F461691

General Info

Members Datasets Scaffolds Average Seq Length
544 321 535 118

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10045285|rootH1_100452852
Length 127
Sequence MIAGRKVRTMNTAANIVVALVALIHVYILVLEMFLWTTPTGRKAFGLTPEFAEASKVLAANQGLYNGFLAAGLIWGLVLGAAGGPVKVFFLACVLVAGLYGAATASRKILFIQALPAAIGLALLLLS

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2721755523 Delftia sp. HK171 Isolate Unclassified
3 2831864461 Roseateles noduli HZ7 Isolate Nodule
4 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
5 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
6 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
7 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
8 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
116 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
117 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
197 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
198 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
202 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
208 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
209 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
210 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
213 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
218 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
219 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
220 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
226 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
232 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
233 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
234 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
235 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
236 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
237 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
238 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
239 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
240 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
244 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
245 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
249 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
260 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
261 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
262 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
263 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
294 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
295 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
298 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
299 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
300 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
301 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
305 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
311 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
312 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
313 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
314 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
315 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
316 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
317 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
318 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
319 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
320 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
321 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.97
Nodule 1.1
Rhizoplane 7.72
Rhizosphere 70.22
Stem 0
Stem Tuber 0
Unclassified 6.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1010978 3300001977 Bacteria 1335
2 JGI24748J21848_1010592 3300002074 Bacteria 1084
3 JGI24738J21930_10034570 3300002075 Bacteria 1029
4 JGI24749J21850_1001786 3300002076 Bacteria 3044
5 JGI24034J26672_10010265 3300002239 Bacteria 1389
6 rootH1_10045285 3300003316 Bacteria 2739
7 rootH2_10096204 3300003320 Bacteria 5143
8 rootH2_10152404 3300003320 Bacteria 1364
9 rootL2_10000464 3300003322 Bacteria 48939
10 rootH1_10014154 3300003323 Bacteria 5230
11 rootH1_10075537 3300003323 Bacteria 4837
12 Ga0055526_1013231 3300003771 Bacteria 3509
13 Ga0055524_1000516 3300003775 Bacteria 29808
14 Ga0055524_1018850 3300003775 Bacteria 2380
15 Ga0055531_10000958 3300003794 Bacteria 23160
16 Ga0055531_10011808 3300003794 Bacteria 4170
17 Ga0055543_1000901 3300004625 Bacteria 14013
18 Ga0055543_1008989 3300004625 Bacteria 2176
19 Ga0065165_1000356 3300005262 Bacteria 75078
20 Ga0065165_1000573 3300005262 Bacteria 54490
21 Ga0065704_10030426 3300005289 Bacteria 965
22 Ga0065707_10305528 3300005295 Bacteria 984
23 Ga0070658_10346077 3300005327 Bacteria 1272
24 Ga0070676_10150692 3300005328 Bacteria 1488
25 Ga0070683_100086296 3300005329 Bacteria 2943
26 Ga0070683_100100825 3300005329 Bacteria 2718
27 Ga0070690_100045076 3300005330 Bacteria 2800
28 Ga0070670_100027381 3300005331 Bacteria 4904
29 Ga0070670_100032959 3300005331 Bacteria 4464
30 Ga0070670_100301775 3300005331 Bacteria 1401
31 Ga0070677_10071518 3300005333 Bacteria 1460
32 Ga0068869_100031397 3300005334 Bacteria 3736
33 Ga0068869_100269514 3300005334 Bacteria 1366
34 Ga0070666_10845855 3300005335 Bacteria 675
35 Ga0070666_10914309 3300005335 Bacteria 649
36 Ga0070682_100313801 3300005337 Bacteria 1155
37 Ga0070682_100816383 3300005337 Bacteria 759
38 Ga0068868_100129455 3300005338 Bacteria 2064
39 Ga0070660_100455012 3300005339 Bacteria 1062
40 Ga0070689_100134960 3300005340 Bacteria 1981
41 Ga0070691_10143131 3300005341 Bacteria 1220
42 Ga0070687_100099164 3300005343 Bacteria 1628
43 Ga0070661_100007619 3300005344 Bacteria 7467
44 Ga0070661_100290433 3300005344 Bacteria 1270
45 Ga0070661_100697182 3300005344 Bacteria 827
46 Ga0070661_101914343 3300005344 Bacteria 504
47 Ga0070692_10044241 3300005345 Bacteria 2293
48 Ga0070692_10716164 3300005345 Bacteria 675
49 Ga0070668_100003517 3300005347 Bacteria 11551
50 Ga0070668_100553594 3300005347 Bacteria 1001
51 Ga0070668_100646363 3300005347 Bacteria 929
52 Ga0070668_101522662 3300005347 Bacteria 612
53 Ga0070669_101906289 3300005353 Bacteria 519
54 Ga0070675_100068617 3300005354 Bacteria 2936
55 Ga0070671_100046910 3300005355 Bacteria 3593
56 Ga0070671_100168620 3300005355 Bacteria 1851
57 Ga0070671_100425800 3300005355 Bacteria 1137
58 Ga0070674_100052301 3300005356 Bacteria 2817
59 Ga0070673_100609687 3300005364 Bacteria 996
60 Ga0070688_100001847 3300005365 Bacteria 10643
61 Ga0070659_100089046 3300005366 Bacteria 2472
62 Ga0070659_100593657 3300005366 Bacteria 951
63 Ga0070667_100054239 3300005367 Bacteria 3385
64 Ga0070667_100643711 3300005367 Bacteria 978
65 Ga0070667_101328966 3300005367 Bacteria 674
66 Ga0070709_10635278 3300005434 Bacteria 825
67 Ga0070709_11623370 3300005434 Bacteria 527
68 Ga0070714_100247963 3300005435 Bacteria 1646
69 Ga0070710_11425876 3300005437 Bacteria 518
70 Ga0070701_10071520 3300005438 Bacteria 1856
71 Ga0070711_100244391 3300005439 Bacteria 1405
72 Ga0070700_100283320 3300005441 Bacteria 1202
73 Ga0070700_100858005 3300005441 Bacteria 736
74 Ga0070694_100604743 3300005444 Bacteria 883
75 Ga0070708_100863480 3300005445 Bacteria 850
76 Ga0070663_100008796 3300005455 Bacteria 6230
77 Ga0070663_100087107 3300005455 Bacteria 2307
78 Ga0070663_100443366 3300005455 Bacteria 1069
79 Ga0070678_100112375 3300005456 Bacteria 2133
80 Ga0070678_101582632 3300005456 Bacteria 615
81 Ga0070662_100002735 3300005457 Bacteria 10898
82 Ga0070662_100200398 3300005457 Bacteria 1583
83 Ga0068867_100134381 3300005459 Bacteria 1926
84 Ga0070685_10003125 3300005466 Bacteria 8420
85 Ga0070685_10006870 3300005466 Bacteria 5808
86 Ga0070685_10552315 3300005466 Bacteria 822
87 Ga0070699_100198668 3300005518 Bacteria 1783
88 Ga0070679_100135392 3300005530 Bacteria 2445
89 Ga0070679_100218284 3300005530 Bacteria 1868
90 Ga0070684_100883907 3300005535 Bacteria 837
91 Ga0070684_101204764 3300005535 Bacteria 712
92 Ga0068853_100054698 3300005539 Bacteria 3440
