F461691
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 544 | 321 | 535 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300003316|rootH1_10045285|rootH1_100452852 |
| Length | 127 |
| Sequence | MIAGRKVRTMNTAANIVVALVALIHVYILVLEMFLWTTPTGRKAFGLTPEFAEASKVLAANQGLYNGFLAAGLIWGLVLGAAGGPVKVFFLACVLVAGLYGAATASRKILFIQALPAAIGLALLLLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 3 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 4 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 5 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 6 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 7 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 8 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 101 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 116 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 117 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 208 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 209 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 211 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 215 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 218 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 226 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 234 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 235 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 236 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 237 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 238 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 239 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 240 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 241 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 242 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 243 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 244 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 245 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 246 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 247 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 248 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 249 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 250 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 288 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 294 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 295 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 296 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 297 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 299 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 300 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 301 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 303 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 305 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 311 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 312 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 314 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 315 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 316 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 317 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 318 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 319 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 320 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 321 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.35 |
| Metatranscriptomes | 0 |
| Isolates | 1.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.97 |
| Nodule | 1.1 |
| Rhizoplane | 7.72 |
| Rhizosphere | 70.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1010978 | 3300001977 | Bacteria | 1335 |
| 2 | JGI24748J21848_1010592 | 3300002074 | Bacteria | 1084 |
| 3 | JGI24738J21930_10034570 | 3300002075 | Bacteria | 1029 |
| 4 | JGI24749J21850_1001786 | 3300002076 | Bacteria | 3044 |
| 5 | JGI24034J26672_10010265 | 3300002239 | Bacteria | 1389 |
| 6 | rootH1_10045285 | 3300003316 | Bacteria | 2739 |
| 7 | rootH2_10096204 | 3300003320 | Bacteria | 5143 |
| 8 | rootH2_10152404 | 3300003320 | Bacteria | 1364 |
| 9 | rootL2_10000464 | 3300003322 | Bacteria | 48939 |
| 10 | rootH1_10014154 | 3300003323 | Bacteria | 5230 |
| 11 | rootH1_10075537 | 3300003323 | Bacteria | 4837 |
| 12 | Ga0055526_1013231 | 3300003771 | Bacteria | 3509 |
| 13 | Ga0055524_1000516 | 3300003775 | Bacteria | 29808 |
| 14 | Ga0055524_1018850 | 3300003775 | Bacteria | 2380 |
| 15 | Ga0055531_10000958 | 3300003794 | Bacteria | 23160 |
| 16 | Ga0055531_10011808 | 3300003794 | Bacteria | 4170 |
| 17 | Ga0055543_1000901 | 3300004625 | Bacteria | 14013 |
| 18 | Ga0055543_1008989 | 3300004625 | Bacteria | 2176 |
| 19 | Ga0065165_1000356 | 3300005262 | Bacteria | 75078 |
| 20 | Ga0065165_1000573 | 3300005262 | Bacteria | 54490 |
| 21 | Ga0065704_10030426 | 3300005289 | Bacteria | 965 |
| 22 | Ga0065707_10305528 | 3300005295 | Bacteria | 984 |
| 23 | Ga0070658_10346077 | 3300005327 | Bacteria | 1272 |
| 24 | Ga0070676_10150692 | 3300005328 | Bacteria | 1488 |
| 25 | Ga0070683_100086296 | 3300005329 | Bacteria | 2943 |
| 26 | Ga0070683_100100825 | 3300005329 | Bacteria | 2718 |
| 27 | Ga0070690_100045076 | 3300005330 | Bacteria | 2800 |
| 28 | Ga0070670_100027381 | 3300005331 | Bacteria | 4904 |
| 29 | Ga0070670_100032959 | 3300005331 | Bacteria | 4464 |
| 30 | Ga0070670_100301775 | 3300005331 | Bacteria | 1401 |
| 31 | Ga0070677_10071518 | 3300005333 | Bacteria | 1460 |
| 32 | Ga0068869_100031397 | 3300005334 | Bacteria | 3736 |
| 33 | Ga0068869_100269514 | 3300005334 | Bacteria | 1366 |
| 34 | Ga0070666_10845855 | 3300005335 | Bacteria | 675 |
| 35 | Ga0070666_10914309 | 3300005335 | Bacteria | 649 |
| 36 | Ga0070682_100313801 | 3300005337 | Bacteria | 1155 |
| 37 | Ga0070682_100816383 | 3300005337 | Bacteria | 759 |
| 38 | Ga0068868_100129455 | 3300005338 | Bacteria | 2064 |
| 39 | Ga0070660_100455012 | 3300005339 | Bacteria | 1062 |
| 40 | Ga0070689_100134960 | 3300005340 | Bacteria | 1981 |
| 41 | Ga0070691_10143131 | 3300005341 | Bacteria | 1220 |
| 42 | Ga0070687_100099164 | 3300005343 | Bacteria | 1628 |
| 43 | Ga0070661_100007619 | 3300005344 | Bacteria | 7467 |
| 44 | Ga0070661_100290433 | 3300005344 | Bacteria | 1270 |
| 45 | Ga0070661_100697182 | 3300005344 | Bacteria | 827 |
| 46 | Ga0070661_101914343 | 3300005344 | Bacteria | 504 |
| 47 | Ga0070692_10044241 | 3300005345 | Bacteria | 2293 |
| 48 | Ga0070692_10716164 | 3300005345 | Bacteria | 675 |
| 49 | Ga0070668_100003517 | 3300005347 | Bacteria | 11551 |
| 50 | Ga0070668_100553594 | 3300005347 | Bacteria | 1001 |
| 51 | Ga0070668_100646363 | 3300005347 | Bacteria | 929 |
| 52 | Ga0070668_101522662 | 3300005347 | Bacteria | 612 |
| 53 | Ga0070669_101906289 | 3300005353 | Bacteria | 519 |
| 54 | Ga0070675_100068617 | 3300005354 | Bacteria | 2936 |
| 55 | Ga0070671_100046910 | 3300005355 | Bacteria | 3593 |
| 56 | Ga0070671_100168620 | 3300005355 | Bacteria | 1851 |
| 57 | Ga0070671_100425800 | 3300005355 | Bacteria | 1137 |
| 58 | Ga0070674_100052301 | 3300005356 | Bacteria | 2817 |
| 59 | Ga0070673_100609687 | 3300005364 | Bacteria | 996 |
| 60 | Ga0070688_100001847 | 3300005365 | Bacteria | 10643 |
| 61 | Ga0070659_100089046 | 3300005366 | Bacteria | 2472 |
| 62 | Ga0070659_100593657 | 3300005366 | Bacteria | 951 |
| 63 | Ga0070667_100054239 | 3300005367 | Bacteria | 3385 |
| 64 | Ga0070667_100643711 | 3300005367 | Bacteria | 978 |
| 65 | Ga0070667_101328966 | 3300005367 | Bacteria | 674 |
| 66 | Ga0070709_10635278 | 3300005434 | Bacteria | 825 |
| 67 | Ga0070709_11623370 | 3300005434 | Bacteria | 527 |
| 68 | Ga0070714_100247963 | 3300005435 | Bacteria | 1646 |
| 69 | Ga0070710_11425876 | 3300005437 | Bacteria | 518 |
| 70 | Ga0070701_10071520 | 3300005438 | Bacteria | 1856 |
| 71 | Ga0070711_100244391 | 3300005439 | Bacteria | 1405 |
| 72 | Ga0070700_100283320 | 3300005441 | Bacteria | 1202 |
| 73 | Ga0070700_100858005 | 3300005441 | Bacteria | 736 |
| 74 | Ga0070694_100604743 | 3300005444 | Bacteria | 883 |
| 75 | Ga0070708_100863480 | 3300005445 | Bacteria | 850 |
| 76 | Ga0070663_100008796 | 3300005455 | Bacteria | 6230 |
| 77 | Ga0070663_100087107 | 3300005455 | Bacteria | 2307 |
| 78 | Ga0070663_100443366 | 3300005455 | Bacteria | 1069 |
| 79 | Ga0070678_100112375 | 3300005456 | Bacteria | 2133 |
| 80 | Ga0070678_101582632 | 3300005456 | Bacteria | 615 |
| 81 | Ga0070662_100002735 | 3300005457 | Bacteria | 10898 |
| 82 | Ga0070662_100200398 | 3300005457 | Bacteria | 1583 |
| 83 | Ga0068867_100134381 | 3300005459 | Bacteria | 1926 |
| 84 | Ga0070685_10003125 | 3300005466 | Bacteria | 8420 |
| 85 | Ga0070685_10006870 | 3300005466 | Bacteria | 5808 |
| 86 | Ga0070685_10552315 | 3300005466 | Bacteria | 822 |
| 87 | Ga0070699_100198668 | 3300005518 | Bacteria | 1783 |
| 88 | Ga0070679_100135392 | 3300005530 | Bacteria | 2445 |
| 89 | Ga0070679_100218284 | 3300005530 | Bacteria | 1868 |
| 90 | Ga0070684_100883907 | 3300005535 | Bacteria | 837 |
| 91 | Ga0070684_101204764 | 3300005535 | Bacteria | 712 |
| 92 | Ga0068853_100054698 | 3300005539 | Bacteria | 3440 |
| 93 | Ga0070686_100092923 | 3300005544 | Bacteria | 2022 |
| 94 | Ga0070693_100091145 | 3300005547 | Bacteria | 1838 |
| 95 | Ga0070693_100110652 | 3300005547 | Bacteria | 1689 |
| 96 | Ga0070665_100000185 | 3300005548 | Bacteria | 111130 |
| 97 | Ga0070665_100083469 | 3300005548 | Bacteria | 3200 |
| 98 | Ga0070665_100085358 | 3300005548 | Bacteria | 3162 |
| 99 | Ga0068855_100082310 | 3300005563 | Bacteria | 3731 |
| 100 | Ga0070664_100069516 | 3300005564 | Bacteria | 3013 |
| 101 | Ga0070664_100216956 | 3300005564 | Bacteria | 1711 |
