metagRoot

F461773

General Info

Members	Datasets	Scaffolds	Average Seq Length
544	256	533	228

Family's Representative Sequence

Representative Sequence	3300046539\|Ga0495621_0046961\|Ga0495621_0046961_596_1396
Length	266
Sequence	MRDNRCQSNDRQGPTATHLVSGAVGGKQRRDRDNGATGGARLELDNPFWSSLTTRHRDVALRLGDVARFPSNYAPFLGIADASVDVATAVDRLVAPGESVYLLGVAPQRIPDGWRLDAFADLAQMICTTPIDVVEGPEIIRLTQAHRADVLALTALVYPHYFRARTMELGRYFGIYQDGRLAAMIGERLGMDGLQEMSAICTHPDFNGRGLARRLTAWLTNETLTLGRTPFLHVSHENIRAKRLYEQLGYRYRRKIPFWSLRRTGR

Samples

	Sample ID	Description	Type	Environment
1	2524614729	Arenimonas oryziterrae YC6267, DSM 21050	Isolate	Rhizosphere
2	2571042365	Lysobacter oryzae DSM 21044	Isolate	Rhizosphere
3	2627854209	Arenimonas oryziterrae YC6267, DSM 21050	Isolate	Rhizosphere
4	2643221579	Pseudoxanthomonas sp. Root630	Isolate	Unclassified
5	2643221581	Pseudoxanthomonas sp. Root65	Isolate	Unclassified
6	2643221593	Lysobacter sp. Root690	Isolate	Unclassified
7	2643221695	Lysobacter sp. Root494	Isolate	Unclassified
8	2939611941	Rhodanobacter soli 1757	Isolate	Rhizosphere
9	2941489479	Lysobacter enzymogenes 2943	Isolate	Rhizosphere
10	2995948881	Lysobacter enzymogenes B25	Isolate	Unclassified
11	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
12	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
13	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
14	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
15	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
16	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
17	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
18	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
19	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
20	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
21	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
22	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
23	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
24	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
25	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
26	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
27	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
28	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
29	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
30	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
31	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
32	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
33	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
34	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
35	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
36	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
37	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
38	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
39	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
40	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
41	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
42	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
43	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
44	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
45	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
46	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
47	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
48	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
49	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
50	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
51	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
52	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
53	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
54	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
55	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
56	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
57	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
58	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
59	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
60	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
61	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
62	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
63	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
64	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
65	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
66	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
67	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
68	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
69	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
71	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
72	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
73	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
74	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
75	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
76	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
77	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
78	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
79	3300009979	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG	Metagenome	Rhizosphere
80	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
81	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
82	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
83	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
84	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
85	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
86	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
87	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
88	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
89	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
90	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
91	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
92	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
93	3300015689	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02	Metagenome	Rhizosphere
94	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
95	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
96	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
97	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
98	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
100	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
101	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
102	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
103	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
104	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
105	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
106	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
107	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
108	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
109	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
110	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
111	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
112	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
113	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
159	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
160	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
161	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
162	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
163	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
164	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
165	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
166	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
167	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
168	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
169	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
170	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
171	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
172	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
173	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
174	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
175	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
176	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
177	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
178	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
179	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
180	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
181	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
182	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
183	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
184	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
185	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
186	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
187	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
188	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
189	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
190	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
191	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
192	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
193	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
194	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
195	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
196	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
197	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
198	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
199	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
200	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
201	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
202	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
203	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
204	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
205	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
206	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
207	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
208	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
209	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
210	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
211	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
212	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
213	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
214	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
215	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
216	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
217	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
218	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
219	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
220	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
221	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
222	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
223	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
224	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
225	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
226	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
227	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
228	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
229	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
230	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
231	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
232	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
233	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
234	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
235	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
236	3300049682	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought	Metagenome	Rhizosphere
237	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
238	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
239	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
240	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
241	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
242	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
243	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
244	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
245	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
246	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
247	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
248	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
249	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
250	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
251	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
252	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
253	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
254	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
255	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
256	8002869464	Pseudoxanthomonas helianthi 110414	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	97.79
Metatranscriptomes	0.18
Isolates	2.02

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	12.68
Nodule	0
Rhizoplane	2.21
Rhizosphere	79.6
Stem	0
Stem Tuber	0
Unclassified	5.51