93 Ga0070686_100092923 3300005544 Bacteria 2022
94 Ga0070693_100091145 3300005547 Bacteria 1838
95 Ga0070693_100110652 3300005547 Bacteria 1689
96 Ga0070665_100000185 3300005548 Bacteria 111130
97 Ga0070665_100083469 3300005548 Bacteria 3200
98 Ga0070665_100085358 3300005548 Bacteria 3162
99 Ga0068855_100082310 3300005563 Bacteria 3731
100 Ga0070664_100069516 3300005564 Bacteria 3013
101 Ga0070664_100216956 3300005564 Bacteria 1711
102 Ga0070664_101279563 3300005564 Bacteria 692
103 Ga0068857_100004957 3300005577 Bacteria 11309
104 Ga0068857_100065716 3300005577 Bacteria 3226
105 Ga0068854_100043113 3300005578 Bacteria 3196
106 Ga0068854_100541783 3300005578 Bacteria 986
107 Ga0068856_100192043 3300005614 Bacteria 2056
108 Ga0068856_100252439 3300005614 Bacteria 1779
109 Ga0068856_100893748 3300005614 Bacteria 907
110 Ga0070702_100024578 3300005615 Bacteria 3216
111 Ga0070702_101370961 3300005615 Bacteria 577
112 Ga0068852_100008993 3300005616 Bacteria 7394
113 Ga0068852_100016822 3300005616 Bacteria 5718
114 Ga0068852_100381703 3300005616 Bacteria 1382
115 Ga0068859_100081731 3300005617 Bacteria 3273
116 Ga0068859_101560674 3300005617 Bacteria 729
117 Ga0068864_100025205 3300005618 Bacteria 5007
118 Ga0068864_100510315 3300005618 Bacteria 1158
119 Ga0068864_101087964 3300005618 Bacteria 795
120 Ga0068864_101216395 3300005618 Bacteria 752
121 Ga0068866_10058862 3300005718 Bacteria 1985
122 Ga0068861_100021803 3300005719 Bacteria 4607
123 Ga0068851_10019001 3300005834 Bacteria 3319
124 Ga0068851_10051127 3300005834 Bacteria 2100
125 Ga0068851_10293941 3300005834 Bacteria 932
126 Ga0068870_10007140 3300005840 Bacteria 4968
127 Ga0068870_11083131 3300005840 Bacteria 575
128 Ga0068863_100121499 3300005841 Bacteria 2491
129 Ga0068863_100124753 3300005841 Bacteria 2456
130 Ga0068863_100813829 3300005841 Bacteria 932
131 Ga0068863_101177970 3300005841 Bacteria 772
132 Ga0068858_100129152 3300005842 Bacteria 2368
133 Ga0068858_100460553 3300005842 Bacteria 1226
134 Ga0068860_100212145 3300005843 Bacteria 1878
135 Ga0068862_100333357 3300005844 Bacteria 1403
136 Ga0068862_102037511 3300005844 Bacteria 585
137 Ga0075365_10185155 3300006038 Bacteria 1456
138 Ga0075363_100558785 3300006048 Bacteria 683
139 Ga0075364_10557595 3300006051 Bacteria 783
140 Ga0070712_100296678 3300006175 Bacteria 1307
141 Ga0070712_101725381 3300006175 Bacteria 548
142 Ga0075362_10037852 3300006177 Bacteria 2117
143 Ga0075362_10148759 3300006177 Bacteria 1123
144 Ga0075367_10038276 3300006178 Bacteria 2791
145 Ga0075367_11035035 3300006178 Bacteria 524
146 Ga0075366_10001146 3300006195 Bacteria 13109
147 Ga0075366_10003385 3300006195 Bacteria 8403
148 Ga0075366_10045891 3300006195 Bacteria 2589
149 Ga0075366_10067193 3300006195 Bacteria 2133
150 Ga0075366_10116191 3300006195 Bacteria 1611
151 Ga0075366_10205092 3300006195 Bacteria 1199
152 Ga0097621_100165768 3300006237 Bacteria 1902
153 Ga0097621_100176445 3300006237 Bacteria 1844
154 Ga0097621_101517208 3300006237 Bacteria 636
155 Ga0075370_10003205 3300006353 Bacteria 7747
156 Ga0075370_10003763 3300006353 Bacteria 7259
157 Ga0075370_10017666 3300006353 Bacteria 3856
158 Ga0075370_10167873 3300006353 Bacteria 1289
159 Ga0075370_10264816 3300006353 Bacteria 1020
160 Ga0068871_100096947 3300006358 Bacteria 2464
161 Ga0068871_100175188 3300006358 Bacteria 1841
162 Ga0068871_100280028 3300006358 Bacteria 1459
163 Ga0075429_100050202 3300006880 Bacteria 3630
164 Ga0068865_100025774 3300006881 Bacteria 3872
165 Ga0097620_100081731 3300006931 Bacteria 3273
166 Ga0097620_101560461 3300006931 Bacteria 729
167 Ga0099823_1000025 3300006944 Bacteria 73278
168 Ga0079104_1000314 3300006946 Bacteria 61159
169 Ga0099794_10641017 3300007265 Bacteria 564
170 Ga0105244_10000896 3300009036 Bacteria 25177
171 Ga0105250_10002300 3300009092 Bacteria 9695
172 Ga0105240_10371002 3300009093 Bacteria 1618
173 Ga0111539_10212294 3300009094 Bacteria 2255
174 Ga0105245_12948553 3300009098 Bacteria 527
175 Ga0105243_10001537 3300009148 Bacteria 20174
176 Ga0105243_10007505 3300009148 Bacteria 8380
177 Ga0105243_12442717 3300009148 Bacteria 561
178 Ga0105242_10062751 3300009176 Bacteria 3059
179 Ga0105248_10014429 3300009177 Bacteria 8696
180 Ga0105248_10419855 3300009177 Bacteria 1506
181 Ga0105248_10907050 3300009177 Bacteria 995
182 Ga0105237_10404189 3300009545 Bacteria 1370
183 Ga0105238_10521372 3300009551 Bacteria 1191
184 Ga0105238_10922791 3300009551 Bacteria 892
185 Ga0105249_10154928 3300009553 Bacteria 2209
186 Ga0105246_10233068 3300011119 Bacteria 1451
187 Ga0105246_10600644 3300011119 Bacteria 951
188 Ga0157317_1000361 3300012475 Bacteria 1827
189 Ga0157319_1000014 3300012497 Bacteria 139356
190 Ga0157313_1017553 3300012503 Bacteria 695
191 Ga0157373_10416051 3300013100 Bacteria 965
192 Ga0157371_10290684 3300013102 Bacteria 1182
193 Ga0157371_11666170 3300013102 Bacteria 500
194 Ga0157370_10000842 3300013104 Bacteria 38924
195 Ga0157370_10059286 3300013104 Bacteria 3637
196 Ga0157370_10211622 3300013104 Bacteria 1797
197 Ga0157370_10519690 3300013104 Bacteria 1093
198 Ga0157369_10031755 3300013105 Bacteria 5811
199 Ga0157374_10010308 3300013296 Bacteria 8037
200 Ga0157374_10039321 3300013296 Bacteria 4353
201 Ga0157374_11152236 3300013296 Bacteria 796
202 Ga0157378_10361261 3300013297 Bacteria 1421
203 Ga0163162_10369721 3300013306 Bacteria 1567
204 Ga0157372_10347452 3300013307 Bacteria 1728
205 Ga0157372_10841917 3300013307 Bacteria 1065
206 Ga0157372_11114536 3300013307 Bacteria 913
207 Ga0157375_10418744 3300013308 Bacteria 1506
208 Ga0157375_10452521 3300013308 Bacteria 1449
209 Ga0157380_10221869 3300014326 Bacteria 1692
210 Ga0157380_11540889 3300014326 Bacteria 719
211 Ga0157377_10001430 3300014745 Bacteria 10296
212 Ga0157376_10051813 3300014969 Bacteria 3410
213 Ga0157376_10186912 3300014969 Bacteria 1897
214 Ga0157376_11202233 3300014969 Bacteria 786
215 Ga0157376_12048957 3300014969 Bacteria 610
216 Ga0163161_10004424 3300017792 Bacteria 9801
217 Ga0163161_10162912 3300017792 Bacteria 1701
218 Ga0163161_12053460 3300017792 Bacteria 508
219 Ga0213876_10234259 3300021384 Bacteria 976
220 Ga0207425_1040973 3300025245 Bacteria 882
221 Ga0209673_1002109 3300025273 Bacteria 14921
222 Ga0209673_1054321 3300025273 Bacteria 1038
223 Ga0209673_1059677 3300025273 Bacteria 960
224 Ga0209564_1000120 3300025295 Bacteria 204226
225 Ga0209050_1001224 3300025298 Bacteria 29786
226 Ga0209256_1000391 3300025299 Bacteria 69634
227 Ga0209256_1001174 3300025299 Bacteria 29515
228 Ga0209051_1001334 3300025303 Bacteria 21469
229 Ga0209257_1001286 3300025304 Bacteria 30635
230 Ga0209257_1001981 3300025304 Bacteria 22011
231 Ga0207697_10006661 3300025315 Bacteria 5204
232 Ga0207656_10007540 3300025321 Bacteria 3968
233 Ga0207656_10219678 3300025321 Bacteria 923
234 Ga0207696_1000007 3300025711 Bacteria 578417
235 Ga0207696_1004149 3300025711 Bacteria 6332
236 Ga0207655_1008820 3300025728 Bacteria 6343
237 Ga0207713_1000005 3300025735 Bacteria 649958
238 Ga0207682_10001376 3300025893 Bacteria 11224
239 Ga0207688_10007810 3300025901 Bacteria 5821
240 Ga0207680_10038458 3300025903 Bacteria 2769
241 Ga0207680_10340481 3300025903 Bacteria 1052
242 Ga0207680_10561771 3300025903 Bacteria 815
243 Ga0207647_10112692 3300025904 Bacteria 1607
244 Ga0207699_10840419 3300025906 Bacteria 676
245 Ga0207645_10003236 3300025907 Bacteria 12442
246 Ga0207643_10001910 3300025908 Bacteria 11499
247 Ga0207643_10852894 3300025908 Bacteria 590
248 Ga0207705_10120631 3300025909 Bacteria 1945
249 Ga0207705_10138843 3300025909 Bacteria 1814
250 Ga0207654_10373264 3300025911 Bacteria 986
251 Ga0207695_10151483 3300025913 Bacteria 2258
252 Ga0207671_10030967 3300025914 Bacteria 3989
253 Ga0207671_10799290 3300025914 Bacteria 748
254 Ga0207693_10135152 3300025915 Bacteria 1938
255 Ga0207662_10014972 3300025918 Bacteria 4357
256 Ga0207657_10193463 3300025919 Bacteria 1640
257 Ga0207649_10257545 3300025920 Bacteria 1259