| 102 | Ga0070664_101279563 | 3300005564 | Bacteria | 692 |
| 103 | Ga0068857_100004957 | 3300005577 | Bacteria | 11309 |
| 104 | Ga0068857_100065716 | 3300005577 | Bacteria | 3226 |
| 105 | Ga0068854_100043113 | 3300005578 | Bacteria | 3196 |
| 106 | Ga0068854_100541783 | 3300005578 | Bacteria | 986 |
| 107 | Ga0068856_100192043 | 3300005614 | Bacteria | 2056 |
| 108 | Ga0068856_100252439 | 3300005614 | Bacteria | 1779 |
| 109 | Ga0068856_100893748 | 3300005614 | Bacteria | 907 |
| 110 | Ga0070702_100024578 | 3300005615 | Bacteria | 3216 |
| 111 | Ga0070702_101370961 | 3300005615 | Bacteria | 577 |
| 112 | Ga0068852_100008993 | 3300005616 | Bacteria | 7394 |
| 113 | Ga0068852_100016822 | 3300005616 | Bacteria | 5718 |
| 114 | Ga0068852_100381703 | 3300005616 | Bacteria | 1382 |
| 115 | Ga0068859_100081731 | 3300005617 | Bacteria | 3273 |
| 116 | Ga0068859_101560674 | 3300005617 | Bacteria | 729 |
| 117 | Ga0068864_100025205 | 3300005618 | Bacteria | 5007 |
| 118 | Ga0068864_100510315 | 3300005618 | Bacteria | 1158 |
| 119 | Ga0068864_101087964 | 3300005618 | Bacteria | 795 |
| 120 | Ga0068864_101216395 | 3300005618 | Bacteria | 752 |
| 121 | Ga0068866_10058862 | 3300005718 | Bacteria | 1985 |
| 122 | Ga0068861_100021803 | 3300005719 | Bacteria | 4607 |
| 123 | Ga0068851_10019001 | 3300005834 | Bacteria | 3319 |
| 124 | Ga0068851_10051127 | 3300005834 | Bacteria | 2100 |
| 125 | Ga0068851_10293941 | 3300005834 | Bacteria | 932 |
| 126 | Ga0068870_10007140 | 3300005840 | Bacteria | 4968 |
| 127 | Ga0068870_11083131 | 3300005840 | Bacteria | 575 |
| 128 | Ga0068863_100121499 | 3300005841 | Bacteria | 2491 |
| 129 | Ga0068863_100124753 | 3300005841 | Bacteria | 2456 |
| 130 | Ga0068863_100813829 | 3300005841 | Bacteria | 932 |
| 131 | Ga0068863_101177970 | 3300005841 | Bacteria | 772 |
| 132 | Ga0068858_100129152 | 3300005842 | Bacteria | 2368 |
| 133 | Ga0068858_100460553 | 3300005842 | Bacteria | 1226 |
| 134 | Ga0068860_100212145 | 3300005843 | Bacteria | 1878 |
| 135 | Ga0068862_100333357 | 3300005844 | Bacteria | 1403 |
| 136 | Ga0068862_102037511 | 3300005844 | Bacteria | 585 |
| 137 | Ga0075365_10185155 | 3300006038 | Bacteria | 1456 |
| 138 | Ga0075363_100558785 | 3300006048 | Bacteria | 683 |
| 139 | Ga0075364_10557595 | 3300006051 | Bacteria | 783 |
| 140 | Ga0070712_100296678 | 3300006175 | Bacteria | 1307 |
| 141 | Ga0070712_101725381 | 3300006175 | Bacteria | 548 |
| 142 | Ga0075362_10037852 | 3300006177 | Bacteria | 2117 |
| 143 | Ga0075362_10148759 | 3300006177 | Bacteria | 1123 |
| 144 | Ga0075367_10038276 | 3300006178 | Bacteria | 2791 |
| 145 | Ga0075367_11035035 | 3300006178 | Bacteria | 524 |
| 146 | Ga0075366_10001146 | 3300006195 | Bacteria | 13109 |
| 147 | Ga0075366_10003385 | 3300006195 | Bacteria | 8403 |
| 148 | Ga0075366_10045891 | 3300006195 | Bacteria | 2589 |
| 149 | Ga0075366_10067193 | 3300006195 | Bacteria | 2133 |
| 150 | Ga0075366_10116191 | 3300006195 | Bacteria | 1611 |
| 151 | Ga0075366_10205092 | 3300006195 | Bacteria | 1199 |
| 152 | Ga0097621_100165768 | 3300006237 | Bacteria | 1902 |
| 153 | Ga0097621_100176445 | 3300006237 | Bacteria | 1844 |
| 154 | Ga0097621_101517208 | 3300006237 | Bacteria | 636 |
| 155 | Ga0075370_10003205 | 3300006353 | Bacteria | 7747 |
| 156 | Ga0075370_10003763 | 3300006353 | Bacteria | 7259 |
| 157 | Ga0075370_10017666 | 3300006353 | Bacteria | 3856 |
| 158 | Ga0075370_10167873 | 3300006353 | Bacteria | 1289 |
| 159 | Ga0075370_10264816 | 3300006353 | Bacteria | 1020 |
| 160 | Ga0068871_100096947 | 3300006358 | Bacteria | 2464 |
| 161 | Ga0068871_100175188 | 3300006358 | Bacteria | 1841 |
| 162 | Ga0068871_100280028 | 3300006358 | Bacteria | 1459 |
| 163 | Ga0075429_100050202 | 3300006880 | Bacteria | 3630 |
| 164 | Ga0068865_100025774 | 3300006881 | Bacteria | 3872 |
| 165 | Ga0097620_100081731 | 3300006931 | Bacteria | 3273 |
| 166 | Ga0097620_101560461 | 3300006931 | Bacteria | 729 |
| 167 | Ga0099823_1000025 | 3300006944 | Bacteria | 73278 |
| 168 | Ga0079104_1000314 | 3300006946 | Bacteria | 61159 |
| 169 | Ga0099794_10641017 | 3300007265 | Bacteria | 564 |
| 170 | Ga0105244_10000896 | 3300009036 | Bacteria | 25177 |
| 171 | Ga0105250_10002300 | 3300009092 | Bacteria | 9695 |
| 172 | Ga0105240_10371002 | 3300009093 | Bacteria | 1618 |
| 173 | Ga0111539_10212294 | 3300009094 | Bacteria | 2255 |
| 174 | Ga0105245_12948553 | 3300009098 | Bacteria | 527 |
| 175 | Ga0105243_10001537 | 3300009148 | Bacteria | 20174 |
| 176 | Ga0105243_10007505 | 3300009148 | Bacteria | 8380 |
| 177 | Ga0105243_12442717 | 3300009148 | Bacteria | 561 |
| 178 | Ga0105242_10062751 | 3300009176 | Bacteria | 3059 |
| 179 | Ga0105248_10014429 | 3300009177 | Bacteria | 8696 |
| 180 | Ga0105248_10419855 | 3300009177 | Bacteria | 1506 |
| 181 | Ga0105248_10907050 | 3300009177 | Bacteria | 995 |
| 182 | Ga0105237_10404189 | 3300009545 | Bacteria | 1370 |
| 183 | Ga0105238_10521372 | 3300009551 | Bacteria | 1191 |
| 184 | Ga0105238_10922791 | 3300009551 | Bacteria | 892 |
| 185 | Ga0105249_10154928 | 3300009553 | Bacteria | 2209 |
| 186 | Ga0105246_10233068 | 3300011119 | Bacteria | 1451 |
| 187 | Ga0105246_10600644 | 3300011119 | Bacteria | 951 |
| 188 | Ga0157317_1000361 | 3300012475 | Bacteria | 1827 |
| 189 | Ga0157319_1000014 | 3300012497 | Bacteria | 139356 |
| 190 | Ga0157313_1017553 | 3300012503 | Bacteria | 695 |
| 191 | Ga0157373_10416051 | 3300013100 | Bacteria | 965 |
| 192 | Ga0157371_10290684 | 3300013102 | Bacteria | 1182 |
| 193 | Ga0157371_11666170 | 3300013102 | Bacteria | 500 |
| 194 | Ga0157370_10000842 | 3300013104 | Bacteria | 38924 |
| 195 | Ga0157370_10059286 | 3300013104 | Bacteria | 3637 |
| 196 | Ga0157370_10211622 | 3300013104 | Bacteria | 1797 |
| 197 | Ga0157370_10519690 | 3300013104 | Bacteria | 1093 |
| 198 | Ga0157369_10031755 | 3300013105 | Bacteria | 5811 |
| 199 | Ga0157374_10010308 | 3300013296 | Bacteria | 8037 |
| 200 | Ga0157374_10039321 | 3300013296 | Bacteria | 4353 |
| 201 | Ga0157374_11152236 | 3300013296 | Bacteria | 796 |
| 202 | Ga0157378_10361261 | 3300013297 | Bacteria | 1421 |
| 203 | Ga0163162_10369721 | 3300013306 | Bacteria | 1567 |
| 204 | Ga0157372_10347452 | 3300013307 | Bacteria | 1728 |
| 205 | Ga0157372_10841917 | 3300013307 | Bacteria | 1065 |
| 206 | Ga0157372_11114536 | 3300013307 | Bacteria | 913 |
| 207 | Ga0157375_10418744 | 3300013308 | Bacteria | 1506 |
| 208 | Ga0157375_10452521 | 3300013308 | Bacteria | 1449 |
| 209 | Ga0157380_10221869 | 3300014326 | Bacteria | 1692 |
| 210 | Ga0157380_11540889 | 3300014326 | Bacteria | 719 |
| 211 | Ga0157377_10001430 | 3300014745 | Bacteria | 10296 |
| 212 | Ga0157376_10051813 | 3300014969 | Bacteria | 3410 |
| 213 | Ga0157376_10186912 | 3300014969 | Bacteria | 1897 |
| 214 | Ga0157376_11202233 | 3300014969 | Bacteria | 786 |
| 215 | Ga0157376_12048957 | 3300014969 | Bacteria | 610 |
| 216 | Ga0163161_10004424 | 3300017792 | Bacteria | 9801 |
| 217 | Ga0163161_10162912 | 3300017792 | Bacteria | 1701 |
| 218 | Ga0163161_12053460 | 3300017792 | Bacteria | 508 |
| 219 | Ga0213876_10234259 | 3300021384 | Bacteria | 976 |
| 220 | Ga0207425_1040973 | 3300025245 | Bacteria | 882 |
| 221 | Ga0209673_1002109 | 3300025273 | Bacteria | 14921 |
| 222 | Ga0209673_1054321 | 3300025273 | Bacteria | 1038 |
| 223 | Ga0209673_1059677 | 3300025273 | Bacteria | 960 |
| 224 | Ga0209564_1000120 | 3300025295 | Bacteria | 204226 |
| 225 | Ga0209050_1001224 | 3300025298 | Bacteria | 29786 |
| 226 | Ga0209256_1000391 | 3300025299 | Bacteria | 69634 |
| 227 | Ga0209256_1001174 | 3300025299 | Bacteria | 29515 |
| 228 | Ga0209051_1001334 | 3300025303 | Bacteria | 21469 |
| 229 | Ga0209257_1001286 | 3300025304 | Bacteria | 30635 |
| 230 | Ga0209257_1001981 | 3300025304 | Bacteria | 22011 |
| 231 | Ga0207697_10006661 | 3300025315 | Bacteria | 5204 |
| 232 | Ga0207656_10007540 | 3300025321 | Bacteria | 3968 |
| 233 | Ga0207656_10219678 | 3300025321 | Bacteria | 923 |
| 234 | Ga0207696_1000007 | 3300025711 | Bacteria | 578417 |
| 235 | Ga0207696_1004149 | 3300025711 | Bacteria | 6332 |
| 236 | Ga0207655_1008820 | 3300025728 | Bacteria | 6343 |
| 237 | Ga0207713_1000005 | 3300025735 | Bacteria | 649958 |
| 238 | Ga0207682_10001376 | 3300025893 | Bacteria | 11224 |
| 239 | Ga0207688_10007810 | 3300025901 | Bacteria | 5821 |
| 240 | Ga0207680_10038458 | 3300025903 | Bacteria | 2769 |
| 241 | Ga0207680_10340481 | 3300025903 | Bacteria | 1052 |
| 242 | Ga0207680_10561771 | 3300025903 | Bacteria | 815 |
| 243 | Ga0207647_10112692 | 3300025904 | Bacteria | 1607 |
| 244 | Ga0207699_10840419 | 3300025906 | Bacteria | 676 |
| 245 | Ga0207645_10003236 | 3300025907 | Bacteria | 12442 |
| 246 | Ga0207643_10001910 | 3300025908 | Bacteria | 11499 |
| 247 | Ga0207643_10852894 | 3300025908 | Bacteria | 590 |
| 248 | Ga0207705_10120631 | 3300025909 | Bacteria | 1945 |
| 249 | Ga0207705_10138843 | 3300025909 | Bacteria | 1814 |
| 250 | Ga0207654_10373264 | 3300025911 | Bacteria | 986 |
| 251 | Ga0207695_10151483 | 3300025913 | Bacteria | 2258 |
| 252 | Ga0207671_10030967 | 3300025914 | Bacteria | 3989 |
| 253 | Ga0207671_10799290 | 3300025914 | Bacteria | 748 |
| 254 | Ga0207693_10135152 | 3300025915 | Bacteria | 1938 |
| 255 | Ga0207662_10014972 | 3300025918 | Bacteria | 4357 |
| 256 | Ga0207657_10193463 | 3300025919 | Bacteria | 1640 |
| 257 | Ga0207649_10257545 | 3300025920 | Bacteria | 1259 |
| 258 | Ga0207649_10613914 | 3300025920 | Bacteria | 837 |
| 259 | Ga0207649_10869746 | 3300025920 | Bacteria | 706 |
| 260 | Ga0207652_10517069 | 3300025921 | Bacteria | 1074 |