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25162J39368_1000220	3300002737	Bacteria	59297
2	JGI25162J39368_1000531	3300002737	Bacteria	28374
3	JGI25157J39369_1000715	3300002741	Bacteria	17822
4	JGI25164J39214_1000189	3300002772	Bacteria	54411
5	JGI25151J46595_10000119	3300003187	Bacteria	106415
6	JGI25151J46595_10026240	3300003187	Bacteria	2355
7	JGI25165J46597_1000324	3300003214	Bacteria	57596
8	JGI25165J46597_1001943	3300003214	Bacteria	8146
9	rootH2_10163522	3300003320	Bacteria	1475
10	Ga0055526_1005975	3300003771	Bacteria	6770
11	Ga0055537_1002039	3300003773	Bacteria	7147
12	Ga0055524_1004154	3300003775	Bacteria	6770
13	Ga0055536_1000779	3300003781	Bacteria	21255
14	Ga0055536_1014830	3300003781	Bacteria	2706
15	Ga0055534_1002196	3300003784	Bacteria	6947
16	Ga0055528_1004432	3300003790	Bacteria	6770
17	Ga0055531_10002454	3300003794	Bacteria	12389
18	Ga0055531_10030520	3300003794	Bacteria	1807
19	Ga0055531_10034430	3300003794	Bacteria	1607
20	Ga0065704_10070483	3300005289	Bacteria	22916
21	Ga0065704_10276436	3300005289	Bacteria	932
22	Ga0065715_10006303	3300005293	Bacteria	3553
23	Ga0065715_10056094	3300005293	Bacteria	976
24	Ga0070683_100195481	3300005329	Bacteria	1920
25	Ga0070683_100435493	3300005329	Bacteria	1251
26	Ga0070683_100614741	3300005329	Unclassified	1040
27	Ga0070670_100042074	3300005331	Bacteria	3926
28	Ga0070670_100195416	3300005331	Bacteria	1757
29	Ga0068869_100002466	3300005334	Bacteria	11157
30	Ga0070666_10000619	3300005335	Bacteria	21309
31	Ga0070666_10006126	3300005335	Bacteria	7391
32	Ga0070666_10064441	3300005335	Bacteria	2485
33	Ga0070680_100151764	3300005336	Bacteria	1945
34	Ga0070680_100867974	3300005336	Bacteria	778
35	Ga0068868_100028195	3300005338	Bacteria	4290
36	Ga0068868_100719844	3300005338	Bacteria	894
37	Ga0070660_100125913	3300005339	Bacteria	2047
38	Ga0070660_100152677	3300005339	Bacteria	1857
39	Ga0070660_100308851	3300005339	Unclassified	1297
40	Ga0070661_100002060	3300005344	Bacteria	13844
41	Ga0070661_100410851	3300005344	Bacteria	1071
42	Ga0070692_10000986	3300005345	Bacteria	9742
43	Ga0070668_100009565	3300005347	Bacteria	7192
44	Ga0070669_100010148	3300005353	Bacteria	6696
45	Ga0070671_100043118	3300005355	Bacteria	3750
46	Ga0070671_100071022	3300005355	Bacteria	2905
47	Ga0070674_100255971	3300005356	Bacteria	1377
48	Ga0070673_100073512	3300005364	Bacteria	2752
49	Ga0070659_100039144	3300005366	Bacteria	3700
50	Ga0070659_100470896	3300005366	Unclassified	1068
51	Ga0070667_100000173	3300005367	Bacteria	79829
52	Ga0070667_100072779	3300005367	Bacteria	2929
53	Ga0070667_100082714	3300005367	Bacteria	2749
54	Ga0070714_100000034	3300005435	Bacteria	130742
55	Ga0070713_100062831	3300005436	Bacteria	3111
56	Ga0070705_100074454	3300005440	Bacteria	2064
57	Ga0070708_100298380	3300005445	Bacteria	1517
58	Ga0070663_100020652	3300005455	Bacteria	4364
59	Ga0070663_100247521	3300005455	Bacteria	1410
60	Ga0070663_100445292	3300005455	Bacteria	1066
61	Ga0070663_100673656	3300005455	Bacteria	877
62	Ga0070678_100096571	3300005456	Bacteria	2280
63	Ga0070662_100020554	3300005457	Bacteria	4498
64	Ga0070662_100119581	3300005457	Bacteria	2018
65	Ga0070681_10129370	3300005458	Bacteria	2457
66	Ga0070681_10158982	3300005458	Bacteria	2183
67	Ga0070679_100007871	3300005530	Bacteria	9993
68	Ga0070679_100092500	3300005530	Bacteria	3012
69	Ga0070679_100189926	3300005530	Bacteria	2024
70	Ga0070679_100400525	3300005530	Bacteria	1318
71	Ga0070679_100457610	3300005530	Unclassified	1221
72	Ga0070679_100524980	3300005530	Bacteria	1128
73	Ga0070684_100741892	3300005535	Bacteria	916
74	Ga0068853_100000582	3300005539	Bacteria	24978
75	Ga0068853_100001459	3300005539	Bacteria	17148
76	Ga0068853_100030836	3300005539	Bacteria	4530
77	Ga0068853_100107710	3300005539	Bacteria	2471
78	Ga0068853_100220623	3300005539	Bacteria	1731
79	Ga0068853_100565733	3300005539	Bacteria	1078
80	Ga0070672_100046752	3300005543	Bacteria	3354
81	Ga0070696_100001877	3300005546	Bacteria	13789
82	Ga0070696_100107058	3300005546	Bacteria	2010
83	Ga0070693_100188565	3300005547	Bacteria	1332
84	Ga0070665_100000108	3300005548	Bacteria	155204
85	Ga0070665_100001653	3300005548	Bacteria	25685
86	Ga0070665_100080904	3300005548	Bacteria	3254
87	Ga0070665_100163290	3300005548	Bacteria	2229
88	Ga0070665_100332981	3300005548	Bacteria	1523
89	Ga0068855_100074514	3300005563	Bacteria	3941
90	Ga0068855_100237159	3300005563	Bacteria	2039
91	Ga0068855_100703441	3300005563	Unclassified	1081
92	Ga0068857_100015183	3300005577	Bacteria	6719
93	Ga0068857_100032855	3300005577	Bacteria	4586
94	Ga0068857_100299406	3300005577	Bacteria	1482
95	Ga0068856_100134952	3300005614	Bacteria	2473
96	Ga0068856_100348480	3300005614	Bacteria	1499
97	Ga0068856_100359151	3300005614	Bacteria	1475
98	Ga0068852_100021206	3300005616	Bacteria	5181
99	Ga0068852_100076379	3300005616	Bacteria	2957
100	Ga0068852_100832390	3300005616	Unclassified	938
101	Ga0068864_100042958	3300005618	Bacteria	3869
102	Ga0068864_100063871	3300005618	Bacteria	3192
103	Ga0068861_100296158	3300005719	Bacteria	1399
104	Ga0068851_10021504	3300005834	Bacteria	3132
105	Ga0068851_10056347	3300005834	Bacteria	2004
106	Ga0068863_100015895	3300005841	Bacteria	7218
107	Ga0068863_100082253	3300005841	Bacteria	3051
108	Ga0068863_100221888	3300005841	Bacteria	1821
109	Ga0068863_101182373	3300005841	Bacteria	770
110	Ga0068858_100010839	3300005842	Bacteria	8617
111	Ga0068858_100069331	3300005842	Bacteria	3268
112	Ga0068858_100126786	3300005842	Bacteria	2391
113	Ga0068858_100342802	3300005842	Unclassified	1430
114	Ga0068858_100343491	3300005842	Bacteria	1429
115	Ga0068860_100034421	3300005843	Bacteria	4858
116	Ga0068862_100302337	3300005844	Bacteria	1472
117	Ga0070716_100276150	3300006173	Bacteria	1157
118	Ga0097621_100012312	3300006237	Bacteria	6334
119	Ga0097621_100035176	3300006237	Bacteria	4001
120	Ga0097621_100082797	3300006237	Bacteria	2672
121	Ga0068871_100021755	3300006358	Bacteria	4935
122	Ga0068871_100121991	3300006358	Bacteria	2202
123	Ga0068871_100276255	3300006358	Bacteria	1468
124	Ga0068865_100009063	3300006881	Bacteria	6155
125	Ga0068865_100449656	3300006881	Bacteria	1065
126	Ga0105240_10000617	3300009093	Bacteria	65935
127	Ga0105240_10003405	3300009093	Bacteria	24740
128	Ga0105240_10038090	3300009093	Bacteria	6172
129	Ga0105240_10039225	3300009093	Bacteria	6067
130	Ga0105240_10337647	3300009093	Bacteria	1712
131	Ga0105240_10764332	3300009093	Bacteria	1049
132	Ga0105245_10126176	3300009098	Bacteria	2396
133	Ga0105245_10243788	3300009098	Bacteria	1743
134	Ga0105245_11114908	3300009098	Unclassified	836
135	Ga0105241_10007340	3300009174	Bacteria	8106
136	Ga0105241_10031428	3300009174	Bacteria	3976
137	Ga0105241_10110986	3300009174	Bacteria	2195
138	Ga0105241_10246894	3300009174	Bacteria	1512
139	Ga0105241_10554866	3300009174	Bacteria	1032
140	Ga0105241_10944240	3300009174	Bacteria	803
141	Ga0105248_10000216	3300009177	Bacteria	66621
142	Ga0105248_10019787	3300009177	Bacteria	7455
143	Ga0105248_10050859	3300009177	Bacteria	4649
144	Ga0105248_10430077	3300009177	Unclassified	1487
145	Ga0105237_10006699	3300009545	Bacteria	12732
146	Ga0105237_10010519	3300009545	Bacteria	9831
147	Ga0105237_10066335	3300009545	Bacteria	3604
148	Ga0105237_10133210	3300009545	Bacteria	2480
149	Ga0105237_10413058	3300009545	Bacteria	1355
150	Ga0105237_10460326	3300009545	Bacteria	1278
151	Ga0105238_10000891	3300009551	Bacteria	30711
152	Ga0105238_10002280	3300009551	Bacteria	19335
153	Ga0105238_10059566	3300009551	Bacteria	3825
154	Ga0105238_10334526	3300009551	Bacteria	1502
155	Ga0105249_10000175	3300009553	Bacteria	74934
156	Ga0105249_10442474	3300009553	Bacteria	1337
157	Ga0105032_100462	3300009979	Bacteria	4047
158	Ga0105239_10004787	3300010375	Bacteria	16060
159	Ga0105239_10127687	3300010375	Bacteria	2827
160	Ga0105239_10137528	3300010375	Bacteria	2720
161	Ga0105239_10160444	3300010375	Bacteria	2512
162	Ga0105239_10346607	3300010375	Bacteria	1677
163	Ga0157371_10050654	3300013102	Bacteria	2951
164	Ga0157370_10007668	3300013104	Bacteria	11710
165	Ga0157370_10193260	3300013104	Bacteria	1889
166	Ga0157370_10557789	3300013104	Unclassified	1050
167	Ga0157369_10017409	3300013105	Bacteria	8075
168	Ga0157369_10032262	3300013105	Bacteria	5762
169	Ga0157369_10069831	3300013105	Bacteria	3774
170	Ga0157369_10166441	3300013105	Bacteria	2325
171	Ga0157374_10031993	3300013296	Bacteria	4786
172	Ga0157374_10053757	3300013296	Bacteria	3755
173	Ga0157374_10498168	3300013296	Bacteria	1223
174	Ga0157378_10000373	3300013297	Bacteria	44286
175	Ga0157378_10432014	3300013297	Bacteria	1303
176	Ga0157378_10848553	3300013297	Unclassified	942
177	Ga0157372_10000470	3300013307	Bacteria	44468
178	Ga0157372_10072804	3300013307	Bacteria	3873
179	Ga0157372_10108252	3300013307	Bacteria	3180
180	Ga0157372_10133552	3300013307	Bacteria	2857
181	Ga0157372_10134958	3300013307	Bacteria	2841
182	Ga0157375_10024977	3300013308	Bacteria	5541
183	Ga0157375_10192827	3300013308	Bacteria	2192
184	Ga0163163_10005908	3300014325	Bacteria	10650
185	Ga0163163_10354267	3300014325	Bacteria	1524
186	Ga0182008_10026445	3300014497	Bacteria	2943
187	Ga0182008_10042736	3300014497	Bacteria	2257
188	Ga0157379_10028085	3300014968	Bacteria	5008
189	Ga0157376_10032870	3300014969	Bacteria	4169
190	Ga0157376_10299488	3300014969	Bacteria	1522
191	Ga0182007_10004085	3300015262	Bacteria	6717
192	Ga0183360_10001	3300015689	Bacteria	3943671
193	Ga0163161_10172996	3300017792	Bacteria	1652
194	Ga0206353_11461609	3300020082	Bacteria	1541
195	Ga0209674_101127	3300025226	Bacteria	7810
196	Ga0207427_100050	3300025231	Bacteria	227233
197	Ga0207427_100166	3300025231	Bacteria	73732
198	Ga0209437_100120	3300025233	Bacteria	205054
199	Ga0209437_100288	3300025233	Bacteria	73732
200	Ga0209258_108816	3300025242	Bacteria	1390