258 Ga0207649_10613914 3300025920 Bacteria 837
259 Ga0207649_10869746 3300025920 Bacteria 706
260 Ga0207652_10517069 3300025921 Bacteria 1074
261 Ga0207652_11230702 3300025921 Bacteria 651
262 Ga0207681_10123337 3300025923 Bacteria 1903
263 Ga0207650_10008159 3300025925 Bacteria 7140
264 Ga0207650_10116218 3300025925 Bacteria 2077
265 Ga0207650_10531789 3300025925 Bacteria 984
266 Ga0207659_10001220 3300025926 Bacteria 15376
267 Ga0207659_10005473 3300025926 Bacteria 7700
268 Ga0207659_11546790 3300025926 Bacteria 567
269 Ga0207687_10343426 3300025927 Bacteria 1214
270 Ga0207644_10037965 3300025931 Bacteria 3390
271 Ga0207644_10049641 3300025931 Bacteria 3005
272 Ga0207644_10050405 3300025931 Bacteria 2984
273 Ga0207644_10173371 3300025931 Bacteria 1686
274 Ga0207690_10031466 3300025932 Bacteria 3395
275 Ga0207690_10561258 3300025932 Bacteria 929
276 Ga0207706_10000618 3300025933 Bacteria 37720
277 Ga0207706_10006454 3300025933 Bacteria 10893
278 Ga0207706_10031049 3300025933 Bacteria 4762
279 Ga0207686_10345198 3300025934 Bacteria 1119
280 Ga0207709_10000310 3300025935 Bacteria 52953
281 Ga0207709_10022625 3300025935 Bacteria 3566
282 Ga0207709_10459706 3300025935 Bacteria 985
283 Ga0207709_10489577 3300025935 Bacteria 958
284 Ga0207670_10051612 3300025936 Bacteria 2762
285 Ga0207669_11084325 3300025937 Bacteria 675
286 Ga0207669_11616013 3300025937 Bacteria 553
287 Ga0207704_10018091 3300025938 Bacteria 3670
288 Ga0207691_10012341 3300025940 Bacteria 8189
289 Ga0207711_10162677 3300025941 Bacteria 2021
290 Ga0207711_10288479 3300025941 Bacteria 1512
291 Ga0207711_10797178 3300025941 Bacteria 880
292 Ga0207689_10007213 3300025942 Bacteria 9764
293 Ga0207689_10116148 3300025942 Bacteria 2200
294 Ga0207661_10080742 3300025944 Bacteria 2684
295 Ga0207661_10197322 3300025944 Bacteria 1768
296 Ga0207661_10784483 3300025944 Bacteria 877
297 Ga0207679_10044426 3300025945 Bacteria 3205
298 Ga0207679_10164904 3300025945 Bacteria 1818
299 Ga0207667_10288080 3300025949 Bacteria 1678
300 Ga0207651_10197114 3300025960 Bacteria 1610
301 Ga0207712_10347097 3300025961 Bacteria 1233
302 Ga0207712_10506088 3300025961 Bacteria 1033
303 Ga0207668_10015690 3300025972 Bacteria 4711
304 Ga0207668_10612239 3300025972 Bacteria 950
305 Ga0207640_10032008 3300025981 Bacteria 3257
306 Ga0207640_10085070 3300025981 Bacteria 2173
307 Ga0207640_10678259 3300025981 Bacteria 881
308 Ga0207658_10020837 3300025986 Bacteria 4542
309 Ga0207658_10233934 3300025986 Bacteria 1552
310 Ga0207677_10202082 3300026023 Bacteria 1580
311 Ga0207677_10725639 3300026023 Bacteria 884
312 Ga0207703_10031740 3300026035 Bacteria 4178
313 Ga0207639_10104968 3300026041 Bacteria 2292
314 Ga0207639_10424287 3300026041 Bacteria 1203
315 Ga0207639_10839612 3300026041 Bacteria 857
316 Ga0207678_10000065 3300026067 Bacteria 83028
317 Ga0207678_10011862 3300026067 Bacteria 7652
318 Ga0207678_10026390 3300026067 Bacteria 5068
319 Ga0207678_10113310 3300026067 Bacteria 2314
320 Ga0207708_10000557 3300026075 Bacteria 28820
321 Ga0207702_10277726 3300026078 Bacteria 1582
322 Ga0207702_10311575 3300026078 Bacteria 1497
323 Ga0207702_10422415 3300026078 Bacteria 1289
324 Ga0207641_10165438 3300026088 Bacteria 2014
325 Ga0207641_10252186 3300026088 Bacteria 1648
326 Ga0207641_12078075 3300026088 Bacteria 569
327 Ga0207648_10003179 3300026089 Bacteria 17304
328 Ga0207676_10065114 3300026095 Bacteria 2901
329 Ga0207676_10345989 3300026095 Bacteria 1373
330 Ga0207676_10627051 3300026095 Bacteria 1035
331 Ga0207674_10007455 3300026116 Bacteria 12752
332 Ga0207674_10010468 3300026116 Bacteria 10501
333 Ga0207674_10334899 3300026116 Bacteria 1463
334 Ga0207675_100005768 3300026118 Bacteria 11842
335 Ga0207683_10058664 3300026121 Bacteria 3379
336 Ga0207683_10606046 3300026121 Bacteria 1014
337 Ga0207683_11869083 3300026121 Bacteria 549
338 Ga0207698_10011417 3300026142 Bacteria 5759
339 Ga0207698_10166275 3300026142 Bacteria 1936
340 Ga0207698_10339387 3300026142 Bacteria 1414
341 Ga0209281_1000002 3300027111 Bacteria 1924012
342 Ga0209389_1000270 3300027296 Bacteria 32662
343 Ga0209371_1035912 3300027312 Bacteria 1040
344 Ga0209999_1018696 3300027543 Bacteria 1269
345 Ga0209970_1001043 3300027614 Bacteria 4908
346 Ga0209813_10007150 3300027866 Bacteria 2773
347 Ga0209974_10005259 3300027876 Bacteria 4568
348 Ga0207428_10319444 3300027907 Bacteria 1147
349 Ga0268266_10000345 3300028379 Bacteria 72371
350 Ga0268266_10043019 3300028379 Bacteria 3859
351 Ga0268266_11298286 3300028379 Bacteria 703
352 Ga0268265_10445915 3300028380 Bacteria 1207
353 Ga0268264_10557710 3300028381 Bacteria 1124
354 Ga0268264_10653335 3300028381 Bacteria 1041
355 Ga0307517_10216900 3300028786 Bacteria 1169
356 Ga0307515_10000902 3300028794 Bacteria 68371
357 Ga0307515_10000991 3300028794 Bacteria 64898
358 Ga0307515_10002510 3300028794 Bacteria 39740
359 Ga0307515_10252738 3300028794 Bacteria 1512
360 Ga0307515_10451187 3300028794 Bacteria 901
361 Ga0268256_1039269 3300030500 Bacteria 1070
362 Ga0307512_10144826 3300030522 Bacteria 1441
363 Ga0307512_10268601 3300030522 Bacteria 829
364 Ga0265332_10261700 3300031238 Bacteria 715
365 Ga0265320_10190493 3300031240 Bacteria 917
366 Ga0265331_10381812 3300031250 Bacteria 631
367 Ga0307513_10038536 3300031456 Bacteria 5306
368 Ga0307513_10292611 3300031456 Bacteria 1399
369 Ga0307509_10046944 3300031507 Bacteria 4647
370 Ga0307408_100006837 3300031548 Bacteria 7563
371 Ga0307508_10000007 3300031616 Bacteria 268359
372 Ga0307508_10483760 3300031616 Bacteria 832
373 Ga0307514_10013727 3300031649 Bacteria 6716
374 Ga0265314_10059610 3300031711 Bacteria 2610
375 Ga0307516_10058976 3300031730 Bacteria 3734
376 Ga0307516_10114599 3300031730 Bacteria 2493
377 Ga0307413_10920233 3300031824 Bacteria 744
378 Ga0307410_12034813 3300031852 Bacteria 513
379 Ga0307412_10866867 3300031911 Bacteria 789
380 Ga0307412_11104813 3300031911 Bacteria 706
381 Ga0307415_101955992 3300032126 Bacteria 570
382 Ga0307510_10311995 3300033180 Bacteria 1032
383 Ga0373951_0039404 3300035091 Bacteria 1136
384 Ga0373946_0224007 3300035171 Bacteria 909
385 Ga0373947_0061538 3300035725 Bacteria 2282
386 Ga0373947_0336982 3300035725 Bacteria 1010
387 Ga0395905_0385739 3300037471 Bacteria 1295
388 Ga0436365_0149550 3300039437 Bacteria 1029
389 Ga0451789_0932306 3300041443 Bacteria 529
390 Ga0451793_1638594 3300041452 Bacteria 1979
391 Ga0451833_0526556 3300041491 Bacteria 689
392 Ga0451839_1148937 3300041496 Bacteria 641
393 Ga0451847_0692594 3300041503 Bacteria 549
394 Ga0451851_1006281 3300041507 Bacteria 566
395 Ga0451843_0212037 3300041509 Bacteria 691
396 Ga0451853_2087719 3300041512 Bacteria 929
397 Ga0439443_077257 3300042003 Bacteria 615
398 Ga0439446_0115896 3300042156 Bacteria 859
399 Ga0451577_0191181 3300042876 Bacteria 1846
400 Ga0466972_0020128 3300044658 Bacteria 3335
401 Ga0453683_0251112 3300044673 Bacteria 1127
402 Ga0466965_0000559 3300044683 Bacteria 13431
403 Ga0466965_0008990 3300044683 Bacteria 4635
404 Ga0466966_0001165 3300044684 Bacteria 16896
405 Ga0466963_0012111 3300044694 Bacteria 5271
406 Ga0466963_0079390 3300044694 Bacteria 2220
407 Ga0466964_0000447 3300044706 Bacteria 12610
408 Ga0466968_0159202 3300044735 Bacteria 1041
409 Ga0466970_0005977 3300044765 Bacteria 6064
410 Ga0466970_0014874 3300044765 Bacteria 4000
411 Ga0466960_0164751 3300044901 Bacteria 1192
412 Ga0466959_0039708 3300045049 Bacteria 3478
413 Ga0451576_0841674 3300045051 Bacteria 963
414 Ga0466958_0034103 3300045836 Bacteria 3035
415 Ga0466967_0226252 3300045976 Bacteria 1779
416 Ga0466967_1159217 3300045976 Bacteria 770
417 Ga0466967_1262764 3300045976 Bacteria 736
418 Ga0495638_0126886 3300046460 Bacteria 1503
419 Ga0495638_0399059 3300046460 Bacteria 714
420 Ga0495583_0380660 3300046506 Bacteria 555
421 Ga0495606_0264711 3300046507 Unclassified 947
422 Ga0495610_0058391 3300046512 Bacteria 1846
423 Ga0495620_0112293 3300046515 Bacteria 1079
424 Ga0495631_0347539 3300046518 Bacteria 631
