Ga0209564_1028626
702 Ga0209564_1071254
703 Ga0209758_1001521
704 Ga0209758_1002717
705 Ga0209758_1005883
706 Ga0209050_1000161
707 Ga0209050_1000463
708 Ga0209050_1001754
709 Ga0209050_1038081
710 Ga0209256_1001657
711 Ga0209256_1004085
712 Ga0209051_1000957
713 Ga0209257_1000252
714 Ga0209257_1000696
715 Ga0209257_1001679
716 Ga0209257_1003341
717 Ga0209257_1003897
718 Ga0207680_10538925
719 Ga0207705_10009605
720 Ga0207705_10237910
721 Ga0207654_10193638
722 Ga0207654_10583720
723 Ga0207707_10148909
724 Ga0207707_10546713
725 Ga0207695_10000575
726 Ga0207695_10001510
727 Ga0207695_10021802
728 Ga0207695_10033702
729 Ga0207695_10193532
730 Ga0207660_10002905
731 Ga0207660_10346835
732 Ga0207657_10011609
733 Ga0207657_10088304
734 Ga0207652_10003109
735 Ga0207652_10310021
736 Ga0207652_10548941
737 Ga0207681_10692693
738 Ga0207694_10216806
739 Ga0207694_10985339
740 Ga0207650_10148952
741 Ga0207644_10192953
742 Ga0207690_10000322
743 Ga0207690_10011268
744 Ga0207690_10866262
745 Ga0207706_10100943
746 Ga0207686_11263118
747 Ga0207704_10000995
748 Ga0207711_10001728
749 Ga0207711_10423024
750 Ga0207689_10122205
751 Ga0207689_10961007
752 Ga0207661_10288239
753 Ga0207661_10886540
754 Ga0207679_10093876
755 Ga0207679_11578537
756 Ga0207667_10022278
757 Ga0207667_10043491
758 Ga0207667_10231306
759 Ga0207667_10494255
760 Ga0207667_11301479
761 Ga0207668_10033421
762 Ga0207668_11085231
763 Ga0207640_10508976
764 Ga0207658_10231556
765 Ga0207658_10387098
766 Ga0207677_11427976
767 Ga0207703_11875863
768 Ga0207639_10034754
769 Ga0207639_10057562
770 Ga0207639_10173551
771 Ga0207639_10433997
772 Ga0207639_10500627
773 Ga0207639_10905182
774 Ga0207702_10120560
775 Ga0207641_10274527
776 Ga0207641_10588523
777 Ga0207641_10680026
778 Ga0207676_10002809
779 Ga0207674_10436939
780 Ga0207674_11638818
781 Ga0207675_101084369
782 Ga0207683_10041246
783 Ga0207698_10889435
784 Ga0268266_10000106
785 Ga0268266_10097145
786 Ga0268266_10221305
787 Ga0268266_10994976
788 Ga0268266_11954601
789 Ga0268265_10060989
790 Ga0268265_10174255
791 Ga0307517_10045644
792 Ga0307517_10108925
793 Ga0307517_10139835
794 Ga0307515_10064212
795 Ga0307515_10073343
796 Ga0307515_10241954
797 Ga0265338_10555526
798 Ga0265327_10001040
799 Ga0265327_10173562
800 Ga0307513_10000162
801 Ga0307513_10002524
802 Ga0307513_10005851
803 Ga0307513_10101942
804 Ga0307410_10410020
805 Ga0307410_10889750
806 Ga0307407_10474613
807 Ga0307409_100042358
808 Ga0307409_102053788
809 Ga0307416_100388854
810 Ga0307416_101524159
811 Ga0307411_10954684
812 Ga0307415_100248047
813 Ga0307415_101476220
814 Ga0307415_101510468
815 Ga0307510_10021804
816 Ga0373936_0001549
817 Ga0373943_0033961
818 Ga0373943_0736736
819 Ga0373946_0070409
820 Ga0373955_0379051
821 Ga0373931_0621006
822 Ga0373927_0001191
823 Ga0373933_0391460
824 Ga0373937_0468068
825 Ga0373925_0002699
826 Ga0373925_0055168
827 Ga0395899_0005055
828 Ga0395899_0198165
829 Ga0395899_0399899
830 Ga0395900_0001461
831 Ga0395900_0295587
832 Ga0395900_0643822
833 Ga0395898_0011138
834 Ga0395898_0314136
835 Ga0395905_0001028
836 Ga0395905_0003958
837 Ga0395905_0022284
838 Ga0395905_0026694
839 Ga0395905_0046204
840 Ga0395905_0075651
841 Ga0395905_0109786
842 Ga0395905_0216361
843 Ga0395905_0237361
844 Ga0395905_0634711
845 Ga0395905_1734093
846 Ga0436364_0554945
847 Ga0436364_1445164
848 Ga0395901_0000342
849 Ga0395901_0414101
850 Ga0436365_0376847
851 Ga0436365_0753899
852 Ga0436365_0758008
853 Ga0436360_0617420
854 Ga0436363_0056776
855 Ga0451791_1831215
856 Ga0451853_3329164
857 Ga0439445_0071516
858 Ga0439459_0008222
859 Ga0466969_0003577
860 Ga0466965_0182999
861 Ga0466966_0001653
862 Ga0466961_0002529
863 Ga0466961_0414988
864 Ga0466963_0115791
865 Ga0453684_1005591
866 Ga0466971_0000691
867 Ga0466970_0366755
868 Ga0466957_0005270
869 Ga0466959_0000162
870 Ga0466959_0692322
871 Ga0466958_0000155
872 Ga0495627_003065
873 Ga0495592_0362354
874 Ga0495590_0002552
875 Ga0495638_0002741
876 Ga0495638_0002772
877 Ga0495638_0006806
878 Ga0495638_0019764
879 Ga0495638_0030227
880 Ga0495638_0078740
881 Ga0495650_0000020
882 Ga0495650_0036027
883 Ga0495650_0042687
884 Ga0495607_0109788
885 Ga0495583_0000069
886 Ga0495583_0065138
887 Ga0495606_0004033
888 Ga0495606_0044542
889 Ga0495606_0476349
890 Ga0495610_0000092