201	Ga0207425_1001498	3300025245	Bacteria	9689
202	Ga0207425_1008111	3300025245	Bacteria	2715
203	Ga0209026_1000157	3300025250	Bacteria	106621
204	Ga0209233_1000174	3300025261	Bacteria	144639
205	Ga0209233_1000184	3300025261	Bacteria	134246
206	Ga0209233_1000284	3300025261	Bacteria	69746
207	Ga0209565_1000034	3300025263	Bacteria	312950
208	Ga0209565_1003168	3300025263	Bacteria	5466
209	Ga0209673_1000039	3300025273	Bacteria	312950
210	Ga0209673_1004642	3300025273	Bacteria	7268
211	Ga0209130_1005684	3300025284	Bacteria	4256
212	Ga0209675_1000023	3300025291	Bacteria	312950
213	Ga0209675_1018848	3300025291	Bacteria	1918
214	Ga0209676_1000156	3300025292	Bacteria	163255
215	Ga0209676_1000609	3300025292	Bacteria	52392
216	Ga0209676_1000997	3300025292	Bacteria	33277
217	Ga0209676_1003263	3300025292	Bacteria	10199
218	Ga0209676_1011489	3300025292	Bacteria	3564
219	Ga0209025_1000023	3300025294	Bacteria	541307
220	Ga0209025_1001558	3300025294	Bacteria	29124
221	Ga0209025_1010320	3300025294	Bacteria	6344
222	Ga0209025_1027161	3300025294	Bacteria	2847
223	Ga0209564_1000066	3300025295	Bacteria	312899
224	Ga0209564_1009585	3300025295	Bacteria	4585
225	Ga0209758_1015639	3300025297	Bacteria	3913
226	Ga0209050_1001956	3300025298	Bacteria	19502
227	Ga0209256_1000048	3300025299	Bacteria	312899
228	Ga0209256_1001108	3300025299	Bacteria	30822
229	Ga0209256_1002473	3300025299	Bacteria	14993
230	Ga0209256_1003294	3300025299	Bacteria	11514
231	Ga0209257_1000298	3300025304	Bacteria	109259
232	Ga0209257_1000302	3300025304	Bacteria	108038
233	Ga0209257_1000875	3300025304	Bacteria	42688
234	Ga0209257_1001201	3300025304	Bacteria	32534
235	Ga0209257_1003611	3300025304	Bacteria	13037
236	Ga0209257_1014318	3300025304	Bacteria	3416
237	Ga0207656_10017833	3300025321	Bacteria	2786
238	Ga0207656_10045941	3300025321	Bacteria	1871
239	Ga0207680_10000148	3300025903	Bacteria	33877
240	Ga0207680_10007027	3300025903	Bacteria	5467
241	Ga0207680_10078248	3300025903	Bacteria	2071
242	Ga0207680_10116998	3300025903	Bacteria	1738
243	Ga0207647_10000531	3300025904	Bacteria	30409
244	Ga0207647_10003010	3300025904	Bacteria	12671
245	Ga0207647_10008779	3300025904	Bacteria	7215
246	Ga0207705_10007388	3300025909	Bacteria	8080
247	Ga0207705_10219933	3300025909	Bacteria	1442
248	Ga0207654_10008265	3300025911	Bacteria	5255
249	Ga0207654_10246536	3300025911	Bacteria	1196
250	Ga0207654_10368113	3300025911	Bacteria	993
251	Ga0207707_10050825	3300025912	Bacteria	3610
252	Ga0207707_10067026	3300025912	Bacteria	3126
253	Ga0207695_10000032	3300025913	Bacteria	521283
254	Ga0207695_10000182	3300025913	Bacteria	184125
255	Ga0207695_10015858	3300025913	Bacteria	8851
256	Ga0207695_10024106	3300025913	Bacteria	6854
257	Ga0207695_10024600	3300025913	Bacteria	6767
258	Ga0207695_10350770	3300025913	Bacteria	1363
259	Ga0207695_10391808	3300025913	Bacteria	1274
260	Ga0207671_10007772	3300025914	Bacteria	9235
261	Ga0207671_10091259	3300025914	Bacteria	2295
262	Ga0207693_10269893	3300025915	Bacteria	1333
263	Ga0207660_10141755	3300025917	Bacteria	1838
264	Ga0207660_10275660	3300025917	Bacteria	1333
265	Ga0207660_10749988	3300025917	Bacteria	797
266	Ga0207657_10021415	3300025919	Bacteria	6084
267	Ga0207657_10048742	3300025919	Bacteria	3697
268	Ga0207657_10089572	3300025919	Bacteria	2570
269	Ga0207657_10128798	3300025919	Bacteria	2076
270	Ga0207657_10190269	3300025919	Bacteria	1656
271	Ga0207649_10002944	3300025920	Bacteria	9370
272	Ga0207649_10011254	3300025920	Bacteria	4928
273	Ga0207649_10077880	3300025920	Bacteria	2138
274	Ga0207652_10013559	3300025921	Bacteria	6592
275	Ga0207652_10122165	3300025921	Bacteria	2318
276	Ga0207652_10491391	3300025921	Bacteria	1105
277	Ga0207681_10052359	3300025923	Bacteria	2768
278	Ga0207694_10000361	3300025924	Bacteria	42849
279	Ga0207694_10000821	3300025924	Bacteria	27776
280	Ga0207694_10659885	3300025924	Bacteria	881
281	Ga0207650_10029221	3300025925	Bacteria	3961
282	Ga0207687_10329351	3300025927	Bacteria	1238
283	Ga0207700_10009046	3300025928	Bacteria	6200
284	Ga0207664_10000021	3300025929	Bacteria	216875
285	Ga0207644_10086102	3300025931	Bacteria	2332
286	Ga0207690_10003672	3300025932	Bacteria	9135
287	Ga0207690_10005103	3300025932	Bacteria	7752
288	Ga0207690_10080688	3300025932	Bacteria	2271
289	Ga0207690_10152114	3300025932	Bacteria	1716
290	Ga0207706_10025355	3300025933	Bacteria	5313
291	Ga0207706_10027066	3300025933	Bacteria	5129
292	Ga0207704_10028975	3300025938	Bacteria	3080
293	Ga0207691_10000184	3300025940	Bacteria	59044
294	Ga0207711_10004262	3300025941	Bacteria	12220
295	Ga0207711_10020071	3300025941	Bacteria	5569
296	Ga0207711_10129830	3300025941	Bacteria	2258
297	Ga0207711_10823779	3300025941	Bacteria	864
298	Ga0207689_10050335	3300025942	Bacteria	3435
299	Ga0207689_10129469	3300025942	Bacteria	2077
300	Ga0207667_10000799	3300025949	Bacteria	40827
301	Ga0207667_10059655	3300025949	Bacteria	3995
302	Ga0207667_10159993	3300025949	Bacteria	2316
303	Ga0207667_10254952	3300025949	Bacteria	1795
304	Ga0207667_10565034	3300025949	Unclassified	1150
305	Ga0207712_10000165	3300025961	Bacteria	68118
306	Ga0207712_10000548	3300025961	Bacteria	30382
307	Ga0207668_10234615	3300025972	Bacteria	1481
308	Ga0207640_10317252	3300025981	Bacteria	1239
309	Ga0207658_10000148	3300025986	Bacteria	73530
310	Ga0207658_10009250	3300025986	Bacteria	6683
311	Ga0207658_10032566	3300025986	Bacteria	3711
312	Ga0207677_10804168	3300026023	Bacteria	842
313	Ga0207703_10002398	3300026035	Bacteria	16292
314	Ga0207703_10019400	3300026035	Bacteria	5312
315	Ga0207703_10034650	3300026035	Bacteria	4007
316	Ga0207703_10096245	3300026035	Bacteria	2499
317	Ga0207703_10278707	3300026035	Bacteria	1518
318	Ga0207639_10000464	3300026041	Bacteria	27922
319	Ga0207639_10001201	3300026041	Bacteria	17585
320	Ga0207639_10169751	3300026041	Bacteria	1846
321	Ga0207639_10441201	3300026041	Bacteria	1180
322	Ga0207639_10807778	3300026041	Bacteria	874
323	Ga0207639_11196684	3300026041	Bacteria	713
324	Ga0207678_10037461	3300026067	Bacteria	4217
325	Ga0207678_10052373	3300026067	Bacteria	3522
326	Ga0207678_10058750	3300026067	Bacteria	3309
327	Ga0207702_10092609	3300026078	Bacteria	2649
328	Ga0207702_10106489	3300026078	Bacteria	2484
329	Ga0207641_10015099	3300026088	Bacteria	6328
330	Ga0207641_10091872	3300026088	Bacteria	2657
331	Ga0207676_10031333	3300026095	Bacteria	3999
332	Ga0207674_10018202	3300026116	Bacteria	7644
333	Ga0207674_10042709	3300026116	Bacteria	4680
334	Ga0207674_10195326	3300026116	Bacteria	1973
335	Ga0207675_100336493	3300026118	Bacteria	1477
336	Ga0207683_10120050	3300026121	Bacteria	2359
337	Ga0207698_10083674	3300026142	Bacteria	2583
338	Ga0207698_10172109	3300026142	Bacteria	1908
339	Ga0268266_10000001	3300028379	Bacteria	4040580
340	Ga0268266_10000006	3300028379	Bacteria	1410021
341	Ga0268266_10006584	3300028379	Bacteria	10612
342	Ga0268266_10033436	3300028379	Bacteria	4372
343	Ga0268264_10014391	3300028381	Bacteria	6503
344	Ga0307515_10251204	3300028794	Bacteria	1521
345	Ga0316177_1124450	3300030731	Bacteria	2298
346	Ga0307513_10125223	3300031456	Bacteria	2526
347	Ga0307513_10245834	3300031456	Bacteria	1590
348	Ga0307408_100128069	3300031548	Bacteria	1977
349	Ga0307408_100202844	3300031548	Bacteria	1606
350	Ga0307408_100275701	3300031548	Bacteria	1398
351	Ga0307405_10541386	3300031731	Bacteria	940
352	Ga0307413_10081821	3300031824	Bacteria	2072
353	Ga0307413_10222616	3300031824	Bacteria	1379
354	Ga0307413_10247106	3300031824	Bacteria	1321
355	Ga0307413_10461616	3300031824	Bacteria	1010
356	Ga0307410_10340285	3300031852	Bacteria	1196
357	Ga0307406_10041397	3300031901	Bacteria	2870
358	Ga0307406_10047174	3300031901	Bacteria	2714
359	Ga0307407_10215956	3300031903	Bacteria	1294
360	Ga0307407_10524750	3300031903	Bacteria	871
361	Ga0307416_100056828	3300032002	Bacteria	3161
362	Ga0307416_100058786	3300032002	Bacteria	3120
363	Ga0307416_100727222	3300032002	Bacteria	1084
364	Ga0307416_101282100	3300032002	Bacteria	838
365	Ga0307414_10003710	3300032004	Bacteria	8188
366	Ga0307414_10005928	3300032004	Bacteria	6767
367	Ga0307414_10011702	3300032004	Bacteria	5156
368	Ga0307414_10022154	3300032004	Bacteria	4002
369	Ga0307414_10090763	3300032004	Bacteria	2268
370	Ga0307414_10142673	3300032004	Bacteria	1877
371	Ga0307414_10319178	3300032004	Bacteria	1321
372	Ga0307415_100194347	3300032126	Bacteria	1604
373	Ga0307415_100393397	3300032126	Bacteria	1181
374	Ga0307507_10257809	3300033179	Bacteria	1117
375	Ga0395899_0052075	3300037312	Bacteria	3036
376	Ga0395900_0117642	3300037418	Bacteria	2727
377	Ga0395905_0000953	3300037471	Bacteria	37129
378	Ga0395905_0024904	3300037471	Bacteria	5646
379	Ga0395905_0042074	3300037471	Bacteria	4286
380	Ga0395905_0168888	3300037471	Bacteria	2055
381	Ga0395901_0040176	3300038443	Bacteria	4844
382	Ga0237816_00050	3300039145	Bacteria	7736
383	Ga0439436_0046859	3300041404	Bacteria	1228
384	Ga0439461_0006250	3300041410	Bacteria	2068
385	Ga0439465_0000415	3300041413	Bacteria	12465
386	Ga0439465_0001341	3300041413	Bacteria	7917
387	Ga0451791_0190050	3300041451	Bacteria	9273
388	Ga0451791_0440994	3300041451	Bacteria	2693
389	Ga0451795_0602903	3300041456	Bacteria	1264
390	Ga0451802_1150257	3300041460	Bacteria	2230
391	Ga0451807_0468952	3300041486	Bacteria	6523
392	Ga0451837_0037703	3300041494	Bacteria	6747
393	Ga0451851_0193987	3300041507	Bacteria	1394
394	Ga0451843_0013366	3300041509	Bacteria	1828
395	Ga0451843_0334519	3300041509	Bacteria	1882
396	Ga0451853_2254292	3300041512	Bacteria	4869
397	Ga0439437_003868	3300042000	Bacteria	1620
398	Ga0439445_0001852	3300042004	Bacteria	4652
399	Ga0439445_0070034	3300042004	Bacteria	969
400	Ga0439448_0044683	3300042005	Bacteria	1441
401	Ga0439432_001933	3300042006	Bacteria	7824
402	Ga0439432_021759	3300042006	Bacteria	2122