425 Ga0495632_0017593 3300046519 Bacteria 3941
426 Ga0495632_0049803 3300046519 Bacteria 2069
427 Ga0495643_0017292 3300046522 Bacteria 4217
428 Ga0495648_0288851 3300046524 Bacteria 774
429 Ga0495642_0352562 3300046528 Bacteria 647
430 Ga0495621_0116390 3300046539 Bacteria 1030
431 Ga0495597_0017307 3300046542 Bacteria 3395
432 Ga0495668_0163659 3300046616 Bacteria 1219
433 Ga0495611_0310144 3300046648 Bacteria 727
434 Ga0495625_0009183 3300046660 Bacteria 8307
435 Ga0495625_0027785 3300046660 Bacteria 4252
436 Ga0495625_0281425 3300046660 Bacteria 1070
437 Ga0495625_0410764 3300046660 Bacteria 844
438 Ga0495658_0550215 3300046683 Bacteria 739
439 Ga0495649_0005203 3300046694 Bacteria 8330
440 Ga0495649_0194833 3300046694 Bacteria 1054
441 Ga0495660_0101314 3300046810 Bacteria 1482
442 Ga0495687_008233 3300047443 Bacteria 6001
443 Ga0495679_186335 3300047446 Bacteria 549
444 Ga0495686_0078919 3300047472 Bacteria 2014
445 Ga0495626_0324554 3300048091 Bacteria 604
446 Ga0496100_0075396 3300048903 Bacteria 2262
447 Ga0496100_0080314 3300048903 Bacteria 2200
448 Ga0496101_0037115 3300048904 Bacteria 3455
449 Ga0496101_0078660 3300048904 Bacteria 2433
450 Ga0496101_0559464 3300048904 Bacteria 904
451 Ga0496102_0094836 3300048905 Bacteria 2765
452 Ga0496102_0132105 3300048905 Bacteria 2338
453 Ga0496102_1824883 3300048905 Bacteria 525
454 Ga0496103_0237866 3300048906 Bacteria 1171
455 Ga0496104_0001887 3300048907 Bacteria 18156
456 Ga0496104_0151488 3300048907 Bacteria 2226
457 Ga0496104_0286343 3300048907 Bacteria 1560
458 Ga0496104_1062746 3300048907 Bacteria 713
459 Ga0496105_0002376 3300048908 Bacteria 13640
460 Ga0496105_0086706 3300048908 Bacteria 2587
461 Ga0496105_0468867 3300048908 Bacteria 992
462 Ga0496106_0066875 3300048909 Bacteria 2738
463 Ga0496107_0015816 3300048910 Bacteria 5292
464 Ga0496107_0105216 3300048910 Bacteria 2071
465 Ga0496108_0003424 3300048911 Bacteria 12729
466 Ga0496108_0059794 3300048911 Bacteria 3205
467 Ga0496108_0264648 3300048911 Bacteria 1496
468 Ga0496109_0005269 3300048912 Bacteria 10803
469 Ga0496109_0005848 3300048912 Bacteria 10316
470 Ga0496109_0168996 3300048912 Bacteria 2051
471 Ga0496109_0395165 3300048912 Bacteria 1306
472 Ga0496110_0024803 3300048913 Bacteria 5116
473 Ga0496110_0951447 3300048913 Unclassified 766
474 Ga0496110_1616051 3300048913 Bacteria 558
475 Ga0496111_0171105 3300048914 Bacteria 1614
476 Ga0496111_0338012 3300048914 Bacteria 1115
477 Ga0496111_0473294 3300048914 Bacteria 923
478 Ga0496112_0255811 3300048915 Bacteria 1701
479 Ga0496112_1621474 3300048915 Bacteria 560
480 Ga0496113_0059618 3300048916 Bacteria 2876
481 Ga0496113_0122872 3300048916 Bacteria 2031
482 Ga0496114_0014834 3300048917 Bacteria 6262
483 Ga0496114_0030835 3300048917 Bacteria 4411
484 Ga0496114_0038571 3300048917 Bacteria 3953
485 Ga0496115_0001975 3300048918 Bacteria 14635
486 Ga0496123_0263987 3300048926 Bacteria 842
487 Ga0496124_0049007 3300048927 Bacteria 3605
488 Ga0496124_0179432 3300048927 Bacteria 1631
489 Ga0496125_0193065 3300048928 Bacteria 1342
490 Ga0496126_0539193 3300048929 Bacteria 927
491 Ga0495682_0369280 3300049460 Bacteria 505
492 Ga0501202_073715 3300049652 Bacteria 791
493 nmdc:mga03683_138719_c1 3300050489 Bacteria 1092
494 nmdc:mga03683_29051_c1 3300050489 Bacteria 2203
495 nmdc:mga03n38_32164_c1 3300050490 Bacteria 2220
496 nmdc:mga03n38_451500_c1 3300050490 Bacteria 715
497 nmdc:mga00v17_24167_c1 3300050491 Bacteria 3522
498 nmdc:mga00v17_482881_c1 3300050491 Bacteria 804
499 nmdc:mga0k408_107346_c1 3300050493 Bacteria 1649
500 nmdc:mga0k408_11186_c1 3300050493 Bacteria 4880
501 nmdc:mga0k408_117052_c1 3300050493 Bacteria 1577
502 nmdc:mga0k408_1659_c1 3300050493 Bacteria 12024
503 nmdc:mga0k408_3382_c1 3300050493 Bacteria 8453
504 nmdc:mga0k408_45009_c1 3300050493 Bacteria 2546
505 nmdc:mga0k408_664_c1 3300050493 Bacteria 18844
506 nmdc:mga06z11_17968_c1 3300050494 Bacteria 3222
507 nmdc:mga06z11_71468_c1 3300050494 Bacteria 1837
508 nmdc:mga06z11_74325_c1 3300050494 Bacteria 1807
509 nmdc:mga04h51_24540_c1 3300050495 Bacteria 1847
510 nmdc:mga04h51_541711_c1 3300050495 Bacteria 501
511 nmdc:mga07m45_129_c1 3300050496 Bacteria 29894
512 nmdc:mga07m45_1421_c1 3300050496 Bacteria 10976
513 nmdc:mga07m45_2714_c1 3300050496 Bacteria 7837
514 nmdc:mga07m45_402765_c1 3300050496 Bacteria 794
515 nmdc:mga07m45_602044_c1 3300050496 Bacteria 635
516 nmdc:mga09592_47303_c1 3300050508 Bacteria 3626
517 nmdc:mga08y16_11377_c1 3300050511 Bacteria 9351
518 nmdc:mga08y16_1354008_c1 3300050511 Bacteria 677
519 nmdc:mga0n895_45632_c1 3300050512 Bacteria 4277
520 nmdc:mga0a205_1011738_c1 3300050515 Bacteria 678
521 nmdc:mga0sz30_24403_c1 3300050516 Bacteria 2467
522 nmdc:mga0sz30_324238_c1 3300050516 Bacteria 688
523 Ga0500578_0199557 3300053086 Bacteria 1225
524 Ga0500641_0000047 3300053096 Bacteria 60191
525 Ga0500658_0036781 3300053134 Bacteria 1944
526 Ga0500658_0056084 3300053134 Bacteria 1624
527 Ga0500573_0298365 3300053140 Bacteria 807
528 Ga0500616_0014641 3300053153 Bacteria 4501
529 Ga0500616_0226976 3300053153 Bacteria 811
530 Ga0500622_0001824 3300053156 Bacteria 16170
531 Ga0500624_007660 3300053157 Bacteria 1492
532 Ga0500634_0000026 3300053161 Bacteria 81353
533 Ga0500634_0161946 3300053161 Bacteria 1031
534 Ga0500587_007940 3300053739 Bacteria 1371
535 Ga0466962_0064169 3300061719 Bacteria 1753

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10519690 Ga0157370_105196902 94
2 3300031616 Ga0307508_10483760 Ga0307508_104837601 105
3 3300031730 Ga0307516_10114599 Ga0307516_101145992 105
4 3300005578 Ga0068854_100541783 Ga0068854_1005417832 106
5 3300049652 Ga0501202_073715 Ga0501202_073715_157_483 106
6 3300050496 nmdc:mga07m45_602044_c1 nmdc:mga07m45_602044_c1_299_625 107
7 3300004625 Ga0055543_1000901 Ga0055543_10009012 108
8 3300005262 Ga0065165_1000356 Ga0065165_100035624 108
9 3300005337 Ga0070682_100313801 Ga0070682_1003138011 109
10 3300005295 Ga0065707_10305528 Ga0065707_103055282 110
11 3300006880 Ga0075429_100050202 Ga0075429_1000502023 110
12 3300005345 Ga0070692_10716164 Ga0070692_107161642 111
13 iso_pu_bacteria 2721755523 2722885345 111
14 iso_pu_bacteria 2839138175 2839143401 111
15 iso_pu_bacteria 2908669403 2908671156 112
16 iso_pu_bacteria 2928115317 2928120858 112
17 iso_pu_bacteria 8003314358 8003322305 112
18 3300005344 Ga0070661_100697182 Ga0070661_1006971822 113
19 3300005457 Ga0070662_100002735 Ga0070662_10000273510 113
20 3300025920 Ga0207649_10613914 Ga0207649_106139142 113
21 3300025933 Ga0207706_10006454 Ga0207706_100064543 113
22 3300042156 Ga0439446_0115896 Ga0439446_0115896_433_774 113
23 iso_pu_bacteria 2585428062 2587755553 113
24 iso_pu_bacteria 2886848708 2886852157 114
25 iso_pu_bacteria 2894023352 2894027932 114
26 3300003316 rootH1_10045285 rootH1_100452852 115
27 3300003320 rootH2_10096204 rootH2_100962045 115
28 3300003322 rootL2_10000464 rootL2_1000046419 115
29 3300003323 rootH1_10014154 rootH1_100141545 115
30 3300003775 Ga0055524_1000516 Ga0055524_100051621 115
31 3300003794 Ga0055531_10011808 Ga0055531_100118082 115
32 3300005289 Ga0065704_10030426 Ga0065704_100304262 115
33 3300005347 Ga0070668_100646363 Ga0070668_1006463632 115
34 3300005367 Ga0070667_101328966 Ga0070667_1013289661 115
35 3300005466 Ga0070685_10552315 Ga0070685_105523152 115
36 3300005614 Ga0068856_100252439 Ga0068856_1002524392 115
37 3300006038 Ga0075365_10185155 Ga0075365_101851552 115
38 3300006353 Ga0075370_10017666 Ga0075370_100176661 115
39 3300006358 Ga0068871_100175188 Ga0068871_1001751882 115
40 3300006946 Ga0079104_1000314 Ga0079104_100031444 115
41 3300009092 Ga0105250_10002300 Ga0105250_1000230012 115
42 3300009098 Ga0105245_12948553 Ga0105245_129485531 115
43 3300009148 Ga0105243_10001537 Ga0105243_100015377 115
44 3300011119 Ga0105246_10600644 Ga0105246_106006442 115
45 3300012475 Ga0157317_1000361 Ga0157317_10003612 115
46 3300012497 Ga0157319_1000014 Ga0157319_100001449 115