| 261 | Ga0207652_11230702 | 3300025921 | Bacteria | 651 |
| 262 | Ga0207681_10123337 | 3300025923 | Bacteria | 1903 |
| 263 | Ga0207650_10008159 | 3300025925 | Bacteria | 7140 |
| 264 | Ga0207650_10116218 | 3300025925 | Bacteria | 2077 |
| 265 | Ga0207650_10531789 | 3300025925 | Bacteria | 984 |
| 266 | Ga0207659_10001220 | 3300025926 | Bacteria | 15376 |
| 267 | Ga0207659_10005473 | 3300025926 | Bacteria | 7700 |
| 268 | Ga0207659_11546790 | 3300025926 | Bacteria | 567 |
| 269 | Ga0207687_10343426 | 3300025927 | Bacteria | 1214 |
| 270 | Ga0207644_10037965 | 3300025931 | Bacteria | 3390 |
| 271 | Ga0207644_10049641 | 3300025931 | Bacteria | 3005 |
| 272 | Ga0207644_10050405 | 3300025931 | Bacteria | 2984 |
| 273 | Ga0207644_10173371 | 3300025931 | Bacteria | 1686 |
| 274 | Ga0207690_10031466 | 3300025932 | Bacteria | 3395 |
| 275 | Ga0207690_10561258 | 3300025932 | Bacteria | 929 |
| 276 | Ga0207706_10000618 | 3300025933 | Bacteria | 37720 |
| 277 | Ga0207706_10006454 | 3300025933 | Bacteria | 10893 |
| 278 | Ga0207706_10031049 | 3300025933 | Bacteria | 4762 |
| 279 | Ga0207686_10345198 | 3300025934 | Bacteria | 1119 |
| 280 | Ga0207709_10000310 | 3300025935 | Bacteria | 52953 |
| 281 | Ga0207709_10022625 | 3300025935 | Bacteria | 3566 |
| 282 | Ga0207709_10459706 | 3300025935 | Bacteria | 985 |
| 283 | Ga0207709_10489577 | 3300025935 | Bacteria | 958 |
| 284 | Ga0207670_10051612 | 3300025936 | Bacteria | 2762 |
| 285 | Ga0207669_11084325 | 3300025937 | Bacteria | 675 |
| 286 | Ga0207669_11616013 | 3300025937 | Bacteria | 553 |
| 287 | Ga0207704_10018091 | 3300025938 | Bacteria | 3670 |
| 288 | Ga0207691_10012341 | 3300025940 | Bacteria | 8189 |
| 289 | Ga0207711_10162677 | 3300025941 | Bacteria | 2021 |
| 290 | Ga0207711_10288479 | 3300025941 | Bacteria | 1512 |
| 291 | Ga0207711_10797178 | 3300025941 | Bacteria | 880 |
| 292 | Ga0207689_10007213 | 3300025942 | Bacteria | 9764 |
| 293 | Ga0207689_10116148 | 3300025942 | Bacteria | 2200 |
| 294 | Ga0207661_10080742 | 3300025944 | Bacteria | 2684 |
| 295 | Ga0207661_10197322 | 3300025944 | Bacteria | 1768 |
| 296 | Ga0207661_10784483 | 3300025944 | Bacteria | 877 |
| 297 | Ga0207679_10044426 | 3300025945 | Bacteria | 3205 |
| 298 | Ga0207679_10164904 | 3300025945 | Bacteria | 1818 |
| 299 | Ga0207667_10288080 | 3300025949 | Bacteria | 1678 |
| 300 | Ga0207651_10197114 | 3300025960 | Bacteria | 1610 |
| 301 | Ga0207712_10347097 | 3300025961 | Bacteria | 1233 |
| 302 | Ga0207712_10506088 | 3300025961 | Bacteria | 1033 |
| 303 | Ga0207668_10015690 | 3300025972 | Bacteria | 4711 |
| 304 | Ga0207668_10612239 | 3300025972 | Bacteria | 950 |
| 305 | Ga0207640_10032008 | 3300025981 | Bacteria | 3257 |
| 306 | Ga0207640_10085070 | 3300025981 | Bacteria | 2173 |
| 307 | Ga0207640_10678259 | 3300025981 | Bacteria | 881 |
| 308 | Ga0207658_10020837 | 3300025986 | Bacteria | 4542 |
| 309 | Ga0207658_10233934 | 3300025986 | Bacteria | 1552 |
| 310 | Ga0207677_10202082 | 3300026023 | Bacteria | 1580 |
| 311 | Ga0207677_10725639 | 3300026023 | Bacteria | 884 |
| 312 | Ga0207703_10031740 | 3300026035 | Bacteria | 4178 |
| 313 | Ga0207639_10104968 | 3300026041 | Bacteria | 2292 |
| 314 | Ga0207639_10424287 | 3300026041 | Bacteria | 1203 |
| 315 | Ga0207639_10839612 | 3300026041 | Bacteria | 857 |
| 316 | Ga0207678_10000065 | 3300026067 | Bacteria | 83028 |
| 317 | Ga0207678_10011862 | 3300026067 | Bacteria | 7652 |
| 318 | Ga0207678_10026390 | 3300026067 | Bacteria | 5068 |
| 319 | Ga0207678_10113310 | 3300026067 | Bacteria | 2314 |
| 320 | Ga0207708_10000557 | 3300026075 | Bacteria | 28820 |
| 321 | Ga0207702_10277726 | 3300026078 | Bacteria | 1582 |
| 322 | Ga0207702_10311575 | 3300026078 | Bacteria | 1497 |
| 323 | Ga0207702_10422415 | 3300026078 | Bacteria | 1289 |
| 324 | Ga0207641_10165438 | 3300026088 | Bacteria | 2014 |
| 325 | Ga0207641_10252186 | 3300026088 | Bacteria | 1648 |
| 326 | Ga0207641_12078075 | 3300026088 | Bacteria | 569 |
| 327 | Ga0207648_10003179 | 3300026089 | Bacteria | 17304 |
| 328 | Ga0207676_10065114 | 3300026095 | Bacteria | 2901 |
| 329 | Ga0207676_10345989 | 3300026095 | Bacteria | 1373 |
| 330 | Ga0207676_10627051 | 3300026095 | Bacteria | 1035 |
| 331 | Ga0207674_10007455 | 3300026116 | Bacteria | 12752 |
| 332 | Ga0207674_10010468 | 3300026116 | Bacteria | 10501 |
| 333 | Ga0207674_10334899 | 3300026116 | Bacteria | 1463 |
| 334 | Ga0207675_100005768 | 3300026118 | Bacteria | 11842 |
| 335 | Ga0207683_10058664 | 3300026121 | Bacteria | 3379 |
| 336 | Ga0207683_10606046 | 3300026121 | Bacteria | 1014 |
| 337 | Ga0207683_11869083 | 3300026121 | Bacteria | 549 |
| 338 | Ga0207698_10011417 | 3300026142 | Bacteria | 5759 |
| 339 | Ga0207698_10166275 | 3300026142 | Bacteria | 1936 |
| 340 | Ga0207698_10339387 | 3300026142 | Bacteria | 1414 |
| 341 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 342 | Ga0209389_1000270 | 3300027296 | Bacteria | 32662 |
| 343 | Ga0209371_1035912 | 3300027312 | Bacteria | 1040 |
| 344 | Ga0209999_1018696 | 3300027543 | Bacteria | 1269 |
| 345 | Ga0209970_1001043 | 3300027614 | Bacteria | 4908 |
| 346 | Ga0209813_10007150 | 3300027866 | Bacteria | 2773 |
| 347 | Ga0209974_10005259 | 3300027876 | Bacteria | 4568 |
| 348 | Ga0207428_10319444 | 3300027907 | Bacteria | 1147 |
| 349 | Ga0268266_10000345 | 3300028379 | Bacteria | 72371 |
| 350 | Ga0268266_10043019 | 3300028379 | Bacteria | 3859 |
| 351 | Ga0268266_11298286 | 3300028379 | Bacteria | 703 |
| 352 | Ga0268265_10445915 | 3300028380 | Bacteria | 1207 |
| 353 | Ga0268264_10557710 | 3300028381 | Bacteria | 1124 |
| 354 | Ga0268264_10653335 | 3300028381 | Bacteria | 1041 |
| 355 | Ga0307517_10216900 | 3300028786 | Bacteria | 1169 |
| 356 | Ga0307515_10000902 | 3300028794 | Bacteria | 68371 |
| 357 | Ga0307515_10000991 | 3300028794 | Bacteria | 64898 |
| 358 | Ga0307515_10002510 | 3300028794 | Bacteria | 39740 |
| 359 | Ga0307515_10252738 | 3300028794 | Bacteria | 1512 |
| 360 | Ga0307515_10451187 | 3300028794 | Bacteria | 901 |
| 361 | Ga0268256_1039269 | 3300030500 | Bacteria | 1070 |
| 362 | Ga0307512_10144826 | 3300030522 | Bacteria | 1441 |
| 363 | Ga0307512_10268601 | 3300030522 | Bacteria | 829 |
| 364 | Ga0265332_10261700 | 3300031238 | Bacteria | 715 |
| 365 | Ga0265320_10190493 | 3300031240 | Bacteria | 917 |
| 366 | Ga0265331_10381812 | 3300031250 | Bacteria | 631 |
| 367 | Ga0307513_10038536 | 3300031456 | Bacteria | 5306 |
| 368 | Ga0307513_10292611 | 3300031456 | Bacteria | 1399 |
| 369 | Ga0307509_10046944 | 3300031507 | Bacteria | 4647 |
| 370 | Ga0307408_100006837 | 3300031548 | Bacteria | 7563 |
| 371 | Ga0307508_10000007 | 3300031616 | Bacteria | 268359 |
| 372 | Ga0307508_10483760 | 3300031616 | Bacteria | 832 |
| 373 | Ga0307514_10013727 | 3300031649 | Bacteria | 6716 |
| 374 | Ga0265314_10059610 | 3300031711 | Bacteria | 2610 |
| 375 | Ga0307516_10058976 | 3300031730 | Bacteria | 3734 |
| 376 | Ga0307516_10114599 | 3300031730 | Bacteria | 2493 |
| 377 | Ga0307413_10920233 | 3300031824 | Bacteria | 744 |
| 378 | Ga0307410_12034813 | 3300031852 | Bacteria | 513 |
| 379 | Ga0307412_10866867 | 3300031911 | Bacteria | 789 |
| 380 | Ga0307412_11104813 | 3300031911 | Bacteria | 706 |
| 381 | Ga0307415_101955992 | 3300032126 | Bacteria | 570 |
| 382 | Ga0307510_10311995 | 3300033180 | Bacteria | 1032 |
| 383 | Ga0373951_0039404 | 3300035091 | Bacteria | 1136 |
| 384 | Ga0373946_0224007 | 3300035171 | Bacteria | 909 |
| 385 | Ga0373947_0061538 | 3300035725 | Bacteria | 2282 |
| 386 | Ga0373947_0336982 | 3300035725 | Bacteria | 1010 |
| 387 | Ga0395905_0385739 | 3300037471 | Bacteria | 1295 |
| 388 | Ga0436365_0149550 | 3300039437 | Bacteria | 1029 |
| 389 | Ga0451789_0932306 | 3300041443 | Bacteria | 529 |
| 390 | Ga0451793_1638594 | 3300041452 | Bacteria | 1979 |
| 391 | Ga0451833_0526556 | 3300041491 | Bacteria | 689 |
| 392 | Ga0451839_1148937 | 3300041496 | Bacteria | 641 |
| 393 | Ga0451847_0692594 | 3300041503 | Bacteria | 549 |
| 394 | Ga0451851_1006281 | 3300041507 | Bacteria | 566 |
| 395 | Ga0451843_0212037 | 3300041509 | Bacteria | 691 |
| 396 | Ga0451853_2087719 | 3300041512 | Bacteria | 929 |
| 397 | Ga0439443_077257 | 3300042003 | Bacteria | 615 |
| 398 | Ga0439446_0115896 | 3300042156 | Bacteria | 859 |
| 399 | Ga0451577_0191181 | 3300042876 | Bacteria | 1846 |
| 400 | Ga0466972_0020128 | 3300044658 | Bacteria | 3335 |
| 401 | Ga0453683_0251112 | 3300044673 | Bacteria | 1127 |
| 402 | Ga0466965_0000559 | 3300044683 | Bacteria | 13431 |
| 403 | Ga0466965_0008990 | 3300044683 | Bacteria | 4635 |
| 404 | Ga0466966_0001165 | 3300044684 | Bacteria | 16896 |
| 405 | Ga0466963_0012111 | 3300044694 | Bacteria | 5271 |
| 406 | Ga0466963_0079390 | 3300044694 | Bacteria | 2220 |
| 407 | Ga0466964_0000447 | 3300044706 | Bacteria | 12610 |
| 408 | Ga0466968_0159202 | 3300044735 | Bacteria | 1041 |
| 409 | Ga0466970_0005977 | 3300044765 | Bacteria | 6064 |
| 410 | Ga0466970_0014874 | 3300044765 | Bacteria | 4000 |
| 411 | Ga0466960_0164751 | 3300044901 | Bacteria | 1192 |
| 412 | Ga0466959_0039708 | 3300045049 | Bacteria | 3478 |
| 413 | Ga0451576_0841674 | 3300045051 | Bacteria | 963 |
| 414 | Ga0466958_0034103 | 3300045836 | Bacteria | 3035 |
| 415 | Ga0466967_0226252 | 3300045976 | Bacteria | 1779 |
| 416 | Ga0466967_1159217 | 3300045976 | Bacteria | 770 |
| 417 | Ga0466967_1262764 | 3300045976 | Bacteria | 736 |
| 418 | Ga0495638_0126886 | 3300046460 | Bacteria | 1503 |
| 419 | Ga0495638_0399059 | 3300046460 | Bacteria | 714 |
| 420 | Ga0495583_0380660 | 3300046506 | Bacteria | 555 |