403	Ga0439432_049219	3300042006	Bacteria	1318
404	Ga0439432_052672	3300042006	Bacteria	1267
405	Ga0439449_0000038	3300042007	Bacteria	39365
406	Ga0439449_0004075	3300042007	Bacteria	5656
407	Ga0439449_0006573	3300042007	Bacteria	4442
408	Ga0439449_0015313	3300042007	Bacteria	2881
409	Ga0439449_0021016	3300042007	Bacteria	2445
410	Ga0439449_0029669	3300042007	Bacteria	2038
411	Ga0439449_0067001	3300042007	Bacteria	1324
412	Ga0439449_0127698	3300042007	Bacteria	944
413	Ga0439457_112017	3300042014	Bacteria	641
414	Ga0439446_0097410	3300042156	Bacteria	927
415	Ga0466972_0001512	3300044658	Bacteria	11316
416	Ga0453683_0042432	3300044673	Bacteria	2856
417	Ga0466961_0251698	3300044693	Bacteria	1085
418	Ga0466970_0001381	3300044765	Bacteria	11692
419	Ga0466967_0523933	3300045976	Bacteria	1165
420	Ga0466967_0752888	3300045976	Bacteria	966
421	Ga0495638_0084314	3300046460	Bacteria	1923
422	Ga0495663_0031910	3300046525	Bacteria	1566
423	Ga0495663_0137511	3300046525	Bacteria	827
424	Ga0495598_0167886	3300046537	Unclassified	776
425	Ga0495621_0004992	3300046539	Bacteria	3781
426	Ga0495621_0046961	3300046539	Bacteria	1534
427	Ga0495622_0096080	3300046557	Bacteria	1360
428	Ga0495656_0044973	3300046615	Bacteria	1862
429	Ga0495657_0266906	3300046675	Bacteria	1027
430	Ga0495647_0023712	3300046681	Bacteria	2228
431	Ga0495671_0007975	3300046692	Bacteria	5985
432	Ga0495636_0007841	3300047318	Bacteria	4203
433	Ga0495636_0012311	3300047318	Bacteria	3387
434	Ga0495636_0045753	3300047318	Bacteria	1824
435	Ga0495636_0103218	3300047318	Bacteria	1248
436	Ga0495674_0318298	3300047319	Bacteria	1268
437	Ga0496101_0141749	3300048904	Unclassified	1832
438	Ga0496101_0591429	3300048904	Bacteria	877
439	Ga0496108_0169379	3300048911	Unclassified	1889
440	Ga0496109_0101041	3300048912	Bacteria	2676
441	Ga0496109_0148292	3300048912	Bacteria	2196
442	Ga0496113_0041912	3300048916	Bacteria	3380
443	Ga0496114_0145046	3300048917	Bacteria	2057
444	Ga0496117_0030857	3300048920	Bacteria	4103
445	Ga0496118_0001109	3300048921	Bacteria	41808
446	Ga0496118_0012333	3300048921	Bacteria	8224
447	Ga0496121_0001499	3300048924	Bacteria	39243
448	Ga0496121_0220531	3300048924	Bacteria	1336
449	Ga0496122_0000129	3300048925	Bacteria	173688
450	Ga0496122_0011484	3300048925	Bacteria	8959
451	Ga0496123_0000113	3300048926	Bacteria	163689
452	Ga0496123_0022874	3300048926	Bacteria	4802
453	Ga0496126_0003777	3300048929	Bacteria	18804
454	Ga0496126_0376798	3300048929	Bacteria	1156
455	Ga0501032_0003860	3300049569	Bacteria	11378
456	Ga0501032_0040696	3300049569	Bacteria	3158
457	Ga0501032_0165764	3300049569	Bacteria	1450
458	Ga0501033_0000720	3300049570	Bacteria	30337
459	Ga0501034_0000221	3300049571	Bacteria	108958
460	Ga0501034_0002656	3300049571	Bacteria	21160
461	Ga0501034_0004188	3300049571	Bacteria	16100
462	Ga0501034_0019666	3300049571	Bacteria	6904
463	Ga0501034_0357896	3300049571	Bacteria	1387
464	Ga0501034_0513763	3300049571	Bacteria	1110
465	Ga0501036_0004881	3300049572	Bacteria	10832
466	Ga0501037_0002331	3300049573	Bacteria	13712
467	Ga0501038_0004437	3300049574	Bacteria	13039
468	Ga0501038_0024061	3300049574	Bacteria	5436
469	Ga0501038_0495811	3300049574	Bacteria	934
470	Ga0501039_0039145	3300049575	Bacteria	3661
471	Ga0501043_0054877	3300049579	Bacteria	3130
472	Ga0501043_0158173	3300049579	Bacteria	1771
473	Ga0501046_0006002	3300049580	Bacteria	10805
474	Ga0501046_0219047	3300049580	Bacteria	1410
475	Ga0501047_0002257	3300049581	Bacteria	18451
476	Ga0501047_0022557	3300049581	Bacteria	6044
477	Ga0501047_0031434	3300049581	Bacteria	5120
478	Ga0501047_0037818	3300049581	Bacteria	4667
479	Ga0501047_0091521	3300049581	Bacteria	2920
480	Ga0501047_0353910	3300049581	Bacteria	1305
481	Ga0501047_0407810	3300049581	Bacteria	1192
482	Ga0501068_0015958	3300049584	Bacteria	4326
483	Ga0501068_0489343	3300049584	Bacteria	797
484	Ga0501069_0050267	3300049585	Bacteria	2318
485	Ga0501069_0090039	3300049585	Bacteria	1735
486	Ga0501069_0124790	3300049585	Bacteria	1472
487	Ga0501070_0003389	3300049586	Bacteria	13830
488	Ga0501070_0020177	3300049586	Bacteria	5591
489	Ga0501070_0036899	3300049586	Bacteria	4081
490	Ga0501070_0044102	3300049586	Bacteria	3711
491	Ga0501070_0045322	3300049586	Bacteria	3657
492	Ga0501070_0056112	3300049586	Bacteria	3265
493	Ga0501070_0110305	3300049586	Bacteria	2274
494	Ga0501070_0425185	3300049586	Bacteria	1072
495	Ga0501070_0494395	3300049586	Bacteria	983
496	Ga0501073_0003125	3300049589	Bacteria	12413
497	Ga0501073_0033753	3300049589	Bacteria	3642
498	Ga0501074_0001543	3300049590	Bacteria	15568
499	Ga0501074_0016257	3300049590	Bacteria	5404
500	Ga0501074_0082527	3300049590	Bacteria	2305
501	Ga0501252_004542	3300049682	Bacteria	1482
502	Ga0501225_0017701	3300049705	Bacteria	1977
503	Ga0501079_0228563	3300049741	Bacteria	1453
504	Ga0501079_0275748	3300049741	Bacteria	1315
505	Ga0501080_0001894	3300049742	Bacteria	18015
506	Ga0501080_0002682	3300049742	Bacteria	15585
507	Ga0501080_0041260	3300049742	Bacteria	4301
508	Ga0501080_0366570	3300049742	Bacteria	1299
509	Ga0501080_0536298	3300049742	Bacteria	1043
510	Ga0501083_0059836	3300049744	Bacteria	2547
511	Ga0501083_0278645	3300049744	Bacteria	1088
512	Ga0501035_0034893	3300049822	Bacteria	4569
513	Ga0501035_0052455	3300049822	Bacteria	3649
514	Ga0501035_0084326	3300049822	Bacteria	2802
515	Ga0501035_0463381	3300049822	Bacteria	1047
516	Ga0501044_0004235	3300049823	Bacteria	16109
517	Ga0501044_0015961	3300049823	Bacteria	8080
518	Ga0501044_0098561	3300049823	Bacteria	2942
519	nmdc:mga0qj67_175350_c1	3300050509	Unclassified	1741
520	Ga0500610_0000390	3300053079	Bacteria	13341
521	Ga0500643_000685	3300053087	Bacteria	22591
522	Ga0500651_0001012	3300053093	Bacteria	13820
523	Ga0500651_0011133	3300053093	Bacteria	5415
524	Ga0500597_000051	3300053120	Bacteria	23267
525	Ga0500559_0067189	3300053136	Bacteria	1609
526	Ga0500568_0002333	3300053139	Bacteria	11254
527	Ga0500604_0091782	3300053151	Bacteria	993
528	Ga0500620_003503	3300053155	Bacteria	3362
529	Ga0500637_0189963	3300053178	Unclassified	1174
530	Ga0501084_0095893	3300054114	Bacteria	2491
531	Ga0500661_027272	3300055283	Bacteria	1009
532	Ga0501082_0000268	3300060353	Bacteria	45918
533	Ga0501082_0092315	3300060353	Bacteria	2615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025913	Ga0207695_10024106	Ga0207695_100241069	191
2	3300025981	Ga0207640_10317252	Ga0207640_103172522	191
3	3300049742	Ga0501080_0536298	Ga0501080_0536298_38_715	191
4	3300003771	Ga0055526_1005975	Ga0055526_10059754	195
5	3300003773	Ga0055537_1002039	Ga0055537_10020395	195
6	3300003775	Ga0055524_1004154	Ga0055524_10041544	195
7	3300003784	Ga0055534_1002196	Ga0055534_10021964	195
8	3300003790	Ga0055528_1004432	Ga0055528_10044324	195
9	3300025263	Ga0209565_1000034	Ga0209565_1000034117	195
10	3300025273	Ga0209673_1000039	Ga0209673_1000039117	195
11	3300025291	Ga0209675_1000023	Ga0209675_1000023117	195
12	3300025295	Ga0209564_1000066	Ga0209564_1000066156	195
13	3300025299	Ga0209256_1000048	Ga0209256_1000048117	195
14	3300042014	Ga0439457_112017	Ga0439457_112017_14_625	198
15	3300042004	Ga0439445_0070034	Ga0439445_0070034_317_931	201
16	3300044765	Ga0466970_0001381	Ga0466970_0001381_5530_6210	207
17	3300025924	Ga0207694_10659885	Ga0207694_106598852	210
18	3300025949	Ga0207667_10254952	Ga0207667_102549523	211
19	3300005548	Ga0070665_100080904	Ga0070665_1000809044	212
20	3300028379	Ga0268266_10006584	Ga0268266_100065848	212
21	3300045976	Ga0466967_0523933	Ga0466967_0523933_294_1019	212
22	3300048924	Ga0496121_0220531	Ga0496121_0220531_17_670	212
23	3300048929	Ga0496126_0376798	Ga0496126_0376798_491_1144	212
24	3300049586	Ga0501070_0020177	Ga0501070_0020177_1456_2121	212
25	3300049823	Ga0501044_0015961	Ga0501044_0015961_4426_5091	212
26	3300005530	Ga0070679_100457610	Ga0070679_1004576101	217
27	3300044658	Ga0466972_0001512	Ga0466972_0001512_5515_6195	217
28	3300032004	Ga0307414_10011702	Ga0307414_100117023	218
29	3300049581	Ga0501047_0037818	Ga0501047_0037818_3732_4391	218
30	3300049590	Ga0501074_0082527	Ga0501074_0082527_738_1397	218
31	iso_pu_bacteria	2643221579	2643906319	219
32	iso_pu_bacteria	2643221581	2643915341	219
33	iso_pu_bacteria	2643221593	2643973893	220
34	iso_pu_bacteria	2941489479	2941491789	220
35	iso_pu_bacteria	2995948881	2995953087	220
36	iso_pu_bacteria	8002869464	8002869512	220
37	iso_pu_bacteria	2524614729	2525557050	221
38	iso_pu_bacteria	2571042365	2572256156	221
39	iso_pu_bacteria	2627854209	2630648646	221
40	iso_pu_bacteria	2643221695	2644528490	221
41	iso_pu_bacteria	2939611941	2939614601	221
42	3300003320	rootH2_10163522	rootH2_101635222	222
43	3300005329	Ga0070683_100435493	Ga0070683_1004354932	222
44	3300005355	Ga0070671_100071022	Ga0070671_1000710221	222
45	3300005356	Ga0070674_100255971	Ga0070674_1002559711	222
46	3300005530	Ga0070679_100524980	Ga0070679_1005249802	222
47	3300005543	Ga0070672_100046752	Ga0070672_1000467522	222
48	3300005719	Ga0068861_100296158	Ga0068861_1002961582	222
49	3300005841	Ga0068863_101182373	Ga0068863_1011823731	222
50	3300010375	Ga0105239_10137528	Ga0105239_101375283	222
51	3300025940	Ga0207691_10000184	Ga0207691_1000018471	222
52	3300026118	Ga0207675_100336493	Ga0207675_1003364932	222
53	3300026121	Ga0207683_10120050	Ga0207683_101200502	222
54	3300031852	Ga0307410_10340285	Ga0307410_103402852	222
55	3300032004	Ga0307414_10319178	Ga0307414_103191782	222
56	3300046537	Ga0495598_0167886	Ga0495598_0167886_86_760	222
57	3300046539	Ga0495621_0004992	Ga0495621_0004992_1010_1684	222
58	3300048920	Ga0496117_0030857	Ga0496117_0030857_1511_2212	222
59	3300048921	Ga0496118_0001109	Ga0496118_0001109_23350_24051	222
60	3300049571	Ga0501034_0000221	Ga0501034_0000221_60109_60783	222
61	3300050509	nmdc:mga0qj67_175350_c1	nmdc:mga0qj67_175350_c1_191_862	222