47 3300013307 Ga0157372_10841917 Ga0157372_108419172 115
48 3300013308 Ga0157375_10452521 Ga0157375_104525212 115
49 3300014326 Ga0157380_11540889 Ga0157380_115408892 115
50 3300017792 Ga0163161_12053460 Ga0163161_120534601 115
51 3300025299 Ga0209256_1000391 Ga0209256_100039144 115
52 3300025304 Ga0209257_1001981 Ga0209257_10019812 115
53 3300025711 Ga0207696_1004149 Ga0207696_10041491 115
54 3300025935 Ga0207709_10000310 Ga0207709_1000031037 115
55 3300025937 Ga0207669_11616013 Ga0207669_116160131 115
56 3300025944 Ga0207661_10784483 Ga0207661_107844832 115
57 3300026078 Ga0207702_10311575 Ga0207702_103115752 115
58 3300027111 Ga0209281_1000002 Ga0209281_10000021172 115
59 3300027312 Ga0209371_1035912 Ga0209371_10359122 115
60 3300030500 Ga0268256_1039269 Ga0268256_10392692 115
61 3300031548 Ga0307408_100006837 Ga0307408_1000068375 115
62 3300041443 Ga0451789_0932306 Ga0451789_0932306_13_375 115
63 3300042003 Ga0439443_077257 Ga0439443_077257_10_366 115
64 3300044694 Ga0466963_0079390 Ga0466963_0079390_1297_1653 115
65 3300048903 Ga0496100_0075396 Ga0496100_0075396_435_785 115
66 3300048904 Ga0496101_0078660 Ga0496101_0078660_1184_1534 115
67 3300048904 Ga0496101_0559464 Ga0496101_0559464_259_609 115
68 3300048905 Ga0496102_0094836 Ga0496102_0094836_2390_2740 115
69 3300048907 Ga0496104_0001887 Ga0496104_0001887_3544_3894 115
70 3300048907 Ga0496104_1062746 Ga0496104_1062746_197_547 115
71 3300048908 Ga0496105_0002376 Ga0496105_0002376_9909_10259 115
72 3300048910 Ga0496107_0015816 Ga0496107_0015816_4681_5031 115
73 3300048911 Ga0496108_0264648 Ga0496108_0264648_1090_1440 115
74 3300048912 Ga0496109_0005848 Ga0496109_0005848_9913_10263 115
75 3300048913 Ga0496110_1616051 Ga0496110_1616051_13_363 115
76 3300048914 Ga0496111_0171105 Ga0496111_0171105_101_451 115
77 3300048915 Ga0496112_1621474 Ga0496112_1621474_77_427 115
78 3300048916 Ga0496113_0059618 Ga0496113_0059618_766_1116 115
79 3300048917 Ga0496114_0014834 Ga0496114_0014834_538_888 115
80 3300048917 Ga0496114_0038571 Ga0496114_0038571_1050_1400 115
81 3300048918 Ga0496115_0001975 Ga0496115_0001975_8006_8356 115
82 3300050493 nmdc:mga0k408_107346_c1 nmdc:mga0k408_107346_c1_438_794 115
83 3300003320 rootH2_10152404 rootH2_101524042 116
84 3300005337 Ga0070682_100816383 Ga0070682_1008163831 116
85 3300005347 Ga0070668_100003517 Ga0070668_10000351713 116
86 3300005434 Ga0070709_11623370 Ga0070709_116233701 116
87 3300005435 Ga0070714_100247963 Ga0070714_1002479633 116
88 3300005441 Ga0070700_100858005 Ga0070700_1008580052 116
89 3300005445 Ga0070708_100863480 Ga0070708_1008634801 116
90 3300005455 Ga0070663_100008796 Ga0070663_1000087963 116
91 3300005518 Ga0070699_100198668 Ga0070699_1001986681 116
92 3300005535 Ga0070684_100883907 Ga0070684_1008839071 116
93 3300005617 Ga0068859_101560674 Ga0068859_1015606742 116
94 3300005618 Ga0068864_101216395 Ga0068864_1012163952 116
95 3300005842 Ga0068858_100460553 Ga0068858_1004605532 116
96 3300006177 Ga0075362_10148759 Ga0075362_101487592 116
97 3300006178 Ga0075367_10038276 Ga0075367_100382763 116
98 3300006178 Ga0075367_11035035 Ga0075367_110350351 116
99 3300006195 Ga0075366_10001146 Ga0075366_1000114610 116
100 3300006195 Ga0075366_10003385 Ga0075366_100033853 116
101 3300006195 Ga0075366_10045891 Ga0075366_100458913 116
102 3300006195 Ga0075366_10067193 Ga0075366_100671931 116
103 3300006195 Ga0075366_10116191 Ga0075366_101161912 116
104 3300006353 Ga0075370_10003205 Ga0075370_100032056 116
105 3300006353 Ga0075370_10003763 Ga0075370_100037633 116
106 3300006353 Ga0075370_10167873 Ga0075370_101678732 116
107 3300006353 Ga0075370_10264816 Ga0075370_102648162 116
108 3300006931 Ga0097620_101560461 Ga0097620_1015604612 116
109 3300009036 Ga0105244_10000896 Ga0105244_100008967 116
110 3300009148 Ga0105243_10007505 Ga0105243_1000750512 116
111 3300009551 Ga0105238_10922791 Ga0105238_109227912 116
112 3300025711 Ga0207696_1000007 Ga0207696_1000007252 116
113 3300025728 Ga0207655_1008820 Ga0207655_10088206 116
114 3300025735 Ga0207713_1000005 Ga0207713_1000005408 116
115 3300025911 Ga0207654_10373264 Ga0207654_103732642 116
116 3300025913 Ga0207695_10151483 Ga0207695_101514832 116
117 3300025914 Ga0207671_10030967 Ga0207671_100309673 116
118 3300025926 Ga0207659_11546790 Ga0207659_115467901 116
119 3300025927 Ga0207687_10343426 Ga0207687_103434262 116
120 3300025933 Ga0207706_10031049 Ga0207706_100310495 116
121 3300025935 Ga0207709_10022625 Ga0207709_100226253 116
122 3300025942 Ga0207689_10116148 Ga0207689_101161483 116
123 3300025961 Ga0207712_10506088 Ga0207712_105060882 116
124 3300025972 Ga0207668_10015690 Ga0207668_100156902 116
125 3300025981 Ga0207640_10032008 Ga0207640_100320082 116
126 3300026041 Ga0207639_10424287 Ga0207639_104242872 116
127 3300026067 Ga0207678_10000065 Ga0207678_1000006517 116
128 3300026067 Ga0207678_10026390 Ga0207678_100263902 116
129 3300026116 Ga0207674_10007455 Ga0207674_100074555 116
130 3300026142 Ga0207698_10339387 Ga0207698_103393873 116
131 3300027866 Ga0209813_10007150 Ga0209813_100071503 116
132 3300028381 Ga0268264_10557710 Ga0268264_105577101 116
133 3300028381 Ga0268264_10653335 Ga0268264_106533352 116
134 3300028786 Ga0307517_10216900 Ga0307517_102169002 116
135 3300028794 Ga0307515_10252738 Ga0307515_102527385 116
136 3300028794 Ga0307515_10451187 Ga0307515_104511873 116
137 3300030522 Ga0307512_10144826 Ga0307512_101448263 116
138 3300031238 Ga0265332_10261700 Ga0265332_102617001 116
139 3300031240 Ga0265320_10190493 Ga0265320_101904932 116
140 3300031250 Ga0265331_10381812 Ga0265331_103818121 116
141 3300031456 Ga0307513_10292611 Ga0307513_102926114 116
142 3300031711 Ga0265314_10059610 Ga0265314_100596103 116
143 3300031730 Ga0307516_10058976 Ga0307516_100589763 116
144 3300031824 Ga0307413_10920233 Ga0307413_109202332 116
145 3300031911 Ga0307412_10866867 Ga0307412_108668672 116
146 3300032126 Ga0307415_101955992 Ga0307415_1019559922 116
147 3300033180 Ga0307510_10311995 Ga0307510_103119952 116
148 3300041507 Ga0451851_1006281 Ga0451851_1006281_166_519 116
149 3300044658 Ga0466972_0020128 Ga0466972_0020128_1924_2277 116
150 3300044683 Ga0466965_0008990 Ga0466965_0008990_1171_1524 116
151 3300044735 Ga0466968_0159202 Ga0466968_0159202_659_1012 116
152 3300044765 Ga0466970_0014874 Ga0466970_0014874_2314_2667 116
153 3300044901 Ga0466960_0164751 Ga0466960_0164751_183_536 116
154 3300045976 Ga0466967_1159217 Ga0466967_1159217_375_728 116
155 3300045976 Ga0466967_1262764 Ga0466967_1262764_199_552 116
156 3300046506 Ga0495583_0380660 Ga0495583_0380660_63_413 116
157 3300046512 Ga0495610_0058391 Ga0495610_0058391_240_590 116
158 3300046515 Ga0495620_0112293 Ga0495620_0112293_653_1003 116
159 3300046518 Ga0495631_0347539 Ga0495631_0347539_246_596 116
160 3300046519 Ga0495632_0017593 Ga0495632_0017593_382_732 116
161 3300046524 Ga0495648_0288851 Ga0495648_0288851_193_543 116
162 3300046542 Ga0495597_0017307 Ga0495597_0017307_664_1014 116
163 3300046616 Ga0495668_0163659 Ga0495668_0163659_355_708 116
164 3300046648 Ga0495611_0310144 Ga0495611_0310144_98_448 116
165 3300046660 Ga0495625_0009183 Ga0495625_0009183_467_832 116
166 3300046660 Ga0495625_0027785 Ga0495625_0027785_2413_2763 116
167 3300046660 Ga0495625_0281425 Ga0495625_0281425_408_758 116
168 3300046660 Ga0495625_0410764 Ga0495625_0410764_287_637 116
169 3300046694 Ga0495649_0005203 Ga0495649_0005203_1678_2028 116
170 3300046810 Ga0495660_0101314 Ga0495660_0101314_276_626 116
171 3300047443 Ga0495687_008233 Ga0495687_008233_2445_2795 116
172 3300047446 Ga0495679_186335 Ga0495679_186335_108_458 116
173 3300048091 Ga0495626_0324554 Ga0495626_0324554_181_531 116
174 3300048927 Ga0496124_0049007 Ga0496124_0049007_2914_3264 116
175 3300048928 Ga0496125_0193065 Ga0496125_0193065_277_627 116
176 3300048929 Ga0496126_0539193 Ga0496126_0539193_515_865 116
177 3300049460 Ga0495682_0369280 Ga0495682_0369280_51_401 116
178 3300050489 nmdc:mga03683_138719_c1 nmdc:mga03683_138719_c1_232_582 116