891 Ga0495610_0006904
892 Ga0495610_0014954
893 Ga0495616_0000205
894 Ga0495616_0054772
895 Ga0495631_0028006
896 Ga0495631_0035210
897 Ga0495632_0014669
898 Ga0495632_0064091
899 Ga0495637_0005537
900 Ga0495637_0148168
901 Ga0495637_0176087
902 Ga0495643_0074552
903 Ga0495643_0111963
904 Ga0495643_0160654
905 Ga0495644_0189427
906 Ga0495648_0006099
907 Ga0495648_0082236
908 Ga0495663_0044823
909 Ga0495642_0018738
910 Ga0495652_0313071
911 Ga0495652_0456862
912 Ga0495654_0000010
913 Ga0495609_0018852
914 Ga0495621_0071569
915 Ga0495597_0051046
916 Ga0495597_0174724
917 Ga0495597_0300396
918 Ga0495645_0011498
919 Ga0495668_0000060
920 Ga0495668_0008967
921 Ga0495668_0019157
922 Ga0495668_0041650
923 Ga0495668_0097354
924 Ga0495668_0188513
925 Ga0495668_0389200
926 Ga0495668_0759180
927 Ga0495611_0002026
928 Ga0495625_0000295
929 Ga0495625_0005488
930 Ga0495625_0016869
931 Ga0495625_0027456
932 Ga0495625_0031655
933 Ga0495625_0246383
934 Ga0495669_0000044
935 Ga0495669_0011743
936 Ga0495669_0131740
937 Ga0495670_0354163
938 Ga0495671_0271091
939 Ga0495671_0296727
940 Ga0495671_0327072
941 Ga0495589_0253590
942 Ga0495660_0032042
943 Ga0495660_0064715
944 Ga0495660_0083741
945 Ga0495660_0199637
946 Ga0495672_0002626
947 Ga0495672_0039530
948 Ga0495672_0051246
949 Ga0495679_014415
950 Ga0495673_0000195
951 Ga0495673_0000272
952 Ga0495673_0003251
953 Ga0495681_0086749
954 Ga0495686_0003661
955 Ga0495686_0005537
956 Ga0495686_0043295
957 Ga0495686_0428962
958 Ga0496100_0209305
959 Ga0496100_1225203
960 Ga0496106_0001132
961 Ga0496107_0000140
962 Ga0496107_0951740
963 Ga0496108_0088190
964 Ga0496109_0055139
965 Ga0496110_0273267
966 Ga0496112_0043102
967 Ga0496112_0118935
968 Ga0496112_0177078
969 Ga0496112_1746582
970 Ga0496113_0248385
971 Ga0496115_0005976
972 Ga0496115_0007301
973 Ga0496115_0156984
974 Ga0496115_0206751
975 Ga0496115_0338518
976 Ga0496121_0010215
977 Ga0496121_0214027
978 Ga0496121_0584505
979 Ga0496124_0018993
980 Ga0496125_0009514
981 Ga0496126_0038915
982 Ga0496126_0201624
983 Ga0501033_0015284
984 Ga0501033_0101106
985 Ga0501033_0267414
986 Ga0501033_0881826
987 Ga0501034_0023999
988 Ga0501034_0045193
989 Ga0501034_0095124
990 Ga0501037_0024773
991 Ga0501037_0154241
992 Ga0501047_0089727
993 Ga0501047_0155441
994 Ga0501047_0199361
995 Ga0501047_0338201
996 Ga0501048_0467337
997 Ga0501238_001142
998 Ga0501238_024679
999 Ga0501080_0527774
1000 Ga0501035_0075853
1001 Ga0501035_0135642
1002 Ga0501035_0581890
1003 Ga0501035_0752247
1004 Ga0501044_0005373
1005 Ga0501044_0020905
1006 nmdc:mga0k408_397255_c1
1007 nmdc:mga0k408_97842_c1
1008 nmdc:mga07m45_115058_c1
1009 nmdc:mga07m45_388135_c1
1010 nmdc:mga07m45_657133_c1
1011 Ga0500635_0001825
1012 Ga0500578_0003007
1013 Ga0500643_003002
1014 Ga0500643_110833
1015 Ga0500644_0001942
1016 Ga0500644_0004193
1017 Ga0500644_0375550
1018 Ga0500647_0001118
1019 Ga0500641_0026882
1020 Ga0500650_0264732
1021 Ga0500554_010642
1022 Ga0500555_046627
1023 Ga0500556_0001319
1024 Ga0500562_000816
1025 Ga0500562_002408
1026 Ga0500562_152700
1027 Ga0500572_000391
1028 Ga0500593_175873
1029 Ga0500594_0000265
1030 Ga0500608_000007
1031 Ga0500608_074511
1032 Ga0500614_051464
1033 Ga0500618_000996
1034 Ga0500652_218899
1035 Ga0500658_0001497
1036 Ga0500559_0000232
1037 Ga0500559_0004136
1038 Ga0500559_0018514
1039 Ga0500559_0230585
1040 Ga0500564_000054
1041 Ga0500577_0005314
1042 Ga0500590_262129
1043 Ga0500616_0043775
1044 Ga0500616_0161868
1045 Ga0500616_0368057
1046 Ga0500622_0001898
1047 Ga0500622_0005891
1048 Ga0500622_0007547
1049 Ga0500622_0007985
1050 Ga0500622_0008795
1051 Ga0500634_0320816
1052 Ga0500611_001977
1053 Ga0500645_002600
1054 Ga0500645_005978
1055 Ga0500609_000248
1056 Ga0500552_001688
1057 Ga0501084_0350781
1058 Ga0466962_0004757
1059 Ga0466962_0707972
1060 2511123342
1061 2585146926
1062 2585155715
1063 2585198333
1064 2587919400
1065 2643750816
1066 2643779228
1067 2643925687
1068 2643931404
1069 2644000496
1070 2644084735
1071 2644225229
1072 2644232537
1073 2644342287
1074 2644365587
1075 2644509890
1076 2739790138
1077 2792461117
1078 2819540051
1079 2819648949
1080 2843749403
1081 2849562623
1082 2849578439
1083 2851156047
1084 2857504640
1085 2884965162
1086 2898333991
1087 2928534357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05656