| 421 | Ga0495606_0264711 | 3300046507 | Unclassified | 947 |
| 422 | Ga0495610_0058391 | 3300046512 | Bacteria | 1846 |
| 423 | Ga0495620_0112293 | 3300046515 | Bacteria | 1079 |
| 424 | Ga0495631_0347539 | 3300046518 | Bacteria | 631 |
| 425 | Ga0495632_0017593 | 3300046519 | Bacteria | 3941 |
| 426 | Ga0495632_0049803 | 3300046519 | Bacteria | 2069 |
| 427 | Ga0495643_0017292 | 3300046522 | Bacteria | 4217 |
| 428 | Ga0495648_0288851 | 3300046524 | Bacteria | 774 |
| 429 | Ga0495642_0352562 | 3300046528 | Bacteria | 647 |
| 430 | Ga0495621_0116390 | 3300046539 | Bacteria | 1030 |
| 431 | Ga0495597_0017307 | 3300046542 | Bacteria | 3395 |
| 432 | Ga0495668_0163659 | 3300046616 | Bacteria | 1219 |
| 433 | Ga0495611_0310144 | 3300046648 | Bacteria | 727 |
| 434 | Ga0495625_0009183 | 3300046660 | Bacteria | 8307 |
| 435 | Ga0495625_0027785 | 3300046660 | Bacteria | 4252 |
| 436 | Ga0495625_0281425 | 3300046660 | Bacteria | 1070 |
| 437 | Ga0495625_0410764 | 3300046660 | Bacteria | 844 |
| 438 | Ga0495658_0550215 | 3300046683 | Bacteria | 739 |
| 439 | Ga0495649_0005203 | 3300046694 | Bacteria | 8330 |
| 440 | Ga0495649_0194833 | 3300046694 | Bacteria | 1054 |
| 441 | Ga0495660_0101314 | 3300046810 | Bacteria | 1482 |
| 442 | Ga0495687_008233 | 3300047443 | Bacteria | 6001 |
| 443 | Ga0495679_186335 | 3300047446 | Bacteria | 549 |
| 444 | Ga0495686_0078919 | 3300047472 | Bacteria | 2014 |
| 445 | Ga0495626_0324554 | 3300048091 | Bacteria | 604 |
| 446 | Ga0496100_0075396 | 3300048903 | Bacteria | 2262 |
| 447 | Ga0496100_0080314 | 3300048903 | Bacteria | 2200 |
| 448 | Ga0496101_0037115 | 3300048904 | Bacteria | 3455 |
| 449 | Ga0496101_0078660 | 3300048904 | Bacteria | 2433 |
| 450 | Ga0496101_0559464 | 3300048904 | Bacteria | 904 |
| 451 | Ga0496102_0094836 | 3300048905 | Bacteria | 2765 |
| 452 | Ga0496102_0132105 | 3300048905 | Bacteria | 2338 |
| 453 | Ga0496102_1824883 | 3300048905 | Bacteria | 525 |
| 454 | Ga0496103_0237866 | 3300048906 | Bacteria | 1171 |
| 455 | Ga0496104_0001887 | 3300048907 | Bacteria | 18156 |
| 456 | Ga0496104_0151488 | 3300048907 | Bacteria | 2226 |
| 457 | Ga0496104_0286343 | 3300048907 | Bacteria | 1560 |
| 458 | Ga0496104_1062746 | 3300048907 | Bacteria | 713 |
| 459 | Ga0496105_0002376 | 3300048908 | Bacteria | 13640 |
| 460 | Ga0496105_0086706 | 3300048908 | Bacteria | 2587 |
| 461 | Ga0496105_0468867 | 3300048908 | Bacteria | 992 |
| 462 | Ga0496106_0066875 | 3300048909 | Bacteria | 2738 |
| 463 | Ga0496107_0015816 | 3300048910 | Bacteria | 5292 |
| 464 | Ga0496107_0105216 | 3300048910 | Bacteria | 2071 |
| 465 | Ga0496108_0003424 | 3300048911 | Bacteria | 12729 |
| 466 | Ga0496108_0059794 | 3300048911 | Bacteria | 3205 |
| 467 | Ga0496108_0264648 | 3300048911 | Bacteria | 1496 |
| 468 | Ga0496109_0005269 | 3300048912 | Bacteria | 10803 |
| 469 | Ga0496109_0005848 | 3300048912 | Bacteria | 10316 |
| 470 | Ga0496109_0168996 | 3300048912 | Bacteria | 2051 |
| 471 | Ga0496109_0395165 | 3300048912 | Bacteria | 1306 |
| 472 | Ga0496110_0024803 | 3300048913 | Bacteria | 5116 |
| 473 | Ga0496110_0951447 | 3300048913 | Unclassified | 766 |
| 474 | Ga0496110_1616051 | 3300048913 | Bacteria | 558 |
| 475 | Ga0496111_0171105 | 3300048914 | Bacteria | 1614 |
| 476 | Ga0496111_0338012 | 3300048914 | Bacteria | 1115 |
| 477 | Ga0496111_0473294 | 3300048914 | Bacteria | 923 |
| 478 | Ga0496112_0255811 | 3300048915 | Bacteria | 1701 |
| 479 | Ga0496112_1621474 | 3300048915 | Bacteria | 560 |
| 480 | Ga0496113_0059618 | 3300048916 | Bacteria | 2876 |
| 481 | Ga0496113_0122872 | 3300048916 | Bacteria | 2031 |
| 482 | Ga0496114_0014834 | 3300048917 | Bacteria | 6262 |
| 483 | Ga0496114_0030835 | 3300048917 | Bacteria | 4411 |
| 484 | Ga0496114_0038571 | 3300048917 | Bacteria | 3953 |
| 485 | Ga0496115_0001975 | 3300048918 | Bacteria | 14635 |
| 486 | Ga0496123_0263987 | 3300048926 | Bacteria | 842 |
| 487 | Ga0496124_0049007 | 3300048927 | Bacteria | 3605 |
| 488 | Ga0496124_0179432 | 3300048927 | Bacteria | 1631 |
| 489 | Ga0496125_0193065 | 3300048928 | Bacteria | 1342 |
| 490 | Ga0496126_0539193 | 3300048929 | Bacteria | 927 |
| 491 | Ga0495682_0369280 | 3300049460 | Bacteria | 505 |
| 492 | Ga0501202_073715 | 3300049652 | Bacteria | 791 |
| 493 | nmdc:mga03683_138719_c1 | 3300050489 | Bacteria | 1092 |
| 494 | nmdc:mga03683_29051_c1 | 3300050489 | Bacteria | 2203 |
| 495 | nmdc:mga03n38_32164_c1 | 3300050490 | Bacteria | 2220 |
| 496 | nmdc:mga03n38_451500_c1 | 3300050490 | Bacteria | 715 |
| 497 | nmdc:mga00v17_24167_c1 | 3300050491 | Bacteria | 3522 |
| 498 | nmdc:mga00v17_482881_c1 | 3300050491 | Bacteria | 804 |
| 499 | nmdc:mga0k408_107346_c1 | 3300050493 | Bacteria | 1649 |
| 500 | nmdc:mga0k408_11186_c1 | 3300050493 | Bacteria | 4880 |
| 501 | nmdc:mga0k408_117052_c1 | 3300050493 | Bacteria | 1577 |
| 502 | nmdc:mga0k408_1659_c1 | 3300050493 | Bacteria | 12024 |
| 503 | nmdc:mga0k408_3382_c1 | 3300050493 | Bacteria | 8453 |
| 504 | nmdc:mga0k408_45009_c1 | 3300050493 | Bacteria | 2546 |
| 505 | nmdc:mga0k408_664_c1 | 3300050493 | Bacteria | 18844 |
| 506 | nmdc:mga06z11_17968_c1 | 3300050494 | Bacteria | 3222 |
| 507 | nmdc:mga06z11_71468_c1 | 3300050494 | Bacteria | 1837 |
| 508 | nmdc:mga06z11_74325_c1 | 3300050494 | Bacteria | 1807 |
| 509 | nmdc:mga04h51_24540_c1 | 3300050495 | Bacteria | 1847 |
| 510 | nmdc:mga04h51_541711_c1 | 3300050495 | Bacteria | 501 |
| 511 | nmdc:mga07m45_129_c1 | 3300050496 | Bacteria | 29894 |
| 512 | nmdc:mga07m45_1421_c1 | 3300050496 | Bacteria | 10976 |
| 513 | nmdc:mga07m45_2714_c1 | 3300050496 | Bacteria | 7837 |
| 514 | nmdc:mga07m45_402765_c1 | 3300050496 | Bacteria | 794 |
| 515 | nmdc:mga07m45_602044_c1 | 3300050496 | Bacteria | 635 |
| 516 | nmdc:mga09592_47303_c1 | 3300050508 | Bacteria | 3626 |
| 517 | nmdc:mga08y16_11377_c1 | 3300050511 | Bacteria | 9351 |
| 518 | nmdc:mga08y16_1354008_c1 | 3300050511 | Bacteria | 677 |
| 519 | nmdc:mga0n895_45632_c1 | 3300050512 | Bacteria | 4277 |
| 520 | nmdc:mga0a205_1011738_c1 | 3300050515 | Bacteria | 678 |
| 521 | nmdc:mga0sz30_24403_c1 | 3300050516 | Bacteria | 2467 |
| 522 | nmdc:mga0sz30_324238_c1 | 3300050516 | Bacteria | 688 |
| 523 | Ga0500578_0199557 | 3300053086 | Bacteria | 1225 |
| 524 | Ga0500641_0000047 | 3300053096 | Bacteria | 60191 |
| 525 | Ga0500658_0036781 | 3300053134 | Bacteria | 1944 |
| 526 | Ga0500658_0056084 | 3300053134 | Bacteria | 1624 |
| 527 | Ga0500573_0298365 | 3300053140 | Bacteria | 807 |
| 528 | Ga0500616_0014641 | 3300053153 | Bacteria | 4501 |
| 529 | Ga0500616_0226976 | 3300053153 | Bacteria | 811 |
| 530 | Ga0500622_0001824 | 3300053156 | Bacteria | 16170 |
| 531 | Ga0500624_007660 | 3300053157 | Bacteria | 1492 |
| 532 | Ga0500634_0000026 | 3300053161 | Bacteria | 81353 |
| 533 | Ga0500634_0161946 | 3300053161 | Bacteria | 1031 |
| 534 | Ga0500587_007940 | 3300053739 | Bacteria | 1371 |
| 535 | Ga0466962_0064169 | 3300061719 | Bacteria | 1753 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10519690 | Ga0157370_105196902 | 94 |
| 2 | 3300031616 | Ga0307508_10483760 | Ga0307508_104837601 | 105 |
| 3 | 3300031730 | Ga0307516_10114599 | Ga0307516_101145992 | 105 |
| 4 | 3300005578 | Ga0068854_100541783 | Ga0068854_1005417832 | 106 |
| 5 | 3300049652 | Ga0501202_073715 | Ga0501202_073715_157_483 | 106 |
| 6 | 3300050496 | nmdc:mga07m45_602044_c1 | nmdc:mga07m45_602044_c1_299_625 | 107 |
| 7 | 3300004625 | Ga0055543_1000901 | Ga0055543_10009012 | 108 |
| 8 | 3300005262 | Ga0065165_1000356 | Ga0065165_100035624 | 108 |
| 9 | 3300005337 | Ga0070682_100313801 | Ga0070682_1003138011 | 109 |
| 10 | 3300005295 | Ga0065707_10305528 | Ga0065707_103055282 | 110 |
| 11 | 3300006880 | Ga0075429_100050202 | Ga0075429_1000502023 | 110 |
| 12 | 3300005345 | Ga0070692_10716164 | Ga0070692_107161642 | 111 |
| 13 | iso_pu_bacteria | 2721755523 | 2722885345 | 111 |
| 14 | iso_pu_bacteria | 2839138175 | 2839143401 | 111 |
| 15 | iso_pu_bacteria | 2908669403 | 2908671156 | 112 |
| 16 | iso_pu_bacteria | 2928115317 | 2928120858 | 112 |
| 17 | iso_pu_bacteria | 8003314358 | 8003322305 | 112 |
| 18 | 3300005344 | Ga0070661_100697182 | Ga0070661_1006971822 | 113 |
| 19 | 3300005457 | Ga0070662_100002735 | Ga0070662_10000273510 | 113 |
| 20 | 3300025920 | Ga0207649_10613914 | Ga0207649_106139142 | 113 |
| 21 | 3300025933 | Ga0207706_10006454 | Ga0207706_100064543 | 113 |
| 22 | 3300042156 | Ga0439446_0115896 | Ga0439446_0115896_433_774 | 113 |
| 23 | iso_pu_bacteria | 2585428062 | 2587755553 | 113 |
| 24 | iso_pu_bacteria | 2886848708 | 2886852157 | 114 |
| 25 | iso_pu_bacteria | 2894023352 | 2894027932 | 114 |
| 26 | 3300003316 | rootH1_10045285 | rootH1_100452852 | 115 |
| 27 | 3300003320 | rootH2_10096204 | rootH2_100962045 | 115 |
| 28 | 3300003322 | rootL2_10000464 | rootL2_1000046419 | 115 |
| 29 | 3300003323 | rootH1_10014154 | rootH1_100141545 | 115 |
| 30 | 3300003775 | Ga0055524_1000516 | Ga0055524_100051621 | 115 |
| 31 | 3300003794 | Ga0055531_10011808 | Ga0055531_100118082 | 115 |
| 32 | 3300005289 | Ga0065704_10030426 | Ga0065704_100304262 | 115 |
| 33 | 3300005347 | Ga0070668_100646363 | Ga0070668_1006463632 | 115 |
| 34 | 3300005367 | Ga0070667_101328966 | Ga0070667_1013289661 | 115 |
| 35 | 3300005466 | Ga0070685_10552315 | Ga0070685_105523152 | 115 |
| 36 | 3300005614 | Ga0068856_100252439 | Ga0068856_1002524392 | 115 |
| 37 | 3300006038 | Ga0075365_10185155 | Ga0075365_101851552 | 115 |
| 38 | 3300006353 | Ga0075370_10017666 | Ga0075370_100176661 | 115 |
| 39 | 3300006358 | Ga0068871_100175188 | Ga0068871_1001751882 | 115 |