179 3300050489 nmdc:mga03683_29051_c1 nmdc:mga03683_29051_c1_882_1235 116
180 3300050490 nmdc:mga03n38_32164_c1 nmdc:mga03n38_32164_c1_679_1032 116
181 3300050491 nmdc:mga00v17_24167_c1 nmdc:mga00v17_24167_c1_385_738 116
182 3300050493 nmdc:mga0k408_11186_c1 nmdc:mga0k408_11186_c1_1201_1554 116
183 3300050493 nmdc:mga0k408_117052_c1 nmdc:mga0k408_117052_c1_91_441 116
184 3300050493 nmdc:mga0k408_1659_c1 nmdc:mga0k408_1659_c1_4979_5329 116
185 3300050493 nmdc:mga0k408_3382_c1 nmdc:mga0k408_3382_c1_4815_5165 116
186 3300050493 nmdc:mga0k408_45009_c1 nmdc:mga0k408_45009_c1_165_515 116
187 3300050493 nmdc:mga0k408_664_c1 nmdc:mga0k408_664_c1_7417_7767 116
188 3300050494 nmdc:mga06z11_17968_c1 nmdc:mga06z11_17968_c1_1669_2022 116
189 3300050494 nmdc:mga06z11_71468_c1 nmdc:mga06z11_71468_c1_44_394 116
190 3300050494 nmdc:mga06z11_74325_c1 nmdc:mga06z11_74325_c1_212_565 116
191 3300050495 nmdc:mga04h51_24540_c1 nmdc:mga04h51_24540_c1_474_827 116
192 3300050496 nmdc:mga07m45_129_c1 nmdc:mga07m45_129_c1_16588_16938 116
193 3300050496 nmdc:mga07m45_1421_c1 nmdc:mga07m45_1421_c1_9382_9735 116
194 3300050496 nmdc:mga07m45_2714_c1 nmdc:mga07m45_2714_c1_3857_4207 116
195 3300050496 nmdc:mga07m45_402765_c1 nmdc:mga07m45_402765_c1_160_510 116
196 3300050516 nmdc:mga0sz30_24403_c1 nmdc:mga0sz30_24403_c1_321_674 116
197 3300050516 nmdc:mga0sz30_324238_c1 nmdc:mga0sz30_324238_c1_88_441 116
198 3300053086 Ga0500578_0199557 Ga0500578_0199557_319_669 116
199 3300053134 Ga0500658_0036781 Ga0500658_0036781_929_1279 116
200 3300053153 Ga0500616_0014641 Ga0500616_0014641_4051_4401 116
201 3300003323 rootH1_10075537 rootH1_100755375 117
202 3300003775 Ga0055524_1018850 Ga0055524_10188502 117
203 3300003794 Ga0055531_10000958 Ga0055531_1000095822 117
204 3300004625 Ga0055543_1008989 Ga0055543_10089891 117
205 3300005262 Ga0065165_1000573 Ga0065165_100057328 117
206 3300005530 Ga0070679_100218284 Ga0070679_1002182841 117
207 3300006177 Ga0075362_10037852 Ga0075362_100378521 117
208 3300006195 Ga0075366_10205092 Ga0075366_102050922 117
209 3300006944 Ga0099823_1000025 Ga0099823_100002516 117
210 3300013104 Ga0157370_10000842 Ga0157370_1000084222 117
211 3300017792 Ga0163161_10004424 Ga0163161_100044244 117
212 3300025273 Ga0209673_1002109 Ga0209673_10021095 117
213 3300025273 Ga0209673_1054321 Ga0209673_10543211 117
214 3300025298 Ga0209050_1001224 Ga0209050_100122421 117
215 3300025299 Ga0209256_1001174 Ga0209256_100117421 117
216 3300025303 Ga0209051_1001334 Ga0209051_100133417 117
217 3300025304 Ga0209257_1001286 Ga0209257_10012868 117
218 3300025921 Ga0207652_11230702 Ga0207652_112307022 117
219 3300027296 Ga0209389_1000270 Ga0209389_100027015 117
220 3300027876 Ga0209974_10005259 Ga0209974_100052594 117
221 3300028794 Ga0307515_10000902 Ga0307515_1000090244 117
222 3300028794 Ga0307515_10000991 Ga0307515_1000099115 117
223 3300028794 Ga0307515_10002510 Ga0307515_100025108 117
224 3300030522 Ga0307512_10268601 Ga0307512_102686011 117
225 3300031456 Ga0307513_10038536 Ga0307513_100385366 117
226 3300031507 Ga0307509_10046944 Ga0307509_100469443 117
227 3300031616 Ga0307508_10000007 Ga0307508_1000000783 117
228 3300031649 Ga0307514_10013727 Ga0307514_100137279 117
229 3300031911 Ga0307412_11104813 Ga0307412_111048132 117
230 3300041452 Ga0451793_1638594 Ga0451793_1638594_325_693 117
231 3300041503 Ga0451847_0692594 Ga0451847_0692594_46_414 117
232 3300041509 Ga0451843_0212037 Ga0451843_0212037_175_543 117
233 3300044694 Ga0466963_0012111 Ga0466963_0012111_226_591 117
234 3300046507 Ga0495606_0264711 Ga0495606_0264711_333_695 117
235 3300046519 Ga0495632_0049803 Ga0495632_0049803_342_710 117
236 3300046522 Ga0495643_0017292 Ga0495643_0017292_270_638 117
237 3300046683 Ga0495658_0550215 Ga0495658_0550215_68_436 117
238 3300046694 Ga0495649_0194833 Ga0495649_0194833_47_415 117
239 3300047472 Ga0495686_0078919 Ga0495686_0078919_1341_1709 117
240 3300048927 Ga0496124_0179432 Ga0496124_0179432_336_713 117
241 3300050495 nmdc:mga04h51_541711_c1 nmdc:mga04h51_541711_c1_79_447 117
242 3300053096 Ga0500641_0000047 Ga0500641_0000047_269_631 117
243 3300053134 Ga0500658_0056084 Ga0500658_0056084_298_666 117
244 3300053140 Ga0500573_0298365 Ga0500573_0298365_349_711 117
245 3300053157 Ga0500624_007660 Ga0500624_007660_229_591 117
246 3300053161 Ga0500634_0000026 Ga0500634_0000026_63152_63514 117
247 3300053161 Ga0500634_0161946 Ga0500634_0161946_467_829 117
248 3300053739 Ga0500587_007940 Ga0500587_007940_611_979 117
249 3300001977 JGI24746J21847_1010978 JGI24746J21847_10109782 118
250 3300002074 JGI24748J21848_1010592 JGI24748J21848_10105922 118
251 3300002075 JGI24738J21930_10034570 JGI24738J21930_100345702 118
252 3300002076 JGI24749J21850_1001786 JGI24749J21850_10017862 118
253 3300002239 JGI24034J26672_10010265 JGI24034J26672_100102652 118
254 3300003771 Ga0055526_1013231 Ga0055526_10132312 118
255 3300005327 Ga0070658_10346077 Ga0070658_103460771 118
256 3300005328 Ga0070676_10150692 Ga0070676_101506921 118
257 3300005329 Ga0070683_100086296 Ga0070683_1000862964 118
258 3300005329 Ga0070683_100100825 Ga0070683_1001008255 118
259 3300005330 Ga0070690_100045076 Ga0070690_1000450763 118
260 3300005331 Ga0070670_100027381 Ga0070670_1000273815 118
261 3300005331 Ga0070670_100032959 Ga0070670_1000329592 118
262 3300005331 Ga0070670_100301775 Ga0070670_1003017752 118
263 3300005333 Ga0070677_10071518 Ga0070677_100715183 118
264 3300005334 Ga0068869_100031397 Ga0068869_1000313976 118
265 3300005334 Ga0068869_100269514 Ga0068869_1002695141 118
266 3300005335 Ga0070666_10845855 Ga0070666_108458551 118
267 3300005335 Ga0070666_10914309 Ga0070666_109143091 118
268 3300005338 Ga0068868_100129455 Ga0068868_1001294553 118
269 3300005339 Ga0070660_100455012 Ga0070660_1004550122 118
270 3300005340 Ga0070689_100134960 Ga0070689_1001349602 118
271 3300005341 Ga0070691_10143131 Ga0070691_101431312 118
272 3300005343 Ga0070687_100099164 Ga0070687_1000991642 118
273 3300005344 Ga0070661_100007619 Ga0070661_10000761912 118
274 3300005344 Ga0070661_100290433 Ga0070661_1002904331 118
275 3300005344 Ga0070661_101914343 Ga0070661_1019143431 118
276 3300005345 Ga0070692_10044241 Ga0070692_100442412 118
277 3300005347 Ga0070668_100553594 Ga0070668_1005535942 118
278 3300005347 Ga0070668_101522662 Ga0070668_1015226622 118
279 3300005353 Ga0070669_101906289 Ga0070669_1019062891 118
280 3300005354 Ga0070675_100068617 Ga0070675_1000686175 118
281 3300005355 Ga0070671_100046910 Ga0070671_1000469104 118
282 3300005355 Ga0070671_100168620 Ga0070671_1001686204 118
283 3300005355 Ga0070671_100425800 Ga0070671_1004258002 118
284 3300005356 Ga0070674_100052301 Ga0070674_1000523014 118
285 3300005364 Ga0070673_100609687 Ga0070673_1006096872 118
286 3300005365 Ga0070688_100001847 Ga0070688_1000018474 118
287 3300005366 Ga0070659_100089046 Ga0070659_1000890463 118
288 3300005366 Ga0070659_100593657 Ga0070659_1005936572 118
289 3300005367 Ga0070667_100054239 Ga0070667_1000542393 118
290 3300005367 Ga0070667_100643711 Ga0070667_1006437112 118
291 3300005434 Ga0070709_10635278 Ga0070709_106352782 118
292 3300005437 Ga0070710_11425876 Ga0070710_114258761 118
293 3300005438 Ga0070701_10071520 Ga0070701_100715203 118
294 3300005439 Ga0070711_100244391 Ga0070711_1002443911 118
295 3300005441 Ga0070700_100283320 Ga0070700_1002833202 118
296 3300005444 Ga0070694_100604743 Ga0070694_1006047432 118
297 3300005455 Ga0070663_100087107 Ga0070663_1000871073 118
298 3300005455 Ga0070663_100443366 Ga0070663_1004433661 118
299 3300005456 Ga0070678_100112375 Ga0070678_1001123753 118
300 3300005456 Ga0070678_101582632 Ga0070678_1015826322 118
301 3300005457 Ga0070662_100200398 Ga0070662_1002003983 118
302 3300005459 Ga0068867_100134381 Ga0068867_1001343812 118
303 3300005466 Ga0070685_10003125 Ga0070685_1000312513 118
304 3300005466 Ga0070685_10006870 Ga0070685_100068702 118
305 3300005530 Ga0070679_100135392 Ga0070679_1001353923 118
306 3300005535 Ga0070684_101204764 Ga0070684_1012047642 118