DUF805

Protein of unknown function (DUF805)

22

139

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eqz-assembly1.cif.gz_A crystal structure of a rev protein from borrelia burgdorferi at 1.80 a resolution 0.4876 19 123
3vuq-assembly2.cif.gz_D crystal structure of ttha0167, a transcriptional regulator, tetr/acrr family from thermus thermophilus hb8 0.3584 2 126
3ux4-assembly1.cif.gz_A crystal structure of the urea channel from the human gastric pathogen helicobacter pylori 0.3358 31 122
5eqz-assembly1.cif.gz_A crystal structure of a rev protein from borrelia burgdorferi at 1.80 a resolution 0.3313 19 123
7wtz-assembly1.cif.gz_S cryo-em structure of a human pre-40s ribosomal subunit - state rrp12-b2 0.3257 75 136
ID Description Score Start End Superfamily
af_P0AF34_7_133_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7773 22 136 1.20.140.150
af_P0AF34_7_133_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7071 22 136 1.20.140.150
af_P64592_11_113_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5936 25 136 1.20.140.150
af_P64592_11_113_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.561 25 136 1.20.140.150
af_Q2FVS2_20_180_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5238 25 137 1.20.140.150
ID Description Score Start End GO Terms
AF-V4NDQ4-F1-model_v4 DUF805 domain-containing protein 0.9772 11 126 GO:0016020
AF-V4NDQ4-F1-model_v4 DUF805 domain-containing protein 0.9689 11 126 GO:0016020
AF-A0A7Y8F2M9-F1-model_v4 DUF805 domain-containing protein 0.9559 14 140 GO:0005886
AF-V4NU84-F1-model_v4 Membrane protein 0.9532 11 143 GO:0005886
AF-A0A7Y8F2M9-F1-model_v4 DUF805 domain-containing protein 0.9486 14 140 GO:0005886

Map