| 40 | 3300006946 | Ga0079104_1000314 | Ga0079104_100031444 | 115 |
| 41 | 3300009092 | Ga0105250_10002300 | Ga0105250_1000230012 | 115 |
| 42 | 3300009098 | Ga0105245_12948553 | Ga0105245_129485531 | 115 |
| 43 | 3300009148 | Ga0105243_10001537 | Ga0105243_100015377 | 115 |
| 44 | 3300011119 | Ga0105246_10600644 | Ga0105246_106006442 | 115 |
| 45 | 3300012475 | Ga0157317_1000361 | Ga0157317_10003612 | 115 |
| 46 | 3300012497 | Ga0157319_1000014 | Ga0157319_100001449 | 115 |
| 47 | 3300013307 | Ga0157372_10841917 | Ga0157372_108419172 | 115 |
| 48 | 3300013308 | Ga0157375_10452521 | Ga0157375_104525212 | 115 |
| 49 | 3300014326 | Ga0157380_11540889 | Ga0157380_115408892 | 115 |
| 50 | 3300017792 | Ga0163161_12053460 | Ga0163161_120534601 | 115 |
| 51 | 3300025299 | Ga0209256_1000391 | Ga0209256_100039144 | 115 |
| 52 | 3300025304 | Ga0209257_1001981 | Ga0209257_10019812 | 115 |
| 53 | 3300025711 | Ga0207696_1004149 | Ga0207696_10041491 | 115 |
| 54 | 3300025935 | Ga0207709_10000310 | Ga0207709_1000031037 | 115 |
| 55 | 3300025937 | Ga0207669_11616013 | Ga0207669_116160131 | 115 |
| 56 | 3300025944 | Ga0207661_10784483 | Ga0207661_107844832 | 115 |
| 57 | 3300026078 | Ga0207702_10311575 | Ga0207702_103115752 | 115 |
| 58 | 3300027111 | Ga0209281_1000002 | Ga0209281_10000021172 | 115 |
| 59 | 3300027312 | Ga0209371_1035912 | Ga0209371_10359122 | 115 |
| 60 | 3300030500 | Ga0268256_1039269 | Ga0268256_10392692 | 115 |
| 61 | 3300031548 | Ga0307408_100006837 | Ga0307408_1000068375 | 115 |
| 62 | 3300041443 | Ga0451789_0932306 | Ga0451789_0932306_13_375 | 115 |
| 63 | 3300042003 | Ga0439443_077257 | Ga0439443_077257_10_366 | 115 |
| 64 | 3300044694 | Ga0466963_0079390 | Ga0466963_0079390_1297_1653 | 115 |
| 65 | 3300048903 | Ga0496100_0075396 | Ga0496100_0075396_435_785 | 115 |
| 66 | 3300048904 | Ga0496101_0078660 | Ga0496101_0078660_1184_1534 | 115 |
| 67 | 3300048904 | Ga0496101_0559464 | Ga0496101_0559464_259_609 | 115 |
| 68 | 3300048905 | Ga0496102_0094836 | Ga0496102_0094836_2390_2740 | 115 |
| 69 | 3300048907 | Ga0496104_0001887 | Ga0496104_0001887_3544_3894 | 115 |
| 70 | 3300048907 | Ga0496104_1062746 | Ga0496104_1062746_197_547 | 115 |
| 71 | 3300048908 | Ga0496105_0002376 | Ga0496105_0002376_9909_10259 | 115 |
| 72 | 3300048910 | Ga0496107_0015816 | Ga0496107_0015816_4681_5031 | 115 |
| 73 | 3300048911 | Ga0496108_0264648 | Ga0496108_0264648_1090_1440 | 115 |
| 74 | 3300048912 | Ga0496109_0005848 | Ga0496109_0005848_9913_10263 | 115 |
| 75 | 3300048913 | Ga0496110_1616051 | Ga0496110_1616051_13_363 | 115 |
| 76 | 3300048914 | Ga0496111_0171105 | Ga0496111_0171105_101_451 | 115 |
| 77 | 3300048915 | Ga0496112_1621474 | Ga0496112_1621474_77_427 | 115 |
| 78 | 3300048916 | Ga0496113_0059618 | Ga0496113_0059618_766_1116 | 115 |
| 79 | 3300048917 | Ga0496114_0014834 | Ga0496114_0014834_538_888 | 115 |
| 80 | 3300048917 | Ga0496114_0038571 | Ga0496114_0038571_1050_1400 | 115 |
| 81 | 3300048918 | Ga0496115_0001975 | Ga0496115_0001975_8006_8356 | 115 |
| 82 | 3300050493 | nmdc:mga0k408_107346_c1 | nmdc:mga0k408_107346_c1_438_794 | 115 |
| 83 | 3300003320 | rootH2_10152404 | rootH2_101524042 | 116 |
| 84 | 3300005337 | Ga0070682_100816383 | Ga0070682_1008163831 | 116 |
| 85 | 3300005347 | Ga0070668_100003517 | Ga0070668_10000351713 | 116 |
| 86 | 3300005434 | Ga0070709_11623370 | Ga0070709_116233701 | 116 |
| 87 | 3300005435 | Ga0070714_100247963 | Ga0070714_1002479633 | 116 |
| 88 | 3300005441 | Ga0070700_100858005 | Ga0070700_1008580052 | 116 |
| 89 | 3300005445 | Ga0070708_100863480 | Ga0070708_1008634801 | 116 |
| 90 | 3300005455 | Ga0070663_100008796 | Ga0070663_1000087963 | 116 |
| 91 | 3300005518 | Ga0070699_100198668 | Ga0070699_1001986681 | 116 |
| 92 | 3300005535 | Ga0070684_100883907 | Ga0070684_1008839071 | 116 |
| 93 | 3300005617 | Ga0068859_101560674 | Ga0068859_1015606742 | 116 |
| 94 | 3300005618 | Ga0068864_101216395 | Ga0068864_1012163952 | 116 |
| 95 | 3300005842 | Ga0068858_100460553 | Ga0068858_1004605532 | 116 |
| 96 | 3300006177 | Ga0075362_10148759 | Ga0075362_101487592 | 116 |
| 97 | 3300006178 | Ga0075367_10038276 | Ga0075367_100382763 | 116 |
| 98 | 3300006178 | Ga0075367_11035035 | Ga0075367_110350351 | 116 |
| 99 | 3300006195 | Ga0075366_10001146 | Ga0075366_1000114610 | 116 |
| 100 | 3300006195 | Ga0075366_10003385 | Ga0075366_100033853 | 116 |
| 101 | 3300006195 | Ga0075366_10045891 | Ga0075366_100458913 | 116 |
| 102 | 3300006195 | Ga0075366_10067193 | Ga0075366_100671931 | 116 |
| 103 | 3300006195 | Ga0075366_10116191 | Ga0075366_101161912 | 116 |
| 104 | 3300006353 | Ga0075370_10003205 | Ga0075370_100032056 | 116 |
| 105 | 3300006353 | Ga0075370_10003763 | Ga0075370_100037633 | 116 |
| 106 | 3300006353 | Ga0075370_10167873 | Ga0075370_101678732 | 116 |
| 107 | 3300006353 | Ga0075370_10264816 | Ga0075370_102648162 | 116 |
| 108 | 3300006931 | Ga0097620_101560461 | Ga0097620_1015604612 | 116 |
| 109 | 3300009036 | Ga0105244_10000896 | Ga0105244_100008967 | 116 |
| 110 | 3300009148 | Ga0105243_10007505 | Ga0105243_1000750512 | 116 |
| 111 | 3300009551 | Ga0105238_10922791 | Ga0105238_109227912 | 116 |
| 112 | 3300025711 | Ga0207696_1000007 | Ga0207696_1000007252 | 116 |
| 113 | 3300025728 | Ga0207655_1008820 | Ga0207655_10088206 | 116 |
| 114 | 3300025735 | Ga0207713_1000005 | Ga0207713_1000005408 | 116 |
| 115 | 3300025911 | Ga0207654_10373264 | Ga0207654_103732642 | 116 |
| 116 | 3300025913 | Ga0207695_10151483 | Ga0207695_101514832 | 116 |
| 117 | 3300025914 | Ga0207671_10030967 | Ga0207671_100309673 | 116 |
| 118 | 3300025926 | Ga0207659_11546790 | Ga0207659_115467901 | 116 |
| 119 | 3300025927 | Ga0207687_10343426 | Ga0207687_103434262 | 116 |
| 120 | 3300025933 | Ga0207706_10031049 | Ga0207706_100310495 | 116 |
| 121 | 3300025935 | Ga0207709_10022625 | Ga0207709_100226253 | 116 |
| 122 | 3300025942 | Ga0207689_10116148 | Ga0207689_101161483 | 116 |
| 123 | 3300025961 | Ga0207712_10506088 | Ga0207712_105060882 | 116 |
| 124 | 3300025972 | Ga0207668_10015690 | Ga0207668_100156902 | 116 |
| 125 | 3300025981 | Ga0207640_10032008 | Ga0207640_100320082 | 116 |
| 126 | 3300026041 | Ga0207639_10424287 | Ga0207639_104242872 | 116 |
| 127 | 3300026067 | Ga0207678_10000065 | Ga0207678_1000006517 | 116 |
| 128 | 3300026067 | Ga0207678_10026390 | Ga0207678_100263902 | 116 |
| 129 | 3300026116 | Ga0207674_10007455 | Ga0207674_100074555 | 116 |
| 130 | 3300026142 | Ga0207698_10339387 | Ga0207698_103393873 | 116 |
| 131 | 3300027866 | Ga0209813_10007150 | Ga0209813_100071503 | 116 |
| 132 | 3300028381 | Ga0268264_10557710 | Ga0268264_105577101 | 116 |
| 133 | 3300028381 | Ga0268264_10653335 | Ga0268264_106533352 | 116 |
| 134 | 3300028786 | Ga0307517_10216900 | Ga0307517_102169002 | 116 |
| 135 | 3300028794 | Ga0307515_10252738 | Ga0307515_102527385 | 116 |
| 136 | 3300028794 | Ga0307515_10451187 | Ga0307515_104511873 | 116 |
| 137 | 3300030522 | Ga0307512_10144826 | Ga0307512_101448263 | 116 |
| 138 | 3300031238 | Ga0265332_10261700 | Ga0265332_102617001 | 116 |
| 139 | 3300031240 | Ga0265320_10190493 | Ga0265320_101904932 | 116 |
| 140 | 3300031250 | Ga0265331_10381812 | Ga0265331_103818121 | 116 |
| 141 | 3300031456 | Ga0307513_10292611 | Ga0307513_102926114 | 116 |
| 142 | 3300031711 | Ga0265314_10059610 | Ga0265314_100596103 | 116 |
| 143 | 3300031730 | Ga0307516_10058976 | Ga0307516_100589763 | 116 |
| 144 | 3300031824 | Ga0307413_10920233 | Ga0307413_109202332 | 116 |
| 145 | 3300031911 | Ga0307412_10866867 | Ga0307412_108668672 | 116 |
| 146 | 3300032126 | Ga0307415_101955992 | Ga0307415_1019559922 | 116 |
| 147 | 3300033180 | Ga0307510_10311995 | Ga0307510_103119952 | 116 |
| 148 | 3300041507 | Ga0451851_1006281 | Ga0451851_1006281_166_519 | 116 |
| 149 | 3300044658 | Ga0466972_0020128 | Ga0466972_0020128_1924_2277 | 116 |
| 150 | 3300044683 | Ga0466965_0008990 | Ga0466965_0008990_1171_1524 | 116 |
| 151 | 3300044735 | Ga0466968_0159202 | Ga0466968_0159202_659_1012 | 116 |
| 152 | 3300044765 | Ga0466970_0014874 | Ga0466970_0014874_2314_2667 | 116 |
| 153 | 3300044901 | Ga0466960_0164751 | Ga0466960_0164751_183_536 | 116 |
| 154 | 3300045976 | Ga0466967_1159217 | Ga0466967_1159217_375_728 | 116 |
| 155 | 3300045976 | Ga0466967_1262764 | Ga0466967_1262764_199_552 | 116 |
| 156 | 3300046506 | Ga0495583_0380660 | Ga0495583_0380660_63_413 | 116 |
| 157 | 3300046512 | Ga0495610_0058391 | Ga0495610_0058391_240_590 | 116 |
| 158 | 3300046515 | Ga0495620_0112293 | Ga0495620_0112293_653_1003 | 116 |
| 159 | 3300046518 | Ga0495631_0347539 | Ga0495631_0347539_246_596 | 116 |
| 160 | 3300046519 | Ga0495632_0017593 | Ga0495632_0017593_382_732 | 116 |
| 161 | 3300046524 | Ga0495648_0288851 | Ga0495648_0288851_193_543 | 116 |
| 162 | 3300046542 | Ga0495597_0017307 | Ga0495597_0017307_664_1014 | 116 |
| 163 | 3300046616 | Ga0495668_0163659 | Ga0495668_0163659_355_708 | 116 |
| 164 | 3300046648 | Ga0495611_0310144 | Ga0495611_0310144_98_448 | 116 |
| 165 | 3300046660 | Ga0495625_0009183 | Ga0495625_0009183_467_832 | 116 |
| 166 | 3300046660 | Ga0495625_0027785 | Ga0495625_0027785_2413_2763 | 116 |
| 167 | 3300046660 | Ga0495625_0281425 | Ga0495625_0281425_408_758 | 116 |
| 168 | 3300046660 | Ga0495625_0410764 | Ga0495625_0410764_287_637 | 116 |
| 169 | 3300046694 | Ga0495649_0005203 | Ga0495649_0005203_1678_2028 | 116 |
| 170 | 3300046810 | Ga0495660_0101314 | Ga0495660_0101314_276_626 | 116 |
| 171 | 3300047443 | Ga0495687_008233 | Ga0495687_008233_2445_2795 | 116 |
| 172 | 3300047446 | Ga0495679_186335 | Ga0495679_186335_108_458 | 116 |
| 173 | 3300048091 | Ga0495626_0324554 | Ga0495626_0324554_181_531 | 116 |