307 3300005539 Ga0068853_100054698 Ga0068853_1000546985 118
308 3300005544 Ga0070686_100092923 Ga0070686_1000929232 118
309 3300005547 Ga0070693_100091145 Ga0070693_1000911452 118
310 3300005547 Ga0070693_100110652 Ga0070693_1001106522 118
311 3300005548 Ga0070665_100000185 Ga0070665_10000018558 118
312 3300005548 Ga0070665_100083469 Ga0070665_1000834692 118
313 3300005548 Ga0070665_100085358 Ga0070665_1000853582 118
314 3300005563 Ga0068855_100082310 Ga0068855_1000823107 118
315 3300005564 Ga0070664_100069516 Ga0070664_1000695163 118
316 3300005564 Ga0070664_100216956 Ga0070664_1002169562 118
317 3300005564 Ga0070664_101279563 Ga0070664_1012795632 118
318 3300005577 Ga0068857_100004957 Ga0068857_10000495711 118
319 3300005577 Ga0068857_100065716 Ga0068857_1000657166 118
320 3300005578 Ga0068854_100043113 Ga0068854_1000431132 118
321 3300005614 Ga0068856_100192043 Ga0068856_1001920433 118
322 3300005614 Ga0068856_100893748 Ga0068856_1008937482 118
323 3300005615 Ga0070702_100024578 Ga0070702_1000245785 118
324 3300005615 Ga0070702_101370961 Ga0070702_1013709612 118
325 3300005616 Ga0068852_100008993 Ga0068852_1000089933 118
326 3300005616 Ga0068852_100016822 Ga0068852_1000168226 118
327 3300005616 Ga0068852_100381703 Ga0068852_1003817032 118
328 3300005617 Ga0068859_100081731 Ga0068859_1000817314 118
329 3300005618 Ga0068864_100025205 Ga0068864_1000252056 118
330 3300005618 Ga0068864_100510315 Ga0068864_1005103151 118
331 3300005618 Ga0068864_101087964 Ga0068864_1010879641 118
332 3300005718 Ga0068866_10058862 Ga0068866_100588623 118
333 3300005719 Ga0068861_100021803 Ga0068861_1000218036 118
334 3300005834 Ga0068851_10019001 Ga0068851_100190014 118
335 3300005834 Ga0068851_10051127 Ga0068851_100511272 118
336 3300005834 Ga0068851_10293941 Ga0068851_102939411 118
337 3300005840 Ga0068870_10007140 Ga0068870_100071403 118
338 3300005840 Ga0068870_11083131 Ga0068870_110831311 118
339 3300005841 Ga0068863_100121499 Ga0068863_1001214992 118
340 3300005841 Ga0068863_100124753 Ga0068863_1001247534 118
341 3300005841 Ga0068863_100813829 Ga0068863_1008138292 118
342 3300005841 Ga0068863_101177970 Ga0068863_1011779702 118
343 3300005842 Ga0068858_100129152 Ga0068858_1001291525 118
344 3300005843 Ga0068860_100212145 Ga0068860_1002121453 118
345 3300005844 Ga0068862_100333357 Ga0068862_1003333573 118
346 3300005844 Ga0068862_102037511 Ga0068862_1020375111 118
347 3300006048 Ga0075363_100558785 Ga0075363_1005587851 118
348 3300006051 Ga0075364_10557595 Ga0075364_105575952 118
349 3300006175 Ga0070712_100296678 Ga0070712_1002966783 118
350 3300006175 Ga0070712_101725381 Ga0070712_1017253812 118
351 3300006237 Ga0097621_100165768 Ga0097621_1001657684 118
352 3300006237 Ga0097621_100176445 Ga0097621_1001764454 118
353 3300006237 Ga0097621_101517208 Ga0097621_1015172082 118
354 3300006358 Ga0068871_100096947 Ga0068871_1000969474 118
355 3300006358 Ga0068871_100280028 Ga0068871_1002800282 118
356 3300006881 Ga0068865_100025774 Ga0068865_1000257746 118
357 3300006931 Ga0097620_100081731 Ga0097620_1000817314 118
358 3300007265 Ga0099794_10641017 Ga0099794_106410171 118
359 3300009093 Ga0105240_10371002 Ga0105240_103710022 118
360 3300009094 Ga0111539_10212294 Ga0111539_102122943 118
361 3300009148 Ga0105243_12442717 Ga0105243_124427171 118
362 3300009176 Ga0105242_10062751 Ga0105242_100627514 118
363 3300009177 Ga0105248_10014429 Ga0105248_100144297 118
364 3300009177 Ga0105248_10419855 Ga0105248_104198552 118
365 3300009177 Ga0105248_10907050 Ga0105248_109070503 118
366 3300009545 Ga0105237_10404189 Ga0105237_104041893 118
367 3300009551 Ga0105238_10521372 Ga0105238_105213722 118
368 3300009553 Ga0105249_10154928 Ga0105249_101549283 118
369 3300011119 Ga0105246_10233068 Ga0105246_102330683 118
370 3300012503 Ga0157313_1017553 Ga0157313_10175532 118
371 3300013100 Ga0157373_10416051 Ga0157373_104160512 118
372 3300013102 Ga0157371_10290684 Ga0157371_102906842 118
373 3300013102 Ga0157371_11666170 Ga0157371_116661702 118
374 3300013104 Ga0157370_10059286 Ga0157370_100592865 118
375 3300013104 Ga0157370_10211622 Ga0157370_102116223 118
376 3300013105 Ga0157369_10031755 Ga0157369_100317554 118
377 3300013296 Ga0157374_10010308 Ga0157374_100103086 118
378 3300013296 Ga0157374_10039321 Ga0157374_100393215 118
379 3300013296 Ga0157374_11152236 Ga0157374_111522361 118
380 3300013297 Ga0157378_10361261 Ga0157378_103612612 118
381 3300013306 Ga0163162_10369721 Ga0163162_103697212 118
382 3300013307 Ga0157372_10347452 Ga0157372_103474522 118
383 3300013307 Ga0157372_11114536 Ga0157372_111145362 118
384 3300013308 Ga0157375_10418744 Ga0157375_104187442 118
385 3300014326 Ga0157380_10221869 Ga0157380_102218692 118
386 3300014745 Ga0157377_10001430 Ga0157377_100014302 118
387 3300014969 Ga0157376_10051813 Ga0157376_100518133 118
388 3300014969 Ga0157376_10186912 Ga0157376_101869124 118
389 3300014969 Ga0157376_11202233 Ga0157376_112022332 118
390 3300014969 Ga0157376_12048957 Ga0157376_120489571 118
391 3300017792 Ga0163161_10162912 Ga0163161_101629123 118
392 3300021384 Ga0213876_10234259 Ga0213876_102342592 118
393 3300025245 Ga0207425_1040973 Ga0207425_10409732 118
394 3300025273 Ga0209673_1059677 Ga0209673_10596772 118
395 3300025295 Ga0209564_1000120 Ga0209564_100012091 118
396 3300025315 Ga0207697_10006661 Ga0207697_100066619 118
397 3300025321 Ga0207656_10007540 Ga0207656_100075404 118
398 3300025321 Ga0207656_10219678 Ga0207656_102196782 118
399 3300025893 Ga0207682_10001376 Ga0207682_100013768 118
400 3300025901 Ga0207688_10007810 Ga0207688_100078103 118
401 3300025903 Ga0207680_10038458 Ga0207680_100384582 118
402 3300025903 Ga0207680_10340481 Ga0207680_103404811 118
403 3300025903 Ga0207680_10561771 Ga0207680_105617712 118
404 3300025904 Ga0207647_10112692 Ga0207647_101126922 118
405 3300025906 Ga0207699_10840419 Ga0207699_108404191 118
406 3300025907 Ga0207645_10003236 Ga0207645_100032362 118
407 3300025908 Ga0207643_10001910 Ga0207643_100019108 118
408 3300025908 Ga0207643_10852894 Ga0207643_108528942 118
409 3300025909 Ga0207705_10120631 Ga0207705_101206313 118
410 3300025909 Ga0207705_10138843 Ga0207705_101388433 118
411 3300025914 Ga0207671_10799290 Ga0207671_107992902 118
412 3300025915 Ga0207693_10135152 Ga0207693_101351523 118
413 3300025918 Ga0207662_10014972 Ga0207662_100149722 118
414 3300025919 Ga0207657_10193463 Ga0207657_101934634 118
415 3300025920 Ga0207649_10257545 Ga0207649_102575451 118
416 3300025920 Ga0207649_10869746 Ga0207649_108697461 118
417 3300025921 Ga0207652_10517069 Ga0207652_105170692 118
418 3300025923 Ga0207681_10123337 Ga0207681_101233372 118
419 3300025925 Ga0207650_10008159 Ga0207650_100081595 118
420 3300025925 Ga0207650_10116218 Ga0207650_101162183 118
421 3300025925 Ga0207650_10531789 Ga0207650_105317892 118
422 3300025926 Ga0207659_10001220 Ga0207659_1000122016 118
423 3300025926 Ga0207659_10005473 Ga0207659_1000547312 118
424 3300025931 Ga0207644_10037965 Ga0207644_100379655 118
425 3300025931 Ga0207644_10049641 Ga0207644_100496412 118
426 3300025931 Ga0207644_10050405 Ga0207644_100504055 118
427 3300025931 Ga0207644_10173371 Ga0207644_101733713 118
428 3300025932 Ga0207690_10031466 Ga0207690_100314664 118
429 3300025932 Ga0207690_10561258 Ga0207690_105612582 118
430 3300025933 Ga0207706_10000618 Ga0207706_100006183 118
431 3300025934 Ga0207686_10345198 Ga0207686_103451982 118
432 3300025935 Ga0207709_10459706 Ga0207709_104597062 118
433 3300025935 Ga0207709_10489577 Ga0207709_104895772 118
434 3300025936 Ga0207670_10051612 Ga0207670_100516125 118
435 3300025937 Ga0207669_11084325 Ga0207669_110843252 118
436 3300025938 Ga0207704_10018091 Ga0207704_100180915 118
437 3300025940 Ga0207691_10012341 Ga0207691_100123412 118
438 3300025941 Ga0207711_10162677 Ga0207711_101626772 118
439 3300025941 Ga0207711_10288479 Ga0207711_102884793 118
440 3300025941 Ga0207711_10797178 Ga0207711_107971781 118
441 3300025942 Ga0207689_10007213 Ga0207689_100072132 118
442 3300025944 Ga0207661_10080742 Ga0207661_100807423 118