62	3300005289	Ga0065704_10070483	Ga0065704_1007048312	223
63	3300005289	Ga0065704_10276436	Ga0065704_102764361	223
64	3300005335	Ga0070666_10000619	Ga0070666_100006199	223
65	3300005440	Ga0070705_100074454	Ga0070705_1000744542	223
66	3300006237	Ga0097621_100012312	Ga0097621_1000123128	223
67	3300009098	Ga0105245_10243788	Ga0105245_102437883	223
68	3300009098	Ga0105245_11114908	Ga0105245_111149081	223
69	3300009177	Ga0105248_10430077	Ga0105248_104300774	223
70	3300025292	Ga0209676_1000156	Ga0209676_1000156122	223
71	3300025903	Ga0207680_10000148	Ga0207680_1000014826	223
72	3300025903	Ga0207680_10078248	Ga0207680_100782481	223
73	3300025927	Ga0207687_10329351	Ga0207687_103293513	223
74	3300025941	Ga0207711_10823779	Ga0207711_108237791	223
75	3300031901	Ga0307406_10041397	Ga0307406_100413972	223
76	3300032004	Ga0307414_10022154	Ga0307414_100221544	223
77	3300037418	Ga0395900_0117642	Ga0395900_0117642_379_1059	223
78	3300037471	Ga0395905_0000953	Ga0395905_0000953_21069_21749	223
79	3300037471	Ga0395905_0024904	Ga0395905_0024904_694_1374	223
80	3300041451	Ga0451791_0190050	Ga0451791_0190050_5719_6411	223
81	3300041451	Ga0451791_0440994	Ga0451791_0440994_1030_1725	223
82	3300041460	Ga0451802_1150257	Ga0451802_1150257_931_1623	223
83	3300041486	Ga0451807_0468952	Ga0451807_0468952_5047_5739	223
84	3300041494	Ga0451837_0037703	Ga0451837_0037703_5857_6549	223
85	3300041509	Ga0451843_0334519	Ga0451843_0334519_374_1066	223
86	3300042005	Ga0439448_0044683	Ga0439448_0044683_518_1192	223
87	3300044673	Ga0453683_0042432	Ga0453683_0042432_1391_2071	223
88	3300044693	Ga0466961_0251698	Ga0466961_0251698_171_935	223
89	3300048904	Ga0496101_0141749	Ga0496101_0141749_401_1081	223
90	3300048911	Ga0496108_0169379	Ga0496108_0169379_439_1119	223
91	3300048912	Ga0496109_0101041	Ga0496109_0101041_816_1496	223
92	3300048916	Ga0496113_0041912	Ga0496113_0041912_1633_2313	223
93	3300048917	Ga0496114_0145046	Ga0496114_0145046_19_699	223
94	3300048929	Ga0496126_0003777	Ga0496126_0003777_4230_4910	223
95	3300049586	Ga0501070_0044102	Ga0501070_0044102_1054_1728	223
96	3300003187	JGI25151J46595_10000119	JGI25151J46595_1000011991	224
97	3300005331	Ga0070670_100042074	Ga0070670_1000420743	224
98	3300005335	Ga0070666_10006126	Ga0070666_100061266	224
99	3300005336	Ga0070680_100151764	Ga0070680_1001517642	224
100	3300005344	Ga0070661_100410851	Ga0070661_1004108511	224
101	3300005367	Ga0070667_100000173	Ga0070667_10000017326	224
102	3300005455	Ga0070663_100020652	Ga0070663_1000206522	224
103	3300005457	Ga0070662_100119581	Ga0070662_1001195811	224
104	3300005458	Ga0070681_10158982	Ga0070681_101589822	224
105	3300005530	Ga0070679_100092500	Ga0070679_1000925002	224
106	3300005539	Ga0068853_100000582	Ga0068853_1000005822	224
107	3300005539	Ga0068853_100220623	Ga0068853_1002206231	224
108	3300005546	Ga0070696_100107058	Ga0070696_1001070581	224
109	3300005548	Ga0070665_100001653	Ga0070665_1000016532	224
110	3300005563	Ga0068855_100074514	Ga0068855_1000745143	224
111	3300005563	Ga0068855_100703441	Ga0068855_1007034412	224
112	3300005577	Ga0068857_100299406	Ga0068857_1002994062	224
113	3300005614	Ga0068856_100134952	Ga0068856_1001349522	224
114	3300005834	Ga0068851_10021504	Ga0068851_100215043	224
115	3300005841	Ga0068863_100221888	Ga0068863_1002218882	224
116	3300005842	Ga0068858_100010839	Ga0068858_1000108395	224
117	3300005842	Ga0068858_100069331	Ga0068858_1000693312	224
118	3300005842	Ga0068858_100342802	Ga0068858_1003428022	224
119	3300006881	Ga0068865_100449656	Ga0068865_1004496561	224
120	3300009093	Ga0105240_10000617	Ga0105240_100006178	224
121	3300009093	Ga0105240_10039225	Ga0105240_100392256	224
122	3300009093	Ga0105240_10337647	Ga0105240_103376472	224
123	3300009174	Ga0105241_10554866	Ga0105241_105548661	224
124	3300009177	Ga0105248_10000216	Ga0105248_1000021631	224
125	3300009545	Ga0105237_10010519	Ga0105237_100105199	224
126	3300009551	Ga0105238_10000891	Ga0105238_100008915	224
127	3300009551	Ga0105238_10059566	Ga0105238_100595665	224
128	3300009553	Ga0105249_10000175	Ga0105249_1000017524	224
129	3300009553	Ga0105249_10442474	Ga0105249_104424742	224
130	3300010375	Ga0105239_10160444	Ga0105239_101604441	224
131	3300013105	Ga0157369_10069831	Ga0157369_100698316	224
132	3300013296	Ga0157374_10498168	Ga0157374_104981681	224
133	3300014497	Ga0182008_10042736	Ga0182008_100427363	224
134	3300014969	Ga0157376_10299488	Ga0157376_102994881	224
135	3300025245	Ga0207425_1001498	Ga0207425_10014984	224
136	3300025294	Ga0209025_1000023	Ga0209025_1000023277	224
137	3300025321	Ga0207656_10017833	Ga0207656_100178332	224
138	3300025903	Ga0207680_10007027	Ga0207680_100070276	224
139	3300025904	Ga0207647_10000531	Ga0207647_1000053119	224
140	3300025912	Ga0207707_10050825	Ga0207707_100508252	224
141	3300025913	Ga0207695_10000032	Ga0207695_10000032332	224
142	3300025913	Ga0207695_10015858	Ga0207695_1001585811	224
143	3300025913	Ga0207695_10024600	Ga0207695_100246006	224
144	3300025913	Ga0207695_10350770	Ga0207695_103507701	224
145	3300025913	Ga0207695_10391808	Ga0207695_103918082	224
146	3300025917	Ga0207660_10141755	Ga0207660_101417552	224
147	3300025920	Ga0207649_10011254	Ga0207649_100112542	224
148	3300025924	Ga0207694_10000361	Ga0207694_100003617	224
149	3300025924	Ga0207694_10000821	Ga0207694_1000082125	224
150	3300025925	Ga0207650_10029221	Ga0207650_100292213	224
151	3300025933	Ga0207706_10027066	Ga0207706_100270665	224
152	3300025941	Ga0207711_10004262	Ga0207711_100042625	224
153	3300025949	Ga0207667_10159993	Ga0207667_101599932	224
154	3300025949	Ga0207667_10565034	Ga0207667_105650342	224
155	3300025961	Ga0207712_10000165	Ga0207712_1000016556	224
156	3300025961	Ga0207712_10000548	Ga0207712_100005487	224
157	3300025986	Ga0207658_10000148	Ga0207658_1000014872	224
158	3300026035	Ga0207703_10002398	Ga0207703_100023985	224
159	3300026035	Ga0207703_10096245	Ga0207703_100962452	224
160	3300026035	Ga0207703_10278707	Ga0207703_102787072	224
161	3300026041	Ga0207639_10001201	Ga0207639_100012012	224
162	3300026041	Ga0207639_10169751	Ga0207639_101697512	224
163	3300026067	Ga0207678_10037461	Ga0207678_100374614	224
164	3300026067	Ga0207678_10058750	Ga0207678_100587503	224
165	3300026116	Ga0207674_10195326	Ga0207674_101953262	224
166	3300026142	Ga0207698_10172109	Ga0207698_101721092	224
167	3300028379	Ga0268266_10000006	Ga0268266_100000061132	224
168	3300031548	Ga0307408_100128069	Ga0307408_1001280691	224
169	3300032002	Ga0307416_100056828	Ga0307416_1000568285	224
170	3300041404	Ga0439436_0046859	Ga0439436_0046859_287_991	224
171	3300041456	Ga0451795_0602903	Ga0451795_0602903_462_1142	224
172	3300045976	Ga0466967_0752888	Ga0466967_0752888_226_921	224
173	3300046539	Ga0495621_0046961	Ga0495621_0046961_596_1396	224
174	3300048921	Ga0496118_0012333	Ga0496118_0012333_4364_5050	224
175	3300048924	Ga0496121_0001499	Ga0496121_0001499_5340_6023	224
176	3300048925	Ga0496122_0000129	Ga0496122_0000129_122279_122989	224
177	3300048926	Ga0496123_0000113	Ga0496123_0000113_81138_81848	224
178	3300049741	Ga0501079_0228563	Ga0501079_0228563_683_1378	224
179	3300049822	Ga0501035_0463381	Ga0501035_0463381_97_774	224
180	3300053087	Ga0500643_000685	Ga0500643_000685_7304_8014	224
181	3300053093	Ga0500651_0001012	Ga0500651_0001012_6285_6962	224
182	3300053120	Ga0500597_000051	Ga0500597_000051_2933_3643	224
183	3300053178	Ga0500637_0189963	Ga0500637_0189963_81_770	224
184	3300002737	JGI25162J39368_1000220	JGI25162J39368_100022019	225
185	3300002737	JGI25162J39368_1000531	JGI25162J39368_100053132	225
186	3300002741	JGI25157J39369_1000715	JGI25157J39369_10007154	225
187	3300002772	JGI25164J39214_1000189	JGI25164J39214_100018915	225
188	3300003187	JGI25151J46595_10026240	JGI25151J46595_100262403	225
189	3300003214	JGI25165J46597_1000324	JGI25165J46597_100032420	225
190	3300003214	JGI25165J46597_1001943	JGI25165J46597_10019439	225
191	3300003781	Ga0055536_1000779	Ga0055536_100077912	225
192	3300003781	Ga0055536_1014830	Ga0055536_10148302	225
193	3300003794	Ga0055531_10002454	Ga0055531_100024543	225
194	3300003794	Ga0055531_10030520	Ga0055531_100305203	225
195	3300003794	Ga0055531_10034430	Ga0055531_100344301	225
196	3300005293	Ga0065715_10006303	Ga0065715_100063033	225
197	3300005293	Ga0065715_10056094	Ga0065715_100560942	225
198	3300005329	Ga0070683_100195481	Ga0070683_1001954812	225
199	3300005329	Ga0070683_100614741	Ga0070683_1006147412	225
200	3300005331	Ga0070670_100195416	Ga0070670_1001954162	225
201	3300005334	Ga0068869_100002466	Ga0068869_10000246612	225
202	3300005335	Ga0070666_10064441	Ga0070666_100644412	225
203	3300005336	Ga0070680_100867974	Ga0070680_1008679741	225
204	3300005338	Ga0068868_100028195	Ga0068868_1000281956	225
205	3300005338	Ga0068868_100719844	Ga0068868_1007198441	225
206	3300005339	Ga0070660_100125913	Ga0070660_1001259132	225
207	3300005339	Ga0070660_100152677	Ga0070660_1001526772	225
208	3300005339	Ga0070660_100308851	Ga0070660_1003088512	225
209	3300005344	Ga0070661_100002060	Ga0070661_10000206012	225
210	3300005345	Ga0070692_10000986	Ga0070692_100009863	225
211	3300005347	Ga0070668_100009565	Ga0070668_1000095652	225
212	3300005353	Ga0070669_100010148	Ga0070669_1000101485	225
213	3300005355	Ga0070671_100043118	Ga0070671_1000431183	225
214	3300005364	Ga0070673_100073512	Ga0070673_1000735122	225
215	3300005366	Ga0070659_100039144	Ga0070659_1000391443	225
216	3300005366	Ga0070659_100470896	Ga0070659_1004708962	225
217	3300005367	Ga0070667_100072779	Ga0070667_1000727794	225
218	3300005367	Ga0070667_100082714	Ga0070667_1000827144	225
219	3300005435	Ga0070714_100000034	Ga0070714_10000003496	225
220	3300005436	Ga0070713_100062831	Ga0070713_1000628314	225
221	3300005445	Ga0070708_100298380	Ga0070708_1002983801	225
222	3300005455	Ga0070663_100247521	Ga0070663_1002475211	225