| 174 | 3300048927 | Ga0496124_0049007 | Ga0496124_0049007_2914_3264 | 116 |
| 175 | 3300048928 | Ga0496125_0193065 | Ga0496125_0193065_277_627 | 116 |
| 176 | 3300048929 | Ga0496126_0539193 | Ga0496126_0539193_515_865 | 116 |
| 177 | 3300049460 | Ga0495682_0369280 | Ga0495682_0369280_51_401 | 116 |
| 178 | 3300050489 | nmdc:mga03683_138719_c1 | nmdc:mga03683_138719_c1_232_582 | 116 |
| 179 | 3300050489 | nmdc:mga03683_29051_c1 | nmdc:mga03683_29051_c1_882_1235 | 116 |
| 180 | 3300050490 | nmdc:mga03n38_32164_c1 | nmdc:mga03n38_32164_c1_679_1032 | 116 |
| 181 | 3300050491 | nmdc:mga00v17_24167_c1 | nmdc:mga00v17_24167_c1_385_738 | 116 |
| 182 | 3300050493 | nmdc:mga0k408_11186_c1 | nmdc:mga0k408_11186_c1_1201_1554 | 116 |
| 183 | 3300050493 | nmdc:mga0k408_117052_c1 | nmdc:mga0k408_117052_c1_91_441 | 116 |
| 184 | 3300050493 | nmdc:mga0k408_1659_c1 | nmdc:mga0k408_1659_c1_4979_5329 | 116 |
| 185 | 3300050493 | nmdc:mga0k408_3382_c1 | nmdc:mga0k408_3382_c1_4815_5165 | 116 |
| 186 | 3300050493 | nmdc:mga0k408_45009_c1 | nmdc:mga0k408_45009_c1_165_515 | 116 |
| 187 | 3300050493 | nmdc:mga0k408_664_c1 | nmdc:mga0k408_664_c1_7417_7767 | 116 |
| 188 | 3300050494 | nmdc:mga06z11_17968_c1 | nmdc:mga06z11_17968_c1_1669_2022 | 116 |
| 189 | 3300050494 | nmdc:mga06z11_71468_c1 | nmdc:mga06z11_71468_c1_44_394 | 116 |
| 190 | 3300050494 | nmdc:mga06z11_74325_c1 | nmdc:mga06z11_74325_c1_212_565 | 116 |
| 191 | 3300050495 | nmdc:mga04h51_24540_c1 | nmdc:mga04h51_24540_c1_474_827 | 116 |
| 192 | 3300050496 | nmdc:mga07m45_129_c1 | nmdc:mga07m45_129_c1_16588_16938 | 116 |
| 193 | 3300050496 | nmdc:mga07m45_1421_c1 | nmdc:mga07m45_1421_c1_9382_9735 | 116 |
| 194 | 3300050496 | nmdc:mga07m45_2714_c1 | nmdc:mga07m45_2714_c1_3857_4207 | 116 |
| 195 | 3300050496 | nmdc:mga07m45_402765_c1 | nmdc:mga07m45_402765_c1_160_510 | 116 |
| 196 | 3300050516 | nmdc:mga0sz30_24403_c1 | nmdc:mga0sz30_24403_c1_321_674 | 116 |
| 197 | 3300050516 | nmdc:mga0sz30_324238_c1 | nmdc:mga0sz30_324238_c1_88_441 | 116 |
| 198 | 3300053086 | Ga0500578_0199557 | Ga0500578_0199557_319_669 | 116 |
| 199 | 3300053134 | Ga0500658_0036781 | Ga0500658_0036781_929_1279 | 116 |
| 200 | 3300053153 | Ga0500616_0014641 | Ga0500616_0014641_4051_4401 | 116 |
| 201 | 3300003323 | rootH1_10075537 | rootH1_100755375 | 117 |
| 202 | 3300003775 | Ga0055524_1018850 | Ga0055524_10188502 | 117 |
| 203 | 3300003794 | Ga0055531_10000958 | Ga0055531_1000095822 | 117 |
| 204 | 3300004625 | Ga0055543_1008989 | Ga0055543_10089891 | 117 |
| 205 | 3300005262 | Ga0065165_1000573 | Ga0065165_100057328 | 117 |
| 206 | 3300005530 | Ga0070679_100218284 | Ga0070679_1002182841 | 117 |
| 207 | 3300006177 | Ga0075362_10037852 | Ga0075362_100378521 | 117 |
| 208 | 3300006195 | Ga0075366_10205092 | Ga0075366_102050922 | 117 |
| 209 | 3300006944 | Ga0099823_1000025 | Ga0099823_100002516 | 117 |
| 210 | 3300013104 | Ga0157370_10000842 | Ga0157370_1000084222 | 117 |
| 211 | 3300017792 | Ga0163161_10004424 | Ga0163161_100044244 | 117 |
| 212 | 3300025273 | Ga0209673_1002109 | Ga0209673_10021095 | 117 |
| 213 | 3300025273 | Ga0209673_1054321 | Ga0209673_10543211 | 117 |
| 214 | 3300025298 | Ga0209050_1001224 | Ga0209050_100122421 | 117 |
| 215 | 3300025299 | Ga0209256_1001174 | Ga0209256_100117421 | 117 |
| 216 | 3300025303 | Ga0209051_1001334 | Ga0209051_100133417 | 117 |
| 217 | 3300025304 | Ga0209257_1001286 | Ga0209257_10012868 | 117 |
| 218 | 3300025921 | Ga0207652_11230702 | Ga0207652_112307022 | 117 |
| 219 | 3300027296 | Ga0209389_1000270 | Ga0209389_100027015 | 117 |
| 220 | 3300027876 | Ga0209974_10005259 | Ga0209974_100052594 | 117 |
| 221 | 3300028794 | Ga0307515_10000902 | Ga0307515_1000090244 | 117 |
| 222 | 3300028794 | Ga0307515_10000991 | Ga0307515_1000099115 | 117 |
| 223 | 3300028794 | Ga0307515_10002510 | Ga0307515_100025108 | 117 |
| 224 | 3300030522 | Ga0307512_10268601 | Ga0307512_102686011 | 117 |
| 225 | 3300031456 | Ga0307513_10038536 | Ga0307513_100385366 | 117 |
| 226 | 3300031507 | Ga0307509_10046944 | Ga0307509_100469443 | 117 |
| 227 | 3300031616 | Ga0307508_10000007 | Ga0307508_1000000783 | 117 |
| 228 | 3300031649 | Ga0307514_10013727 | Ga0307514_100137279 | 117 |
| 229 | 3300031911 | Ga0307412_11104813 | Ga0307412_111048132 | 117 |
| 230 | 3300041452 | Ga0451793_1638594 | Ga0451793_1638594_325_693 | 117 |
| 231 | 3300041503 | Ga0451847_0692594 | Ga0451847_0692594_46_414 | 117 |
| 232 | 3300041509 | Ga0451843_0212037 | Ga0451843_0212037_175_543 | 117 |
| 233 | 3300044694 | Ga0466963_0012111 | Ga0466963_0012111_226_591 | 117 |
| 234 | 3300046507 | Ga0495606_0264711 | Ga0495606_0264711_333_695 | 117 |
| 235 | 3300046519 | Ga0495632_0049803 | Ga0495632_0049803_342_710 | 117 |
| 236 | 3300046522 | Ga0495643_0017292 | Ga0495643_0017292_270_638 | 117 |
| 237 | 3300046683 | Ga0495658_0550215 | Ga0495658_0550215_68_436 | 117 |
| 238 | 3300046694 | Ga0495649_0194833 | Ga0495649_0194833_47_415 | 117 |
| 239 | 3300047472 | Ga0495686_0078919 | Ga0495686_0078919_1341_1709 | 117 |
| 240 | 3300048927 | Ga0496124_0179432 | Ga0496124_0179432_336_713 | 117 |
| 241 | 3300050495 | nmdc:mga04h51_541711_c1 | nmdc:mga04h51_541711_c1_79_447 | 117 |
| 242 | 3300053096 | Ga0500641_0000047 | Ga0500641_0000047_269_631 | 117 |
| 243 | 3300053134 | Ga0500658_0056084 | Ga0500658_0056084_298_666 | 117 |
| 244 | 3300053140 | Ga0500573_0298365 | Ga0500573_0298365_349_711 | 117 |
| 245 | 3300053157 | Ga0500624_007660 | Ga0500624_007660_229_591 | 117 |
| 246 | 3300053161 | Ga0500634_0000026 | Ga0500634_0000026_63152_63514 | 117 |
| 247 | 3300053161 | Ga0500634_0161946 | Ga0500634_0161946_467_829 | 117 |
| 248 | 3300053739 | Ga0500587_007940 | Ga0500587_007940_611_979 | 117 |
| 249 | 3300001977 | JGI24746J21847_1010978 | JGI24746J21847_10109782 | 118 |
| 250 | 3300002074 | JGI24748J21848_1010592 | JGI24748J21848_10105922 | 118 |
| 251 | 3300002075 | JGI24738J21930_10034570 | JGI24738J21930_100345702 | 118 |
| 252 | 3300002076 | JGI24749J21850_1001786 | JGI24749J21850_10017862 | 118 |
| 253 | 3300002239 | JGI24034J26672_10010265 | JGI24034J26672_100102652 | 118 |
| 254 | 3300003771 | Ga0055526_1013231 | Ga0055526_10132312 | 118 |
| 255 | 3300005327 | Ga0070658_10346077 | Ga0070658_103460771 | 118 |
| 256 | 3300005328 | Ga0070676_10150692 | Ga0070676_101506921 | 118 |
| 257 | 3300005329 | Ga0070683_100086296 | Ga0070683_1000862964 | 118 |
| 258 | 3300005329 | Ga0070683_100100825 | Ga0070683_1001008255 | 118 |
| 259 | 3300005330 | Ga0070690_100045076 | Ga0070690_1000450763 | 118 |
| 260 | 3300005331 | Ga0070670_100027381 | Ga0070670_1000273815 | 118 |
| 261 | 3300005331 | Ga0070670_100032959 | Ga0070670_1000329592 | 118 |
| 262 | 3300005331 | Ga0070670_100301775 | Ga0070670_1003017752 | 118 |
| 263 | 3300005333 | Ga0070677_10071518 | Ga0070677_100715183 | 118 |
| 264 | 3300005334 | Ga0068869_100031397 | Ga0068869_1000313976 | 118 |
| 265 | 3300005334 | Ga0068869_100269514 | Ga0068869_1002695141 | 118 |
| 266 | 3300005335 | Ga0070666_10845855 | Ga0070666_108458551 | 118 |
| 267 | 3300005335 | Ga0070666_10914309 | Ga0070666_109143091 | 118 |
| 268 | 3300005338 | Ga0068868_100129455 | Ga0068868_1001294553 | 118 |
| 269 | 3300005339 | Ga0070660_100455012 | Ga0070660_1004550122 | 118 |
| 270 | 3300005340 | Ga0070689_100134960 | Ga0070689_1001349602 | 118 |
| 271 | 3300005341 | Ga0070691_10143131 | Ga0070691_101431312 | 118 |
| 272 | 3300005343 | Ga0070687_100099164 | Ga0070687_1000991642 | 118 |
| 273 | 3300005344 | Ga0070661_100007619 | Ga0070661_10000761912 | 118 |
| 274 | 3300005344 | Ga0070661_100290433 | Ga0070661_1002904331 | 118 |
| 275 | 3300005344 | Ga0070661_101914343 | Ga0070661_1019143431 | 118 |
| 276 | 3300005345 | Ga0070692_10044241 | Ga0070692_100442412 | 118 |
| 277 | 3300005347 | Ga0070668_100553594 | Ga0070668_1005535942 | 118 |
| 278 | 3300005347 | Ga0070668_101522662 | Ga0070668_1015226622 | 118 |
| 279 | 3300005353 | Ga0070669_101906289 | Ga0070669_1019062891 | 118 |
| 280 | 3300005354 | Ga0070675_100068617 | Ga0070675_1000686175 | 118 |
| 281 | 3300005355 | Ga0070671_100046910 | Ga0070671_1000469104 | 118 |
| 282 | 3300005355 | Ga0070671_100168620 | Ga0070671_1001686204 | 118 |
| 283 | 3300005355 | Ga0070671_100425800 | Ga0070671_1004258002 | 118 |
| 284 | 3300005356 | Ga0070674_100052301 | Ga0070674_1000523014 | 118 |
| 285 | 3300005364 | Ga0070673_100609687 | Ga0070673_1006096872 | 118 |
| 286 | 3300005365 | Ga0070688_100001847 | Ga0070688_1000018474 | 118 |
| 287 | 3300005366 | Ga0070659_100089046 | Ga0070659_1000890463 | 118 |
| 288 | 3300005366 | Ga0070659_100593657 | Ga0070659_1005936572 | 118 |
| 289 | 3300005367 | Ga0070667_100054239 | Ga0070667_1000542393 | 118 |
| 290 | 3300005367 | Ga0070667_100643711 | Ga0070667_1006437112 | 118 |
| 291 | 3300005434 | Ga0070709_10635278 | Ga0070709_106352782 | 118 |
| 292 | 3300005437 | Ga0070710_11425876 | Ga0070710_114258761 | 118 |
| 293 | 3300005438 | Ga0070701_10071520 | Ga0070701_100715203 | 118 |
| 294 | 3300005439 | Ga0070711_100244391 | Ga0070711_1002443911 | 118 |
| 295 | 3300005441 | Ga0070700_100283320 | Ga0070700_1002833202 | 118 |
| 296 | 3300005444 | Ga0070694_100604743 | Ga0070694_1006047432 | 118 |
| 297 | 3300005455 | Ga0070663_100087107 | Ga0070663_1000871073 | 118 |
| 298 | 3300005455 | Ga0070663_100443366 | Ga0070663_1004433661 | 118 |
| 299 | 3300005456 | Ga0070678_100112375 | Ga0070678_1001123753 | 118 |
| 300 | 3300005456 | Ga0070678_101582632 | Ga0070678_1015826322 | 118 |
| 301 | 3300005457 | Ga0070662_100200398 | Ga0070662_1002003983 | 118 |