443 3300025944 Ga0207661_10197322 Ga0207661_101973223 118
444 3300025945 Ga0207679_10044426 Ga0207679_100444263 118
445 3300025945 Ga0207679_10164904 Ga0207679_101649043 118
446 3300025949 Ga0207667_10288080 Ga0207667_102880803 118
447 3300025960 Ga0207651_10197114 Ga0207651_101971143 118
448 3300025961 Ga0207712_10347097 Ga0207712_103470972 118
449 3300025972 Ga0207668_10612239 Ga0207668_106122391 118
450 3300025981 Ga0207640_10085070 Ga0207640_100850704 118
451 3300025981 Ga0207640_10678259 Ga0207640_106782592 118
452 3300025986 Ga0207658_10020837 Ga0207658_100208372 118
453 3300025986 Ga0207658_10233934 Ga0207658_102339342 118
454 3300026023 Ga0207677_10202082 Ga0207677_102020823 118
455 3300026023 Ga0207677_10725639 Ga0207677_107256392 118
456 3300026035 Ga0207703_10031740 Ga0207703_100317404 118
457 3300026041 Ga0207639_10104968 Ga0207639_101049683 118
458 3300026041 Ga0207639_10839612 Ga0207639_108396121 118
459 3300026067 Ga0207678_10011862 Ga0207678_1001186213 118
460 3300026067 Ga0207678_10113310 Ga0207678_101133103 118
461 3300026075 Ga0207708_10000557 Ga0207708_1000055730 118
462 3300026078 Ga0207702_10277726 Ga0207702_102777263 118
463 3300026078 Ga0207702_10422415 Ga0207702_104224152 118
464 3300026088 Ga0207641_10165438 Ga0207641_101654382 118
465 3300026088 Ga0207641_10252186 Ga0207641_102521863 118
466 3300026088 Ga0207641_12078075 Ga0207641_120780751 118
467 3300026089 Ga0207648_10003179 Ga0207648_1000317919 118
468 3300026095 Ga0207676_10065114 Ga0207676_100651145 118
469 3300026095 Ga0207676_10345989 Ga0207676_103459891 118
470 3300026095 Ga0207676_10627051 Ga0207676_106270512 118
471 3300026116 Ga0207674_10010468 Ga0207674_1001046819 118
472 3300026116 Ga0207674_10334899 Ga0207674_103348992 118
473 3300026118 Ga0207675_100005768 Ga0207675_1000057683 118
474 3300026121 Ga0207683_10058664 Ga0207683_100586646 118
475 3300026121 Ga0207683_10606046 Ga0207683_106060461 118
476 3300026121 Ga0207683_11869083 Ga0207683_118690831 118
477 3300026142 Ga0207698_10011417 Ga0207698_100114176 118
478 3300026142 Ga0207698_10166275 Ga0207698_101662752 118
479 3300027543 Ga0209999_1018696 Ga0209999_10186962 118
480 3300027614 Ga0209970_1001043 Ga0209970_10010435 118
481 3300027907 Ga0207428_10319444 Ga0207428_103194441 118
482 3300028379 Ga0268266_10000345 Ga0268266_1000034534 118
483 3300028379 Ga0268266_10043019 Ga0268266_100430195 118
484 3300028379 Ga0268266_11298286 Ga0268266_112982862 118
485 3300028380 Ga0268265_10445915 Ga0268265_104459152 118
486 3300031852 Ga0307410_12034813 Ga0307410_120348131 118
487 3300035091 Ga0373951_0039404 Ga0373951_0039404_459_815 118
488 3300035171 Ga0373946_0224007 Ga0373946_0224007_140_496 118
489 3300035725 Ga0373947_0061538 Ga0373947_0061538_1644_2000 118
490 3300035725 Ga0373947_0336982 Ga0373947_0336982_136_498 118
491 3300037471 Ga0395905_0385739 Ga0395905_0385739_541_903 118
492 3300039437 Ga0436365_0149550 Ga0436365_0149550_97_459 118
493 3300041491 Ga0451833_0526556 Ga0451833_0526556_41_397 118
494 3300041496 Ga0451839_1148937 Ga0451839_1148937_228_584 118
495 3300041512 Ga0451853_2087719 Ga0451853_2087719_253_609 118
496 3300042876 Ga0451577_0191181 Ga0451577_0191181_950_1309 118
497 3300044673 Ga0453683_0251112 Ga0453683_0251112_501_860 118
498 3300044683 Ga0466965_0000559 Ga0466965_0000559_3869_4237 118
499 3300044684 Ga0466966_0001165 Ga0466966_0001165_10841_11209 118
500 3300044706 Ga0466964_0000447 Ga0466964_0000447_11730_12098 118
501 3300044765 Ga0466970_0005977 Ga0466970_0005977_3071_3439 118
502 3300045049 Ga0466959_0039708 Ga0466959_0039708_18_386 118
503 3300045051 Ga0451576_0841674 Ga0451576_0841674_255_611 118
504 3300045836 Ga0466958_0034103 Ga0466958_0034103_2640_3008 118
505 3300045976 Ga0466967_0226252 Ga0466967_0226252_62_430 118
506 3300046460 Ga0495638_0126886 Ga0495638_0126886_30_398 118
507 3300046460 Ga0495638_0399059 Ga0495638_0399059_173_529 118
508 3300046528 Ga0495642_0352562 Ga0495642_0352562_43_399 118
509 3300046539 Ga0495621_0116390 Ga0495621_0116390_303_659 118
510 3300048903 Ga0496100_0080314 Ga0496100_0080314_500_856 118
511 3300048904 Ga0496101_0037115 Ga0496101_0037115_2177_2533 118
512 3300048905 Ga0496102_0132105 Ga0496102_0132105_664_1020 118
513 3300048905 Ga0496102_1824883 Ga0496102_1824883_72_428 118
514 3300048906 Ga0496103_0237866 Ga0496103_0237866_534_890 118
515 3300048907 Ga0496104_0151488 Ga0496104_0151488_884_1240 118
516 3300048907 Ga0496104_0286343 Ga0496104_0286343_423_779 118
517 3300048908 Ga0496105_0086706 Ga0496105_0086706_1136_1492 118
518 3300048908 Ga0496105_0468867 Ga0496105_0468867_271_627 118
519 3300048909 Ga0496106_0066875 Ga0496106_0066875_1551_1907 118
520 3300048910 Ga0496107_0105216 Ga0496107_0105216_832_1188 118
521 3300048911 Ga0496108_0003424 Ga0496108_0003424_6453_6809 118
522 3300048911 Ga0496108_0059794 Ga0496108_0059794_1918_2274 118
523 3300048912 Ga0496109_0005269 Ga0496109_0005269_9085_9441 118
524 3300048912 Ga0496109_0168996 Ga0496109_0168996_1598_1966 118
525 3300048912 Ga0496109_0395165 Ga0496109_0395165_818_1174 118
526 3300048913 Ga0496110_0024803 Ga0496110_0024803_2303_2659 118
527 3300048913 Ga0496110_0951447 Ga0496110_0951447_26_382 118
528 3300048914 Ga0496111_0338012 Ga0496111_0338012_39_395 118
529 3300048914 Ga0496111_0473294 Ga0496111_0473294_123_479 118
530 3300048915 Ga0496112_0255811 Ga0496112_0255811_215_571 118
531 3300048916 Ga0496113_0122872 Ga0496113_0122872_875_1231 118
532 3300048917 Ga0496114_0030835 Ga0496114_0030835_2592_2948 118
533 3300048926 Ga0496123_0263987 Ga0496123_0263987_74_442 118
534 3300050490 nmdc:mga03n38_451500_c1 nmdc:mga03n38_451500_c1_215_577 118
535 3300050491 nmdc:mga00v17_482881_c1 nmdc:mga00v17_482881_c1_202_564 118
536 3300050508 nmdc:mga09592_47303_c1 nmdc:mga09592_47303_c1_1953_2312 118
537 3300050511 nmdc:mga08y16_11377_c1 nmdc:mga08y16_11377_c1_29_388 118
538 3300050511 nmdc:mga08y16_1354008_c1 nmdc:mga08y16_1354008_c1_41_397 118
539 3300050512 nmdc:mga0n895_45632_c1 nmdc:mga0n895_45632_c1_423_782 118
540 3300050515 nmdc:mga0a205_1011738_c1 nmdc:mga0a205_1011738_c1_273_632 118
541 3300053153 Ga0500616_0226976 Ga0500616_0226976_103_471 118
542 3300053156 Ga0500622_0001824 Ga0500622_0001824_8752_9126 118
543 3300061719 Ga0466962_0064169 Ga0466962_0064169_504_872 118
544 iso_pu_bacteria 2831864461 2831868966 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06993

DUF1304

Protein of unknown function (DUF1304)

19

125

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xly-assembly1.cif.gz_B x-ray structure of the rna-binding protein she2p 0.5079 6 102
5znd-assembly1.cif.gz_A 8-mer nanotube derived from 24-mer rhuhf nanocage 0.4995 2 67
7sel-assembly1.cif.gz_B e. coli msba in complex with lps and inhibitor g7090 (compound 3) 0.4916 4 92
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4774 1 115
6z0c-assembly4.cif.gz_D structure of in silico modelled artificial maquette-3 protein 0.4599 2 115
ID Description Score Start End Superfamily
af_Q9N4P4_40_210_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7326 3 114 1.20.120.550
af_Q9N4P4_40_210_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6959 3 114 1.20.120.550
af_P75685_2_182_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.661 3 116 1.20.120.550
af_Q9VDI6_16_125_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6421 4 108 1.20.120.550
af_P75685_2_182_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6377 3 116 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A2N5A7T2-F1-model_v4 DUF1304 domain-containing protein 1.005 4 69 GO:0016020
AF-A0A1Q3S578-F1-model_v4 deleted 1.003 2 117
AF-A0A1V5FX76-F1-model_v4 DUF1304 domain-containing protein 1.003 2 115 GO:0016020
AF-A0A1T4XX38-F1-model_v4 Putative membrane protein 1.002 2 115 GO:0016020
AF-A0A829SAE4-F1-model_v4 DUF1304 domain-containing protein 1.002 6 66 GO:0016020

Feature Viewer

pLDDT pTM Quality
97.41 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map