223	3300005455	Ga0070663_100445292	Ga0070663_1004452922	225
224	3300005455	Ga0070663_100673656	Ga0070663_1006736561	225
225	3300005456	Ga0070678_100096571	Ga0070678_1000965712	225
226	3300005457	Ga0070662_100020554	Ga0070662_1000205542	225
227	3300005458	Ga0070681_10129370	Ga0070681_101293701	225
228	3300005530	Ga0070679_100007871	Ga0070679_1000078713	225
229	3300005530	Ga0070679_100189926	Ga0070679_1001899264	225
230	3300005530	Ga0070679_100400525	Ga0070679_1004005253	225
231	3300005535	Ga0070684_100741892	Ga0070684_1007418922	225
232	3300005539	Ga0068853_100001459	Ga0068853_10000145910	225
233	3300005539	Ga0068853_100030836	Ga0068853_1000308366	225
234	3300005539	Ga0068853_100107710	Ga0068853_1001077103	225
235	3300005539	Ga0068853_100565733	Ga0068853_1005657331	225
236	3300005546	Ga0070696_100001877	Ga0070696_1000018778	225
237	3300005547	Ga0070693_100188565	Ga0070693_1001885652	225
238	3300005548	Ga0070665_100000108	Ga0070665_10000010887	225
239	3300005548	Ga0070665_100163290	Ga0070665_1001632903	225
240	3300005548	Ga0070665_100332981	Ga0070665_1003329812	225
241	3300005563	Ga0068855_100237159	Ga0068855_1002371592	225
242	3300005577	Ga0068857_100015183	Ga0068857_1000151833	225
243	3300005577	Ga0068857_100032855	Ga0068857_1000328556	225
244	3300005614	Ga0068856_100348480	Ga0068856_1003484802	225
245	3300005614	Ga0068856_100359151	Ga0068856_1003591512	225
246	3300005616	Ga0068852_100021206	Ga0068852_1000212067	225
247	3300005616	Ga0068852_100076379	Ga0068852_1000763792	225
248	3300005616	Ga0068852_100832390	Ga0068852_1008323902	225
249	3300005618	Ga0068864_100042958	Ga0068864_1000429583	225
250	3300005618	Ga0068864_100063871	Ga0068864_1000638712	225
251	3300005834	Ga0068851_10056347	Ga0068851_100563472	225
252	3300005841	Ga0068863_100015895	Ga0068863_10001589510	225
253	3300005841	Ga0068863_100082253	Ga0068863_1000822532	225
254	3300005842	Ga0068858_100126786	Ga0068858_1001267862	225
255	3300005842	Ga0068858_100343491	Ga0068858_1003434913	225
256	3300005843	Ga0068860_100034421	Ga0068860_1000344217	225
257	3300005844	Ga0068862_100302337	Ga0068862_1003023373	225
258	3300006173	Ga0070716_100276150	Ga0070716_1002761502	225
259	3300006237	Ga0097621_100035176	Ga0097621_1000351764	225
260	3300006237	Ga0097621_100082797	Ga0097621_1000827972	225
261	3300006358	Ga0068871_100021755	Ga0068871_1000217553	225
262	3300006358	Ga0068871_100121991	Ga0068871_1001219914	225
263	3300006358	Ga0068871_100276255	Ga0068871_1002762552	225
264	3300006881	Ga0068865_100009063	Ga0068865_1000090634	225
265	3300009093	Ga0105240_10003405	Ga0105240_100034052	225
266	3300009093	Ga0105240_10038090	Ga0105240_100380907	225
267	3300009093	Ga0105240_10764332	Ga0105240_107643322	225
268	3300009098	Ga0105245_10126176	Ga0105245_101261762	225
269	3300009174	Ga0105241_10007340	Ga0105241_100073408	225
270	3300009174	Ga0105241_10031428	Ga0105241_100314284	225
271	3300009174	Ga0105241_10110986	Ga0105241_101109863	225
272	3300009174	Ga0105241_10246894	Ga0105241_102468943	225
273	3300009174	Ga0105241_10944240	Ga0105241_109442401	225
274	3300009177	Ga0105248_10019787	Ga0105248_1001978710	225
275	3300009177	Ga0105248_10050859	Ga0105248_100508592	225
276	3300009545	Ga0105237_10006699	Ga0105237_100066991	225
277	3300009545	Ga0105237_10066335	Ga0105237_100663354	225
278	3300009545	Ga0105237_10133210	Ga0105237_101332102	225
279	3300009545	Ga0105237_10413058	Ga0105237_104130581	225
280	3300009545	Ga0105237_10460326	Ga0105237_104603262	225
281	3300009551	Ga0105238_10002280	Ga0105238_100022808	225
282	3300009551	Ga0105238_10334526	Ga0105238_103345262	225
283	3300009979	Ga0105032_100462	Ga0105032_1004625	225
284	3300010375	Ga0105239_10004787	Ga0105239_100047878	225
285	3300010375	Ga0105239_10127687	Ga0105239_101276872	225
286	3300010375	Ga0105239_10346607	Ga0105239_103466072	225
287	3300013102	Ga0157371_10050654	Ga0157371_100506542	225
288	3300013104	Ga0157370_10007668	Ga0157370_100076689	225
289	3300013104	Ga0157370_10193260	Ga0157370_101932602	225
290	3300013104	Ga0157370_10557789	Ga0157370_105577892	225
291	3300013105	Ga0157369_10017409	Ga0157369_100174096	225
292	3300013105	Ga0157369_10032262	Ga0157369_100322627	225
293	3300013105	Ga0157369_10166441	Ga0157369_101664412	225
294	3300013296	Ga0157374_10031993	Ga0157374_100319932	225
295	3300013296	Ga0157374_10053757	Ga0157374_100537572	225
296	3300013297	Ga0157378_10000373	Ga0157378_1000037311	225
297	3300013297	Ga0157378_10432014	Ga0157378_104320142	225
298	3300013297	Ga0157378_10848553	Ga0157378_108485531	225
299	3300013307	Ga0157372_10000470	Ga0157372_100004704	225
300	3300013307	Ga0157372_10072804	Ga0157372_100728042	225
301	3300013307	Ga0157372_10108252	Ga0157372_101082522	225
302	3300013307	Ga0157372_10133552	Ga0157372_101335522	225
303	3300013307	Ga0157372_10134958	Ga0157372_101349584	225
304	3300013308	Ga0157375_10024977	Ga0157375_100249777	225
305	3300013308	Ga0157375_10192827	Ga0157375_101928272	225
306	3300014325	Ga0163163_10005908	Ga0163163_1000590812	225
307	3300014325	Ga0163163_10354267	Ga0163163_103542673	225
308	3300014497	Ga0182008_10026445	Ga0182008_100264451	225
309	3300014968	Ga0157379_10028085	Ga0157379_100280856	225
310	3300014969	Ga0157376_10032870	Ga0157376_100328704	225
311	3300015262	Ga0182007_10004085	Ga0182007_100040855	225
312	3300015689	Ga0183360_10001	Ga0183360_10001127	225
313	3300017792	Ga0163161_10172996	Ga0163161_101729962	225
314	3300020082	Ga0206353_11461609	Ga0206353_114616093	225
315	3300025226	Ga0209674_101127	Ga0209674_1011272	225
316	3300025231	Ga0207427_100050	Ga0207427_100050285	225
317	3300025231	Ga0207427_100166	Ga0207427_10016636	225
318	3300025233	Ga0209437_100120	Ga0209437_10012056	225
319	3300025233	Ga0209437_100288	Ga0209437_10028849	225
320	3300025242	Ga0209258_108816	Ga0209258_1088162	225
321	3300025245	Ga0207425_1008111	Ga0207425_10081113	225
322	3300025250	Ga0209026_1000157	Ga0209026_100015752	225
323	3300025261	Ga0209233_1000174	Ga0209233_1000174114	225
324	3300025261	Ga0209233_1000184	Ga0209233_1000184106	225
325	3300025261	Ga0209233_1000284	Ga0209233_100028445	225
326	3300025263	Ga0209565_1003168	Ga0209565_10031682	225
327	3300025273	Ga0209673_1004642	Ga0209673_10046427	225
328	3300025284	Ga0209130_1005684	Ga0209130_10056844	225
329	3300025291	Ga0209675_1018848	Ga0209675_10188482	225
330	3300025292	Ga0209676_1000609	Ga0209676_100060926	225
331	3300025292	Ga0209676_1000997	Ga0209676_100099720	225
332	3300025292	Ga0209676_1003263	Ga0209676_10032635	225
333	3300025292	Ga0209676_1011489	Ga0209676_10114891	225
334	3300025294	Ga0209025_1001558	Ga0209025_100155815	225
335	3300025294	Ga0209025_1010320	Ga0209025_10103204	225
336	3300025294	Ga0209025_1027161	Ga0209025_10271612	225
337	3300025295	Ga0209564_1009585	Ga0209564_10095855	225
338	3300025297	Ga0209758_1015639	Ga0209758_10156394	225
339	3300025298	Ga0209050_1001956	Ga0209050_100195610	225
340	3300025299	Ga0209256_1001108	Ga0209256_100110815	225
341	3300025299	Ga0209256_1002473	Ga0209256_10024734	225
342	3300025299	Ga0209256_1003294	Ga0209256_10032948	225
343	3300025304	Ga0209257_1000298	Ga0209257_100029829	225
344	3300025304	Ga0209257_1000302	Ga0209257_100030221	225
345	3300025304	Ga0209257_1000875	Ga0209257_100087515	225
346	3300025304	Ga0209257_1001201	Ga0209257_100120115	225
347	3300025304	Ga0209257_1003611	Ga0209257_10036112	225
348	3300025304	Ga0209257_1014318	Ga0209257_10143182	225
349	3300025321	Ga0207656_10045941	Ga0207656_100459413	225
350	3300025903	Ga0207680_10116998	Ga0207680_101169982	225
351	3300025904	Ga0207647_10003010	Ga0207647_1000301012	225
352	3300025904	Ga0207647_10008779	Ga0207647_100087797	225
353	3300025909	Ga0207705_10007388	Ga0207705_100073886	225
354	3300025909	Ga0207705_10219933	Ga0207705_102199332	225
355	3300025911	Ga0207654_10008265	Ga0207654_100082655	225
356	3300025911	Ga0207654_10246536	Ga0207654_102465362	225
357	3300025911	Ga0207654_10368113	Ga0207654_103681133	225
358	3300025912	Ga0207707_10067026	Ga0207707_100670262	225
359	3300025913	Ga0207695_10000182	Ga0207695_10000182123	225
360	3300025914	Ga0207671_10007772	Ga0207671_100077727	225
361	3300025914	Ga0207671_10091259	Ga0207671_100912593	225
362	3300025915	Ga0207693_10269893	Ga0207693_102698932	225
363	3300025917	Ga0207660_10275660	Ga0207660_102756602	225
364	3300025917	Ga0207660_10749988	Ga0207660_107499881	225
365	3300025919	Ga0207657_10021415	Ga0207657_100214157	225
366	3300025919	Ga0207657_10048742	Ga0207657_100487422	225
367	3300025919	Ga0207657_10089572	Ga0207657_100895722	225
368	3300025919	Ga0207657_10128798	Ga0207657_101287981	225
369	3300025919	Ga0207657_10190269	Ga0207657_101902692	225
370	3300025920	Ga0207649_10002944	Ga0207649_100029448	225
371	3300025920	Ga0207649_10077880	Ga0207649_100778802	225
372	3300025921	Ga0207652_10013559	Ga0207652_100135594	225
373	3300025921	Ga0207652_10122165	Ga0207652_101221652	225
374	3300025921	Ga0207652_10491391	Ga0207652_104913912	225
375	3300025923	Ga0207681_10052359	Ga0207681_100523593	225
376	3300025928	Ga0207700_10009046	Ga0207700_100090468	225
377	3300025929	Ga0207664_10000021	Ga0207664_10000021127	225
378	3300025931	Ga0207644_10086102	Ga0207644_100861022	225
379	3300025932	Ga0207690_10003672	Ga0207690_100036729	225
380	3300025932	Ga0207690_10005103	Ga0207690_100051036	225
381	3300025932	Ga0207690_10080688	Ga0207690_100806883	225
382	3300025932	Ga0207690_10152114	Ga0207690_101521143	225
383	3300025933	Ga0207706_10025355	Ga0207706_100253553	225
384	3300025938	Ga0207704_10028975	Ga0207704_100289755	225
385	3300025941	Ga0207711_10020071	Ga0207711_100200717	225
386	3300025941	Ga0207711_10129830	Ga0207711_101298302	225
387	3300025942	Ga0207689_10050335	Ga0207689_100503353	225
388	3300025942	Ga0207689_10129469	Ga0207689_101294694	225
389	3300025949	Ga0207667_10000799	Ga0207667_1000079916	225
390	3300025949	Ga0207667_10059655	Ga0207667_100596552	225
391	3300025972	Ga0207668_10234615	Ga0207668_102346152	225
392	3300025986	Ga0207658_10009250	Ga0207658_100092504	225
393	3300025986	Ga0207658_10032566	Ga0207658_100325666	225
394	3300026023	Ga0207677_10804168	Ga0207677_108041681	225
395	3300026035	Ga0207703_10019400	Ga0207703_100194006	225
396	3300026035	Ga0207703_10034650	Ga0207703_100346505	225
397	3300026041	Ga0207639_10000464	Ga0207639_100004649	225
398	3300026041	Ga0207639_10441201	Ga0207639_104412011	225
399	3300026041	Ga0207639_10807778	Ga0207639_108077781	225
400	3300026041	Ga0207639_11196684	Ga0207639_111966841	225
401	3300026067	Ga0207678_10052373	Ga0207678_100523732	225
402	3300026078	Ga0207702_10092609	Ga0207702_100926092	225
403	3300026078	Ga0207702_10106489	Ga0207702_101064895	225
404	3300026088	Ga0207641_10015099	Ga0207641_100150999	225
405	3300026088	Ga0207641_10091872	Ga0207641_100918722	225
406	3300026095	Ga0207676_10031333	Ga0207676_100313333	225
407	3300026116	Ga0207674_10018202	Ga0207674_100182023	225
408	3300026116	Ga0207674_10042709	Ga0207674_100427093	225
409	3300026142	Ga0207698_10083674	Ga0207698_100836743	225
410	3300028379	Ga0268266_10000001	Ga0268266_100000011948	225
411	3300028379	Ga0268266_10033436	Ga0268266_100334363	225
412	3300028381	Ga0268264_10014391	Ga0268264_100143912	225
413	3300028794	Ga0307515_10251204	Ga0307515_102512042	225
414	3300030731	Ga0316177_1124450	Ga0316177_11244502	225
415	3300031456	Ga0307513_10125223	Ga0307513_101252232	225
416	3300031456	Ga0307513_10245834	Ga0307513_102458342	225
417	3300031548	Ga0307408_100202844	Ga0307408_1002028442	225
418	3300031548	Ga0307408_100275701	Ga0307408_1002757012	225
419	3300031731	Ga0307405_10541386	Ga0307405_105413862	225
420	3300031824	Ga0307413_10081821	Ga0307413_100818213	225
421	3300031824	Ga0307413_10222616	Ga0307413_102226162	225
422	3300031824	Ga0307413_10247106	Ga0307413_102471062	225
423	3300031824	Ga0307413_10461616	Ga0307413_104616162	225
424	3300031901	Ga0307406_10047174	Ga0307406_100471744	225
425	3300031903	Ga0307407_10215956	Ga0307407_102159563	225
426	3300031903	Ga0307407_10524750	Ga0307407_105247501	225
427	3300032002	Ga0307416_100058786	Ga0307416_1000587862	225
428	3300032002	Ga0307416_100727222	Ga0307416_1007272221	225
429	3300032002	Ga0307416_101282100	Ga0307416_1012821001	225
430	3300032004	Ga0307414_10003710	Ga0307414_100037104	225
431	3300032004	Ga0307414_10005928	Ga0307414_100059284	225
432	3300032004	Ga0307414_10090763	Ga0307414_100907632	225
433	3300032004	Ga0307414_10142673	Ga0307414_101426733	225
434	3300032126	Ga0307415_100194347	Ga0307415_1001943472	225
435	3300032126	Ga0307415_100393397	Ga0307415_1003933972	225
436	3300033179	Ga0307507_10257809	Ga0307507_102578092	225
437	3300037312	Ga0395899_0052075	Ga0395899_0052075_484_1161	225
438	3300037471	Ga0395905_0042074	Ga0395905_0042074_920_1690	225
439	3300037471	Ga0395905_0168888	Ga0395905_0168888_947_1627	225
440	3300038443	Ga0395901_0040176	Ga0395901_0040176_3744_4421	225
441	3300039145	Ga0237816_00050	Ga0237816_00050_348_1043	225
442	3300041410	Ga0439461_0006250	Ga0439461_0006250_321_1010	225
443	3300041413	Ga0439465_0000415	Ga0439465_0000415_7194_7892	225
444	3300041413	Ga0439465_0001341	Ga0439465_0001341_2406_3095	225
445	3300041507	Ga0451851_0193987	Ga0451851_0193987_463_1161	225
446	3300041509	Ga0451843_0013366	Ga0451843_0013366_1053_1733	225
447	3300041512	Ga0451853_2254292	Ga0451853_2254292_3593_4291	225
448	3300042000	Ga0439437_003868	Ga0439437_003868_16_693	225
449	3300042004	Ga0439445_0001852	Ga0439445_0001852_3270_3977	225
450	3300042006	Ga0439432_001933	Ga0439432_001933_4734_5420	225
451	3300042006	Ga0439432_021759	Ga0439432_021759_907_1656	225
452	3300042006	Ga0439432_049219	Ga0439432_049219_181_864	225
453	3300042006	Ga0439432_052672	Ga0439432_052672_41_724	225
454	3300042007	Ga0439449_0000038	Ga0439449_0000038_9934_10632	225
455	3300042007	Ga0439449_0004075	Ga0439449_0004075_3824_4573	225
456	3300042007	Ga0439449_0006573	Ga0439449_0006573_3344_4048	225
457	3300042007	Ga0439449_0015313	Ga0439449_0015313_1127_1810	225
458	3300042007	Ga0439449_0021016	Ga0439449_0021016_1258_1950	225
459	3300042007	Ga0439449_0029669	Ga0439449_0029669_627_1319	225
460	3300042007	Ga0439449_0067001	Ga0439449_0067001_91_774	225
461	3300042007	Ga0439449_0127698	Ga0439449_0127698_82_777	225
462	3300042156	Ga0439446_0097410	Ga0439446_0097410_160_849	225
463	3300046460	Ga0495638_0084314	Ga0495638_0084314_423_1109	225
464	3300046525	Ga0495663_0031910	Ga0495663_0031910_587_1276	225
465	3300046525	Ga0495663_0137511	Ga0495663_0137511_28_717	225
466	3300046557	Ga0495622_0096080	Ga0495622_0096080_30_716	225
467	3300046615	Ga0495656_0044973	Ga0495656_0044973_1009_1686	225
468	3300046675	Ga0495657_0266906	Ga0495657_0266906_164_850	225
469	3300046681	Ga0495647_0023712	Ga0495647_0023712_184_870	225
470	3300046692	Ga0495671_0007975	Ga0495671_0007975_2958_3647	225
471	3300047318	Ga0495636_0007841	Ga0495636_0007841_1459_2163	225
472	3300047318	Ga0495636_0012311	Ga0495636_0012311_845_1522	225
473	3300047318	Ga0495636_0045753	Ga0495636_0045753_395_1072	225
474	3300047318	Ga0495636_0103218	Ga0495636_0103218_420_1097	225
475	3300047319	Ga0495674_0318298	Ga0495674_0318298_338_1024	225
476	3300048904	Ga0496101_0591429	Ga0496101_0591429_146_835	225
477	3300048912	Ga0496109_0148292	Ga0496109_0148292_484_1161	225
478	3300048925	Ga0496122_0011484	Ga0496122_0011484_6762_7448	225
479	3300048926	Ga0496123_0022874	Ga0496123_0022874_1185_1871	225
480	3300049569	Ga0501032_0003860	Ga0501032_0003860_4379_5077	225
481	3300049569	Ga0501032_0040696	Ga0501032_0040696_140_820	225
482	3300049569	Ga0501032_0165764	Ga0501032_0165764_699_1382	225
483	3300049570	Ga0501033_0000720	Ga0501033_0000720_11576_12274	225
484	3300049571	Ga0501034_0002656	Ga0501034_0002656_4987_5682	225
485	3300049571	Ga0501034_0004188	Ga0501034_0004188_11704_12402	225
486	3300049571	Ga0501034_0019666	Ga0501034_0019666_1518_2213	225
487	3300049571	Ga0501034_0357896	Ga0501034_0357896_133_828	225
488	3300049571	Ga0501034_0513763	Ga0501034_0513763_98_778	225
489	3300049572	Ga0501036_0004881	Ga0501036_0004881_2127_2825	225
490	3300049573	Ga0501037_0002331	Ga0501037_0002331_8840_9538	225
491	3300049574	Ga0501038_0004437	Ga0501038_0004437_9452_10150	225
492	3300049574	Ga0501038_0024061	Ga0501038_0024061_2574_3254	225
493	3300049574	Ga0501038_0495811	Ga0501038_0495811_88_771	225
494	3300049575	Ga0501039_0039145	Ga0501039_0039145_2874_3572	225
495	3300049579	Ga0501043_0054877	Ga0501043_0054877_367_1056	225
496	3300049579	Ga0501043_0158173	Ga0501043_0158173_301_996	225
497	3300049580	Ga0501046_0006002	Ga0501046_0006002_552_1250	225
498	3300049580	Ga0501046_0219047	Ga0501046_0219047_344_1039	225
499	3300049581	Ga0501047_0002257	Ga0501047_0002257_13405_14100	225
500	3300049581	Ga0501047_0022557	Ga0501047_0022557_4487_5167	225
501	3300049581	Ga0501047_0031434	Ga0501047_0031434_3228_3926	225
502	3300049581	Ga0501047_0091521	Ga0501047_0091521_1527_2216	225
503	3300049581	Ga0501047_0353910	Ga0501047_0353910_19_702	225
504	3300049581	Ga0501047_0407810	Ga0501047_0407810_374_1057	225
505	3300049584	Ga0501068_0015958	Ga0501068_0015958_802_1500	225
506	3300049584	Ga0501068_0489343	Ga0501068_0489343_15_704	225
507	3300049585	Ga0501069_0050267	Ga0501069_0050267_767_1465	225
508	3300049585	Ga0501069_0090039	Ga0501069_0090039_864_1544	225
509	3300049585	Ga0501069_0124790	Ga0501069_0124790_89_784	225
510	3300049586	Ga0501070_0003389	Ga0501070_0003389_2995_3675	225
511	3300049586	Ga0501070_0036899	Ga0501070_0036899_282_977	225
512	3300049586	Ga0501070_0045322	Ga0501070_0045322_1751_2446	225
513	3300049586	Ga0501070_0056112	Ga0501070_0056112_511_1188	225
514	3300049586	Ga0501070_0110305	Ga0501070_0110305_1379_2074	225
515	3300049586	Ga0501070_0425185	Ga0501070_0425185_202_900	225
516	3300049586	Ga0501070_0494395	Ga0501070_0494395_124_813	225
517	3300049589	Ga0501073_0003125	Ga0501073_0003125_4037_4735	225
518	3300049589	Ga0501073_0033753	Ga0501073_0033753_1919_2611	225
519	3300049590	Ga0501074_0001543	Ga0501074_0001543_12772_13467	225
520	3300049590	Ga0501074_0016257	Ga0501074_0016257_3471_4166	225
521	3300049682	Ga0501252_004542	Ga0501252_004542_154_837	225
522	3300049705	Ga0501225_0017701	Ga0501225_0017701_567_1259	225
523	3300049741	Ga0501079_0275748	Ga0501079_0275748_148_828	225
524	3300049742	Ga0501080_0001894	Ga0501080_0001894_10771_11466	225
525	3300049742	Ga0501080_0002682	Ga0501080_0002682_6238_6936	225
526	3300049742	Ga0501080_0041260	Ga0501080_0041260_2695_3390	225
527	3300049742	Ga0501080_0366570	Ga0501080_0366570_435_1115	225
528	3300049744	Ga0501083_0059836	Ga0501083_0059836_152_850	225
529	3300049744	Ga0501083_0278645	Ga0501083_0278645_386_1069	225
530	3300049822	Ga0501035_0034893	Ga0501035_0034893_1526_2215	225
531	3300049822	Ga0501035_0052455	Ga0501035_0052455_1422_2102	225
532	3300049822	Ga0501035_0084326	Ga0501035_0084326_1610_2308	225
533	3300049823	Ga0501044_0004235	Ga0501044_0004235_9353_10042	225
534	3300049823	Ga0501044_0098561	Ga0501044_0098561_306_986	225
535	3300053079	Ga0500610_0000390	Ga0500610_0000390_4736_5521	225
536	3300053093	Ga0500651_0011133	Ga0500651_0011133_427_1107	225
537	3300053136	Ga0500559_0067189	Ga0500559_0067189_111_797	225
538	3300053139	Ga0500568_0002333	Ga0500568_0002333_6593_7279	225
539	3300053151	Ga0500604_0091782	Ga0500604_0091782_217_906	225
540	3300053155	Ga0500620_003503	Ga0500620_003503_1427_2107	225
541	3300054114	Ga0501084_0095893	Ga0501084_0095893_443_1126	225
542	3300055283	Ga0500661_027272	Ga0500661_027272_61_810	225
543	3300060353	Ga0501082_0000268	Ga0501082_0000268_1296_1979	225
544	3300060353	Ga0501082_0092315	Ga0501082_0092315_121_819	225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

172

259

0.96 PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

142

250

0.88 PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

147

255

0.81 PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

168

252

0.73 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3ec4-assembly1.cif.gz_A	crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution	0.9131	6	225
3ec4-assembly2.cif.gz_B	crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution	0.9106	6	225
3ec4-assembly1.cif.gz_A	crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution	0.8938	6	225
3ec4-assembly2.cif.gz_B	crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution	0.8912	6	225
3c26-assembly1.cif.gz_A-2	crystal structure of a putative acetyltransferase (np_394282.1) from thermoplasma acidophilum at 2.00 a resolution	0.8548	133	212

ID	Description	Score	Start	End	Superfamily
af_E7EZI9_69_205_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.9084	133	216	3.40.630.30
3ec4B00	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.8997	6	225	3.40.630.30
af_Q8IQP3_53_143_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.8932	133	191	3.40.630.30
1y9kD01	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.8889	128	213	3.40.630.30
af_P39337_13_151_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.8815	133	212	3.40.630.30

ID	Description	Score	Start	End	GO Terms
AF-A0A811B8S4-F1-model_v4	deleted	0.99	5	224
AF-A0A4R6Z7R7-F1-model_v4	FR47-like protein	0.9714	1	224	GO:0016747
AF-A0A522RLE7-F1-model_v4	GNAT family N-acetyltransferase	0.9696	1	170	GO:0016740
AF-A0A4V1S5G2-F1-model_v4	GNAT family N-acetyltransferase	0.9657	5	225	GO:0016747
AF-A0A7G8V816-F1-model_v4	GNAT family N-acetyltransferase	0.9653	3	225	GO:0016747

Feature Viewer

pLDDT	pTM	Quality
94.73	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F461773

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF08445

FR47

FR47-like protein

172

259

0.96

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

142

250

0.88

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

147

255

0.81

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

168

252

0.73

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Map