| 302 | 3300005459 | Ga0068867_100134381 | Ga0068867_1001343812 | 118 |
| 303 | 3300005466 | Ga0070685_10003125 | Ga0070685_1000312513 | 118 |
| 304 | 3300005466 | Ga0070685_10006870 | Ga0070685_100068702 | 118 |
| 305 | 3300005530 | Ga0070679_100135392 | Ga0070679_1001353923 | 118 |
| 306 | 3300005535 | Ga0070684_101204764 | Ga0070684_1012047642 | 118 |
| 307 | 3300005539 | Ga0068853_100054698 | Ga0068853_1000546985 | 118 |
| 308 | 3300005544 | Ga0070686_100092923 | Ga0070686_1000929232 | 118 |
| 309 | 3300005547 | Ga0070693_100091145 | Ga0070693_1000911452 | 118 |
| 310 | 3300005547 | Ga0070693_100110652 | Ga0070693_1001106522 | 118 |
| 311 | 3300005548 | Ga0070665_100000185 | Ga0070665_10000018558 | 118 |
| 312 | 3300005548 | Ga0070665_100083469 | Ga0070665_1000834692 | 118 |
| 313 | 3300005548 | Ga0070665_100085358 | Ga0070665_1000853582 | 118 |
| 314 | 3300005563 | Ga0068855_100082310 | Ga0068855_1000823107 | 118 |
| 315 | 3300005564 | Ga0070664_100069516 | Ga0070664_1000695163 | 118 |
| 316 | 3300005564 | Ga0070664_100216956 | Ga0070664_1002169562 | 118 |
| 317 | 3300005564 | Ga0070664_101279563 | Ga0070664_1012795632 | 118 |
| 318 | 3300005577 | Ga0068857_100004957 | Ga0068857_10000495711 | 118 |
| 319 | 3300005577 | Ga0068857_100065716 | Ga0068857_1000657166 | 118 |
| 320 | 3300005578 | Ga0068854_100043113 | Ga0068854_1000431132 | 118 |
| 321 | 3300005614 | Ga0068856_100192043 | Ga0068856_1001920433 | 118 |
| 322 | 3300005614 | Ga0068856_100893748 | Ga0068856_1008937482 | 118 |
| 323 | 3300005615 | Ga0070702_100024578 | Ga0070702_1000245785 | 118 |
| 324 | 3300005615 | Ga0070702_101370961 | Ga0070702_1013709612 | 118 |
| 325 | 3300005616 | Ga0068852_100008993 | Ga0068852_1000089933 | 118 |
| 326 | 3300005616 | Ga0068852_100016822 | Ga0068852_1000168226 | 118 |
| 327 | 3300005616 | Ga0068852_100381703 | Ga0068852_1003817032 | 118 |
| 328 | 3300005617 | Ga0068859_100081731 | Ga0068859_1000817314 | 118 |
| 329 | 3300005618 | Ga0068864_100025205 | Ga0068864_1000252056 | 118 |
| 330 | 3300005618 | Ga0068864_100510315 | Ga0068864_1005103151 | 118 |
| 331 | 3300005618 | Ga0068864_101087964 | Ga0068864_1010879641 | 118 |
| 332 | 3300005718 | Ga0068866_10058862 | Ga0068866_100588623 | 118 |
| 333 | 3300005719 | Ga0068861_100021803 | Ga0068861_1000218036 | 118 |
| 334 | 3300005834 | Ga0068851_10019001 | Ga0068851_100190014 | 118 |
| 335 | 3300005834 | Ga0068851_10051127 | Ga0068851_100511272 | 118 |
| 336 | 3300005834 | Ga0068851_10293941 | Ga0068851_102939411 | 118 |
| 337 | 3300005840 | Ga0068870_10007140 | Ga0068870_100071403 | 118 |
| 338 | 3300005840 | Ga0068870_11083131 | Ga0068870_110831311 | 118 |
| 339 | 3300005841 | Ga0068863_100121499 | Ga0068863_1001214992 | 118 |
| 340 | 3300005841 | Ga0068863_100124753 | Ga0068863_1001247534 | 118 |
| 341 | 3300005841 | Ga0068863_100813829 | Ga0068863_1008138292 | 118 |
| 342 | 3300005841 | Ga0068863_101177970 | Ga0068863_1011779702 | 118 |
| 343 | 3300005842 | Ga0068858_100129152 | Ga0068858_1001291525 | 118 |
| 344 | 3300005843 | Ga0068860_100212145 | Ga0068860_1002121453 | 118 |
| 345 | 3300005844 | Ga0068862_100333357 | Ga0068862_1003333573 | 118 |
| 346 | 3300005844 | Ga0068862_102037511 | Ga0068862_1020375111 | 118 |
| 347 | 3300006048 | Ga0075363_100558785 | Ga0075363_1005587851 | 118 |
| 348 | 3300006051 | Ga0075364_10557595 | Ga0075364_105575952 | 118 |
| 349 | 3300006175 | Ga0070712_100296678 | Ga0070712_1002966783 | 118 |
| 350 | 3300006175 | Ga0070712_101725381 | Ga0070712_1017253812 | 118 |
| 351 | 3300006237 | Ga0097621_100165768 | Ga0097621_1001657684 | 118 |
| 352 | 3300006237 | Ga0097621_100176445 | Ga0097621_1001764454 | 118 |
| 353 | 3300006237 | Ga0097621_101517208 | Ga0097621_1015172082 | 118 |
| 354 | 3300006358 | Ga0068871_100096947 | Ga0068871_1000969474 | 118 |
| 355 | 3300006358 | Ga0068871_100280028 | Ga0068871_1002800282 | 118 |
| 356 | 3300006881 | Ga0068865_100025774 | Ga0068865_1000257746 | 118 |
| 357 | 3300006931 | Ga0097620_100081731 | Ga0097620_1000817314 | 118 |
| 358 | 3300007265 | Ga0099794_10641017 | Ga0099794_106410171 | 118 |
| 359 | 3300009093 | Ga0105240_10371002 | Ga0105240_103710022 | 118 |
| 360 | 3300009094 | Ga0111539_10212294 | Ga0111539_102122943 | 118 |
| 361 | 3300009148 | Ga0105243_12442717 | Ga0105243_124427171 | 118 |
| 362 | 3300009176 | Ga0105242_10062751 | Ga0105242_100627514 | 118 |
| 363 | 3300009177 | Ga0105248_10014429 | Ga0105248_100144297 | 118 |
| 364 | 3300009177 | Ga0105248_10419855 | Ga0105248_104198552 | 118 |
| 365 | 3300009177 | Ga0105248_10907050 | Ga0105248_109070503 | 118 |
| 366 | 3300009545 | Ga0105237_10404189 | Ga0105237_104041893 | 118 |
| 367 | 3300009551 | Ga0105238_10521372 | Ga0105238_105213722 | 118 |
| 368 | 3300009553 | Ga0105249_10154928 | Ga0105249_101549283 | 118 |
| 369 | 3300011119 | Ga0105246_10233068 | Ga0105246_102330683 | 118 |
| 370 | 3300012503 | Ga0157313_1017553 | Ga0157313_10175532 | 118 |
| 371 | 3300013100 | Ga0157373_10416051 | Ga0157373_104160512 | 118 |
| 372 | 3300013102 | Ga0157371_10290684 | Ga0157371_102906842 | 118 |
| 373 | 3300013102 | Ga0157371_11666170 | Ga0157371_116661702 | 118 |
| 374 | 3300013104 | Ga0157370_10059286 | Ga0157370_100592865 | 118 |
| 375 | 3300013104 | Ga0157370_10211622 | Ga0157370_102116223 | 118 |
| 376 | 3300013105 | Ga0157369_10031755 | Ga0157369_100317554 | 118 |
| 377 | 3300013296 | Ga0157374_10010308 | Ga0157374_100103086 | 118 |
| 378 | 3300013296 | Ga0157374_10039321 | Ga0157374_100393215 | 118 |
| 379 | 3300013296 | Ga0157374_11152236 | Ga0157374_111522361 | 118 |
| 380 | 3300013297 | Ga0157378_10361261 | Ga0157378_103612612 | 118 |
| 381 | 3300013306 | Ga0163162_10369721 | Ga0163162_103697212 | 118 |
| 382 | 3300013307 | Ga0157372_10347452 | Ga0157372_103474522 | 118 |
| 383 | 3300013307 | Ga0157372_11114536 | Ga0157372_111145362 | 118 |
| 384 | 3300013308 | Ga0157375_10418744 | Ga0157375_104187442 | 118 |
| 385 | 3300014326 | Ga0157380_10221869 | Ga0157380_102218692 | 118 |
| 386 | 3300014745 | Ga0157377_10001430 | Ga0157377_100014302 | 118 |
| 387 | 3300014969 | Ga0157376_10051813 | Ga0157376_100518133 | 118 |
| 388 | 3300014969 | Ga0157376_10186912 | Ga0157376_101869124 | 118 |
| 389 | 3300014969 | Ga0157376_11202233 | Ga0157376_112022332 | 118 |
| 390 | 3300014969 | Ga0157376_12048957 | Ga0157376_120489571 | 118 |
| 391 | 3300017792 | Ga0163161_10162912 | Ga0163161_101629123 | 118 |
| 392 | 3300021384 | Ga0213876_10234259 | Ga0213876_102342592 | 118 |
| 393 | 3300025245 | Ga0207425_1040973 | Ga0207425_10409732 | 118 |
| 394 | 3300025273 | Ga0209673_1059677 | Ga0209673_10596772 | 118 |
| 395 | 3300025295 | Ga0209564_1000120 | Ga0209564_100012091 | 118 |
| 396 | 3300025315 | Ga0207697_10006661 | Ga0207697_100066619 | 118 |
| 397 | 3300025321 | Ga0207656_10007540 | Ga0207656_100075404 | 118 |
| 398 | 3300025321 | Ga0207656_10219678 | Ga0207656_102196782 | 118 |
| 399 | 3300025893 | Ga0207682_10001376 | Ga0207682_100013768 | 118 |
| 400 | 3300025901 | Ga0207688_10007810 | Ga0207688_100078103 | 118 |
| 401 | 3300025903 | Ga0207680_10038458 | Ga0207680_100384582 | 118 |
| 402 | 3300025903 | Ga0207680_10340481 | Ga0207680_103404811 | 118 |
| 403 | 3300025903 | Ga0207680_10561771 | Ga0207680_105617712 | 118 |
| 404 | 3300025904 | Ga0207647_10112692 | Ga0207647_101126922 | 118 |
| 405 | 3300025906 | Ga0207699_10840419 | Ga0207699_108404191 | 118 |
| 406 | 3300025907 | Ga0207645_10003236 | Ga0207645_100032362 | 118 |
| 407 | 3300025908 | Ga0207643_10001910 | Ga0207643_100019108 | 118 |
| 408 | 3300025908 | Ga0207643_10852894 | Ga0207643_108528942 | 118 |
| 409 | 3300025909 | Ga0207705_10120631 | Ga0207705_101206313 | 118 |
| 410 | 3300025909 | Ga0207705_10138843 | Ga0207705_101388433 | 118 |
| 411 | 3300025914 | Ga0207671_10799290 | Ga0207671_107992902 | 118 |
| 412 | 3300025915 | Ga0207693_10135152 | Ga0207693_101351523 | 118 |
| 413 | 3300025918 | Ga0207662_10014972 | Ga0207662_100149722 | 118 |
| 414 | 3300025919 | Ga0207657_10193463 | Ga0207657_101934634 | 118 |
| 415 | 3300025920 | Ga0207649_10257545 | Ga0207649_102575451 | 118 |
| 416 | 3300025920 | Ga0207649_10869746 | Ga0207649_108697461 | 118 |
| 417 | 3300025921 | Ga0207652_10517069 | Ga0207652_105170692 | 118 |
| 418 | 3300025923 | Ga0207681_10123337 | Ga0207681_101233372 | 118 |
| 419 | 3300025925 | Ga0207650_10008159 | Ga0207650_100081595 | 118 |
| 420 | 3300025925 | Ga0207650_10116218 | Ga0207650_101162183 | 118 |
| 421 | 3300025925 | Ga0207650_10531789 | Ga0207650_105317892 | 118 |
| 422 | 3300025926 | Ga0207659_10001220 | Ga0207659_1000122016 | 118 |
| 423 | 3300025926 | Ga0207659_10005473 | Ga0207659_1000547312 | 118 |
| 424 | 3300025931 | Ga0207644_10037965 | Ga0207644_100379655 | 118 |
| 425 | 3300025931 | Ga0207644_10049641 | Ga0207644_100496412 | 118 |
| 426 | 3300025931 | Ga0207644_10050405 | Ga0207644_100504055 | 118 |
| 427 | 3300025931 | Ga0207644_10173371 | Ga0207644_101733713 | 118 |
| 428 | 3300025932 | Ga0207690_10031466 | Ga0207690_100314664 | 118 |
| 429 | 3300025932 | Ga0207690_10561258 | Ga0207690_105612582 | 118 |
| 430 | 3300025933 | Ga0207706_10000618 | Ga0207706_100006183 | 118 |
| 431 | 3300025934 | Ga0207686_10345198 | Ga0207686_103451982 | 118 |
| 432 | 3300025935 | Ga0207709_10459706 | Ga0207709_104597062 | 118 |
| 433 | 3300025935 | Ga0207709_10489577 | Ga0207709_104895772 | 118 |
| 434 | 3300025936 | Ga0207670_10051612 | Ga0207670_100516125 | 118 |
| 435 | 3300025937 | Ga0207669_11084325 | Ga0207669_110843252 | 118 |
| 436 | 3300025938 | Ga0207704_10018091 | Ga0207704_100180915 | 118 |
| 437 | 3300025940 | Ga0207691_10012341 | Ga0207691_100123412 | 118 |
| 438 | 3300025941 | Ga0207711_10162677 | Ga0207711_101626772 | 118 |
| 439 | 3300025941 | Ga0207711_10288479 | Ga0207711_102884793 | 118 |
| 440 | 3300025941 | Ga0207711_10797178 | Ga0207711_107971781 | 118 |
| 441 | 3300025942 | Ga0207689_10007213 | Ga0207689_100072132 | 118 |
| 442 | 3300025944 | Ga0207661_10080742 | Ga0207661_100807423 | 118 |
| 443 | 3300025944 | Ga0207661_10197322 | Ga0207661_101973223 | 118 |
| 444 | 3300025945 | Ga0207679_10044426 | Ga0207679_100444263 | 118 |
| 445 | 3300025945 | Ga0207679_10164904 | Ga0207679_101649043 | 118 |
| 446 | 3300025949 | Ga0207667_10288080 | Ga0207667_102880803 | 118 |
| 447 | 3300025960 | Ga0207651_10197114 | Ga0207651_101971143 | 118 |
| 448 | 3300025961 | Ga0207712_10347097 | Ga0207712_103470972 | 118 |
| 449 | 3300025972 | Ga0207668_10612239 | Ga0207668_106122391 | 118 |
| 450 | 3300025981 | Ga0207640_10085070 | Ga0207640_100850704 | 118 |
| 451 | 3300025981 | Ga0207640_10678259 | Ga0207640_106782592 | 118 |
| 452 | 3300025986 | Ga0207658_10020837 | Ga0207658_100208372 | 118 |
| 453 | 3300025986 | Ga0207658_10233934 | Ga0207658_102339342 | 118 |
| 454 | 3300026023 | Ga0207677_10202082 | Ga0207677_102020823 | 118 |
| 455 | 3300026023 | Ga0207677_10725639 | Ga0207677_107256392 | 118 |
| 456 | 3300026035 | Ga0207703_10031740 | Ga0207703_100317404 | 118 |
| 457 | 3300026041 | Ga0207639_10104968 | Ga0207639_101049683 | 118 |
| 458 | 3300026041 | Ga0207639_10839612 | Ga0207639_108396121 | 118 |
| 459 | 3300026067 | Ga0207678_10011862 | Ga0207678_1001186213 | 118 |
| 460 | 3300026067 | Ga0207678_10113310 | Ga0207678_101133103 | 118 |
| 461 | 3300026075 | Ga0207708_10000557 | Ga0207708_1000055730 | 118 |
| 462 | 3300026078 | Ga0207702_10277726 | Ga0207702_102777263 | 118 |
| 463 | 3300026078 | Ga0207702_10422415 | Ga0207702_104224152 | 118 |
| 464 | 3300026088 | Ga0207641_10165438 | Ga0207641_101654382 | 118 |
| 465 | 3300026088 | Ga0207641_10252186 | Ga0207641_102521863 | 118 |
| 466 | 3300026088 | Ga0207641_12078075 | Ga0207641_120780751 | 118 |
| 467 | 3300026089 | Ga0207648_10003179 | Ga0207648_1000317919 | 118 |
| 468 | 3300026095 | Ga0207676_10065114 | Ga0207676_100651145 | 118 |
| 469 | 3300026095 | Ga0207676_10345989 | Ga0207676_103459891 | 118 |
| 470 | 3300026095 | Ga0207676_10627051 | Ga0207676_106270512 | 118 |
| 471 | 3300026116 | Ga0207674_10010468 | Ga0207674_1001046819 | 118 |
| 472 | 3300026116 | Ga0207674_10334899 | Ga0207674_103348992 | 118 |
| 473 | 3300026118 | Ga0207675_100005768 | Ga0207675_1000057683 | 118 |
| 474 | 3300026121 | Ga0207683_10058664 | Ga0207683_100586646 | 118 |
| 475 | 3300026121 | Ga0207683_10606046 | Ga0207683_106060461 | 118 |
| 476 | 3300026121 | Ga0207683_11869083 | Ga0207683_118690831 | 118 |
| 477 | 3300026142 | Ga0207698_10011417 | Ga0207698_100114176 | 118 |
| 478 | 3300026142 | Ga0207698_10166275 | Ga0207698_101662752 | 118 |
| 479 | 3300027543 | Ga0209999_1018696 | Ga0209999_10186962 | 118 |
| 480 | 3300027614 | Ga0209970_1001043 | Ga0209970_10010435 | 118 |
| 481 | 3300027907 | Ga0207428_10319444 | Ga0207428_103194441 | 118 |
| 482 | 3300028379 | Ga0268266_10000345 | Ga0268266_1000034534 | 118 |
| 483 | 3300028379 | Ga0268266_10043019 | Ga0268266_100430195 | 118 |
| 484 | 3300028379 | Ga0268266_11298286 | Ga0268266_112982862 | 118 |
| 485 | 3300028380 | Ga0268265_10445915 | Ga0268265_104459152 | 118 |
| 486 | 3300031852 | Ga0307410_12034813 | Ga0307410_120348131 | 118 |
| 487 | 3300035091 | Ga0373951_0039404 | Ga0373951_0039404_459_815 | 118 |
| 488 | 3300035171 | Ga0373946_0224007 | Ga0373946_0224007_140_496 | 118 |
| 489 | 3300035725 | Ga0373947_0061538 | Ga0373947_0061538_1644_2000 | 118 |
| 490 | 3300035725 | Ga0373947_0336982 | Ga0373947_0336982_136_498 | 118 |
| 491 | 3300037471 | Ga0395905_0385739 | Ga0395905_0385739_541_903 | 118 |
| 492 | 3300039437 | Ga0436365_0149550 | Ga0436365_0149550_97_459 | 118 |
| 493 | 3300041491 | Ga0451833_0526556 | Ga0451833_0526556_41_397 | 118 |
| 494 | 3300041496 | Ga0451839_1148937 | Ga0451839_1148937_228_584 | 118 |
| 495 | 3300041512 | Ga0451853_2087719 | Ga0451853_2087719_253_609 | 118 |
| 496 | 3300042876 | Ga0451577_0191181 | Ga0451577_0191181_950_1309 | 118 |
| 497 | 3300044673 | Ga0453683_0251112 | Ga0453683_0251112_501_860 | 118 |
| 498 | 3300044683 | Ga0466965_0000559 | Ga0466965_0000559_3869_4237 | 118 |
| 499 | 3300044684 | Ga0466966_0001165 | Ga0466966_0001165_10841_11209 | 118 |
| 500 | 3300044706 | Ga0466964_0000447 | Ga0466964_0000447_11730_12098 | 118 |
| 501 | 3300044765 | Ga0466970_0005977 | Ga0466970_0005977_3071_3439 | 118 |
| 502 | 3300045049 | Ga0466959_0039708 | Ga0466959_0039708_18_386 | 118 |
| 503 | 3300045051 | Ga0451576_0841674 | Ga0451576_0841674_255_611 | 118 |
| 504 | 3300045836 | Ga0466958_0034103 | Ga0466958_0034103_2640_3008 | 118 |
| 505 | 3300045976 | Ga0466967_0226252 | Ga0466967_0226252_62_430 | 118 |
| 506 | 3300046460 | Ga0495638_0126886 | Ga0495638_0126886_30_398 | 118 |
| 507 | 3300046460 | Ga0495638_0399059 | Ga0495638_0399059_173_529 | 118 |
| 508 | 3300046528 | Ga0495642_0352562 | Ga0495642_0352562_43_399 | 118 |
| 509 | 3300046539 | Ga0495621_0116390 | Ga0495621_0116390_303_659 | 118 |
| 510 | 3300048903 | Ga0496100_0080314 | Ga0496100_0080314_500_856 | 118 |
| 511 | 3300048904 | Ga0496101_0037115 | Ga0496101_0037115_2177_2533 | 118 |
| 512 | 3300048905 | Ga0496102_0132105 | Ga0496102_0132105_664_1020 | 118 |
| 513 | 3300048905 | Ga0496102_1824883 | Ga0496102_1824883_72_428 | 118 |
| 514 | 3300048906 | Ga0496103_0237866 | Ga0496103_0237866_534_890 | 118 |
| 515 | 3300048907 | Ga0496104_0151488 | Ga0496104_0151488_884_1240 | 118 |
| 516 | 3300048907 | Ga0496104_0286343 | Ga0496104_0286343_423_779 | 118 |
| 517 | 3300048908 | Ga0496105_0086706 | Ga0496105_0086706_1136_1492 | 118 |
| 518 | 3300048908 | Ga0496105_0468867 | Ga0496105_0468867_271_627 | 118 |
| 519 | 3300048909 | Ga0496106_0066875 | Ga0496106_0066875_1551_1907 | 118 |
| 520 | 3300048910 | Ga0496107_0105216 | Ga0496107_0105216_832_1188 | 118 |
| 521 | 3300048911 | Ga0496108_0003424 | Ga0496108_0003424_6453_6809 | 118 |
| 522 | 3300048911 | Ga0496108_0059794 | Ga0496108_0059794_1918_2274 | 118 |
| 523 | 3300048912 | Ga0496109_0005269 | Ga0496109_0005269_9085_9441 | 118 |
| 524 | 3300048912 | Ga0496109_0168996 | Ga0496109_0168996_1598_1966 | 118 |
| 525 | 3300048912 | Ga0496109_0395165 | Ga0496109_0395165_818_1174 | 118 |
| 526 | 3300048913 | Ga0496110_0024803 | Ga0496110_0024803_2303_2659 | 118 |
| 527 | 3300048913 | Ga0496110_0951447 | Ga0496110_0951447_26_382 | 118 |
| 528 | 3300048914 | Ga0496111_0338012 | Ga0496111_0338012_39_395 | 118 |
| 529 | 3300048914 | Ga0496111_0473294 | Ga0496111_0473294_123_479 | 118 |
| 530 | 3300048915 | Ga0496112_0255811 | Ga0496112_0255811_215_571 | 118 |
| 531 | 3300048916 | Ga0496113_0122872 | Ga0496113_0122872_875_1231 | 118 |
| 532 | 3300048917 | Ga0496114_0030835 | Ga0496114_0030835_2592_2948 | 118 |
| 533 | 3300048926 | Ga0496123_0263987 | Ga0496123_0263987_74_442 | 118 |
| 534 | 3300050490 | nmdc:mga03n38_451500_c1 | nmdc:mga03n38_451500_c1_215_577 | 118 |
| 535 | 3300050491 | nmdc:mga00v17_482881_c1 | nmdc:mga00v17_482881_c1_202_564 | 118 |
| 536 | 3300050508 | nmdc:mga09592_47303_c1 | nmdc:mga09592_47303_c1_1953_2312 | 118 |
| 537 | 3300050511 | nmdc:mga08y16_11377_c1 | nmdc:mga08y16_11377_c1_29_388 | 118 |
| 538 | 3300050511 | nmdc:mga08y16_1354008_c1 | nmdc:mga08y16_1354008_c1_41_397 | 118 |
| 539 | 3300050512 | nmdc:mga0n895_45632_c1 | nmdc:mga0n895_45632_c1_423_782 | 118 |
| 540 | 3300050515 | nmdc:mga0a205_1011738_c1 | nmdc:mga0a205_1011738_c1_273_632 | 118 |
| 541 | 3300053153 | Ga0500616_0226976 | Ga0500616_0226976_103_471 | 118 |
| 542 | 3300053156 | Ga0500622_0001824 | Ga0500622_0001824_8752_9126 | 118 |
| 543 | 3300061719 | Ga0466962_0064169 | Ga0466962_0064169_504_872 | 118 |
| 544 | iso_pu_bacteria | 2831864461 | 2831868966 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xly-assembly1.cif.gz_B | x-ray structure of the rna-binding protein she2p | 0.5079 | 6 | 102 |
| 5znd-assembly1.cif.gz_A | 8-mer nanotube derived from 24-mer rhuhf nanocage | 0.4995 | 2 | 67 |
| 7sel-assembly1.cif.gz_B | e. coli msba in complex with lps and inhibitor g7090 (compound 3) | 0.4916 | 4 | 92 |
| 2rld-assembly1.cif.gz_A | crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution | 0.4774 | 1 | 115 |
| 6z0c-assembly4.cif.gz_D | structure of in silico modelled artificial maquette-3 protein | 0.4599 | 2 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9N4P4_40_210_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7326 | 3 | 114 | 1.20.120.550 |
| af_Q9N4P4_40_210_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.6959 | 3 | 114 | 1.20.120.550 |
| af_P75685_2_182_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.661 | 3 | 116 | 1.20.120.550 |
| af_Q9VDI6_16_125_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.6421 | 4 | 108 | 1.20.120.550 |
| af_P75685_2_182_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.6377 | 3 | 116 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N5A7T2-F1-model_v4 | DUF1304 domain-containing protein | 1.005 | 4 | 69 |
GO:0016020
|
| AF-A0A1Q3S578-F1-model_v4 | deleted | 1.003 | 2 | 117 |
|
| AF-A0A1V5FX76-F1-model_v4 | DUF1304 domain-containing protein | 1.003 | 2 | 115 |
GO:0016020
|
| AF-A0A1T4XX38-F1-model_v4 | Putative membrane protein | 1.002 | 2 | 115 |
GO:0016020
|
| AF-A0A829SAE4-F1-model_v4 | DUF1304 domain-containing protein | 1.002 | 6 | 66 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar