F461776

General Info

Members Datasets Scaffolds Average Seq Length
544 209 544 211

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0096412|Ga0495625_0096412_212_928
Length 238
Sequence MSCELLFAANGSQLVANSSQLLNPTNMYIKIYFNDKPLFLCDSIDAELEPYRHHDDTMFIDEFSSHAVKSMVHEMEQQKIHAGILLHTDLAALKKALWKKFTVMQAAGGLVFNPRQEALFIFRRGKWDLPKGKLDPGETLEACALREVREETGLKGVHSDGFMLPTFHTYHESGKFILKESHWYRMKTAESALAPQREEDITQAIWANEQKVNECLKNSFPSIRDVISRYRRQEAADV

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
155 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
156 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
157 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
158 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 0.18
Rhizosphere 97.43
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10098982 3300003322 Bacteria 4419
2 rootL2_10315015 3300003322 Bacteria 2083
3 Ga0065714_10122454 3300005288 Bacteria 1332
4 Ga0065712_10006497 3300005290 Bacteria 3073
5 Ga0065712_10007690 3300005290 Bacteria 3079
6 Ga0065712_10098895 3300005290 Bacteria 2104
7 Ga0065715_10129527 3300005293 Bacteria 2043
8 Ga0065707_10113208 3300005295 Bacteria 2335
9 Ga0065707_10340952 3300005295 Bacteria 934
10 Ga0070658_10341260 3300005327 Bacteria 1281
11 Ga0070676_10020723 3300005328 Bacteria 3675
12 Ga0070676_10022991 3300005328 Bacteria 3501
13 Ga0070676_10058594 3300005328 Unclassified 2283
14 Ga0070676_10262227 3300005328 Bacteria 1157
15 Ga0070683_100007495 3300005329 Bacteria 9223
16 Ga0070683_100008296 3300005329 Bacteria 8829
17 Ga0070690_100004288 3300005330 Bacteria 7900
18 Ga0070670_100014926 3300005331 Bacteria 6666
19 Ga0070670_100020723 3300005331 Bacteria 5652
20 Ga0070670_100041924 3300005331 Bacteria 3934
21 Ga0070670_100097616 3300005331 Bacteria 2528
22 Ga0070670_100183751 3300005331 Bacteria 1815
23 Ga0070670_100232342 3300005331 Bacteria 1605
24 Ga0070670_100298205 3300005331 Bacteria 1409
25 Ga0070670_100665972 3300005331 Bacteria 934
26 Ga0070677_10312560 3300005333 Bacteria 802
27 Ga0068869_100001737 3300005334 Bacteria 13017
28 Ga0068869_100029015 3300005334 Bacteria 3872
29 Ga0068869_100057728 3300005334 Unclassified 2835
30 Ga0068869_100063976 3300005334 Bacteria 2705
31 Ga0068869_100066249 3300005334 Bacteria 2660
32 Ga0068869_100176048 3300005334 Bacteria 1674
33 Ga0068869_100269356 3300005334 Bacteria 1366
34 Ga0068869_100367595 3300005334 Bacteria 1176
35 Ga0070666_10000343 3300005335 Bacteria 29213
36 Ga0070666_10049250 3300005335 Bacteria 2831
37 Ga0070666_10113935 3300005335 Bacteria 1871
38 Ga0070666_10142434 3300005335 Bacteria 1670
39 Ga0070682_100172780 3300005337 Bacteria 1503
40 Ga0068868_100001438 3300005338 Bacteria 16409
41 Ga0068868_100022095 3300005338 Bacteria 4798
42 Ga0068868_100054884 3300005338 Bacteria 3142
43 Ga0068868_100091371 3300005338 Bacteria 2453
44 Ga0068868_100121815 3300005338 Unclassified 2128
45 Ga0068868_100150522 3300005338 Bacteria 1916
46 Ga0068868_100446509 3300005338 Bacteria 1124
47 Ga0068868_100936540 3300005338 Bacteria 789
48 Ga0070660_100128883 3300005339 Unclassified 2023
49 Ga0070689_100006180 3300005340 Bacteria 8258
50 Ga0070689_100011429 3300005340 Bacteria 6359
51 Ga0070689_100030912 3300005340 Bacteria 4066
52 Ga0070689_100059038 3300005340 Bacteria 2980
53 Ga0070689_100327116 3300005340 Bacteria 1281
54 Ga0070687_100207424 3300005343 Bacteria 1191
55 Ga0070661_100007580 3300005344 Bacteria 7487
56 Ga0070661_100026972 3300005344 Bacteria 4136
57 Ga0070661_100098831 3300005344 Bacteria 2168
58 Ga0070668_100112809 3300005347 Unclassified 2165
59 Ga0070668_100155417 3300005347 Bacteria 1853
60 Ga0070669_100006405 3300005353 Bacteria 8474
61 Ga0070669_100021734 3300005353 Bacteria 4587
62 Ga0070669_100078084 3300005353 Bacteria 2460
63 Ga0070669_100453399 3300005353 Unclassified 1057
64 Ga0070675_100047469 3300005354 Unclassified 3519
65 Ga0070675_100146396 3300005354 Unclassified 2023
66 Ga0070675_100209227 3300005354 Bacteria 1695
67 Ga0070675_100220645 3300005354 Bacteria 1651
68 Ga0070675_100363534 3300005354 Bacteria 1285
69 Ga0070671_100009808 3300005355 Bacteria 7685
70 Ga0070671_100241392 3300005355 Bacteria 1534
71 Ga0070674_100024438 3300005356 Bacteria 3921
72 Ga0070674_100522031 3300005356 Bacteria 992
73 Ga0070673_100008635 3300005364 Bacteria 6788
74 Ga0070673_100014035 3300005364 Bacteria 5563
75 Ga0070673_100024564 3300005364 Bacteria 4422
76 Ga0070673_100067345 3300005364 Unclassified 2863
77 Ga0070673_100074170 3300005364 Bacteria 2741
78 Ga0070673_100075945 3300005364 Bacteria 2712
79 Ga0070673_100213718 3300005364 Unclassified 1667
80 Ga0070673_100325998 3300005364 Bacteria 1357
81 Ga0070673_100621270 3300005364 Bacteria 987
82 Ga0070688_100013508 3300005365 Unclassified 4607
83 Ga0070688_100014621 3300005365 Bacteria 4450
84 Ga0070688_100047235 3300005365 Bacteria 2669
85 Ga0070688_100645290 3300005365 Bacteria 815
86 Ga0070659_100150711 3300005366 Unclassified 1897
87 Ga0070659_100167342 3300005366 Bacteria 1799
88 Ga0070659_100180741 3300005366 Unclassified 1731
89 Ga0070667_100009014 3300005367 Bacteria 8257
90 Ga0070667_100223318 3300005367 Bacteria 1677
91 Ga0070667_100820751 3300005367 Bacteria 864
92 Ga0070700_100262039 3300005441 Bacteria 1245
93 Ga0070663_100065342 3300005455 Bacteria 2633
94 Ga0070663_100437369 3300005455 Bacteria 1076
95 Ga0070678_100117032 3300005456 Unclassified 2095
96 Ga0070678_100179503 3300005456 Bacteria 1732
97 Ga0070662_100005363 3300005457 Bacteria 8189
98 Ga0070662_100101298 3300005457 Unclassified 2180
99 Ga0068867_100014632 3300005459 Bacteria 5559
100 Ga0068867_100025843 3300005459 Unclassified 4212
101 Ga0068867_100091115 3300005459 Unclassified 2314
102 Ga0070685_10015189 3300005466 Bacteria 4088
103 Ga0070685_10027916 3300005466 Unclassified 3124
104 Ga0070685_10237405 3300005466 Bacteria 1202
105 Ga0070698_100031402 3300005471 Bacteria 5507
106 Ga0070698_100049843 3300005471 Bacteria 4273
107 Ga0070684_100010482 3300005535 Bacteria 7344
108 Ga0070684_100102457 3300005535 Unclassified 2559
109 Ga0070697_100375133 3300005536 Bacteria 1231
110 Ga0068853_100006317 3300005539 Bacteria 9404
111 Ga0068853_100007339 3300005539 Bacteria 8820
112 Ga0068853_100096336 3300005539 Bacteria 2610
113 Ga0068853_100109982 3300005539 Bacteria 2447
114 Ga0068853_100324281 3300005539 Bacteria 1428
115 Ga0068853_100607761 3300005539 Bacteria 1039
116 Ga0070672_100084486 3300005543 Bacteria 2549
117 Ga0070672_100198501 3300005543 Unclassified 1677
118 Ga0070695_100366588 3300005545 Unclassified 1083
119 Ga0070693_100131867 3300005547 Bacteria 1563
120 Ga0070665_100014018 3300005548 Bacteria 8058
121 Ga0070665_100226519 3300005548 Bacteria 1870
122 Ga0070665_100639134 3300005548 Unclassified 1077
123 Ga0070665_100897692 3300005548 Bacteria 899
124 Ga0070704_100260834 3300005549 Bacteria 1427
125 Ga0070664_100024452 3300005564 Unclassified 4996
126 Ga0070664_100034101 3300005564 Bacteria 4269
127 Ga0070664_100074769 3300005564 Bacteria 2908
128 Ga0070664_100156791 3300005564 Bacteria 2012
129 Ga0070664_100162738 3300005564 Bacteria 1975
130 Ga0070664_100520314 3300005564 Bacteria 1098
131 Ga0068857_100026901 3300005577 Bacteria 5072
132 Ga0068857_100074620 3300005577 Unclassified 3023
133 Ga0068857_100231154 3300005577 Bacteria 1691
134 Ga0068854_100079992 3300005578 Bacteria 2411
135 Ga0068854_100162105 3300005578 Bacteria 1733
136 Ga0068854_100359769 3300005578 Unclassified 1194
137 Ga0068854_100596925 3300005578 Bacteria 942
138 Ga0068852_100049368 3300005616 Unclassified 3600
139 Ga0068852_100053055 3300005616 Bacteria 3488
140 Ga0068852_100215352 3300005616 Bacteria 1824
141 Ga0068859_100000066 3300005617 Bacteria 100640
142 Ga0068859_100015491 3300005617 Bacteria 7661
143 Ga0068859_100025287 3300005617 Bacteria 5956
144 Ga0068859_100030780 3300005617 Bacteria 5386
145 Ga0068859_100091324 3300005617 Bacteria 3096
146 Ga0068859_100093399 3300005617 Bacteria 3060
147 Ga0068859_100147331 3300005617 Bacteria 2429
148 Ga0068859_100250180 3300005617 Bacteria 1863
149 Ga0068859_100279610 3300005617 Unclassified 1762
150 Ga0068859_100871955 3300005617 Bacteria 986
151 Ga0068864_100002791 3300005618 Bacteria 14425
152 Ga0068864_100014307 3300005618 Bacteria 6592
153 Ga0068864_100025879 3300005618 Unclassified 4944
154 Ga0068864_100282096 3300005618 Bacteria 1551
155 Ga0068864_100873521 3300005618 Bacteria 887
156 Ga0068866_10058029 3300005718 Unclassified 1997
157 Ga0068866_10067772 3300005718 Bacteria 1874
158 Ga0068866_10079811 3300005718 Bacteria 1754
159 Ga0068861_100031835 3300005719 Unclassified 3879
160 Ga0068861_100058009 3300005719 Bacteria 2959
161 Ga0068861_100089572 3300005719 Unclassified 2425
162 Ga0068870_10006697 3300005840 Bacteria 5097
163 Ga0068870_10012321 3300005840 Unclassified 3994
164 Ga0068863_100052577 3300005841 Bacteria 3860
165 Ga0068863_100067901 3300005841 Bacteria 3372
166 Ga0068863_100159058 3300005841 Bacteria 2164
167 Ga0068863_100200627 3300005841 Bacteria 1919
168 Ga0068863_100235648 3300005841 Bacteria 1766
169 Ga0068858_100076474 3300005842 Bacteria 3109
170 Ga0068858_100219235 3300005842 Unclassified 1801
171 Ga0068858_100378159 3300005842 Bacteria 1359
172 Ga0068860_100033850 3300005843 Bacteria 4902
173 Ga0068860_100048239 3300005843 Bacteria 4058
174 Ga0068860_100085768 3300005843 Unclassified 2996
175 Ga0068860_100300310 3300005843 Bacteria 1573
176 Ga0068860_100449180 3300005843 Unclassified 1282
177 Ga0068862_100008687 3300005844 Bacteria 8404
178 Ga0068862_100043060 3300005844 Bacteria 3848
179 Ga0068862_100139344 3300005844 Bacteria 2152
180 Ga0068862_100198895 3300005844 Bacteria 1806
181 Ga0068862_100655857 3300005844 Bacteria 1013
182 Ga0075366_10009888 3300006195 Bacteria 5336
183 Ga0075366_10081022 3300006195 Bacteria 1938
184 Ga0097621_100033676 3300006237 Bacteria 4082
185 Ga0097621_100137485 3300006237 Bacteria 2085
186 Ga0097621_100280189 3300006237 Bacteria 1467
187 Ga0097621_100456278 3300006237 Unclassified 1152
188 Ga0097621_100869669 3300006237 Bacteria 838
189 Ga0068871_100027169 3300006358 Bacteria 4472
190 Ga0068871_100037855 3300006358 Bacteria 3849
191 Ga0068871_100262435 3300006358 Unclassified 1507
192 Ga0075428_100019102 3300006844 Bacteria 7580
193 Ga0075428_100094079 3300006844 Bacteria 3267
194 Ga0075428_100127646 3300006844 Bacteria 2767
195 Ga0075428_100268199 3300006844 Unclassified 1837
196 Ga0075430_100090947 3300006846 Unclassified 2552
197 Ga0075431_100033404 3300006847 Bacteria 5303
198 Ga0075434_100213813 3300006871 Unclassified 1948
199 Ga0075429_100011301 3300006880 Bacteria 7730
200 Ga0075429_100035795 3300006880 Bacteria 4318
201 Ga0068865_100041856 3300006881 Bacteria 3120
202 Ga0068865_100055639 3300006881 Bacteria 2754
203 Ga0068865_100300841 3300006881 Bacteria 1284
204 Ga0097620_100000066 3300006931 Bacteria 100640
205 Ga0097620_100015491 3300006931 Bacteria 7661
206 Ga0097620_100025287 3300006931 Bacteria 5956
207 Ga0097620_100030780 3300006931 Bacteria 5386
208 Ga0097620_100091324 3300006931 Bacteria 3096
209 Ga0097620_100093398 3300006931 Bacteria 3060
210 Ga0097620_100147322 3300006931 Bacteria 2429
211 Ga0097620_100250201 3300006931 Bacteria 1863
212 Ga0097620_100279611 3300006931 Unclassified 1762
213 Ga0097620_100871962 3300006931 Bacteria 986
214 Ga0111539_10841852 3300009094 Bacteria 1067
215 Ga0105245_10176718 3300009098 Bacteria 2037
216 Ga0105245_10255674 3300009098 Unclassified 1703
217 Ga0105247_10004254 3300009101 Bacteria 9174
218 Ga0105247_10006282 3300009101 Bacteria 7369
219 Ga0105247_10054184 3300009101 Unclassified 2475
220 Ga0105247_10314884 3300009101 Unclassified 1090
221 Ga0114129_10079010 3300009147 Bacteria 4574
222 Ga0114129_10840440 3300009147 Bacteria 1168
223 Ga0114129_10879857 3300009147 Bacteria 1136
224 Ga0105241_10008638 3300009174 Bacteria 7488
225 Ga0105242_10055283 3300009176 Bacteria 3248
226 Ga0105242_10061357 3300009176 Bacteria 3092
227 Ga0105242_10086718 3300009176 Unclassified 2627
228 Ga0105242_10120644 3300009176 Bacteria 2249
229 Ga0105242_10122758 3300009176 Bacteria 2232
230 Ga0105242_10124855 3300009176 Bacteria 2214
231 Ga0105242_10163993 3300009176 Bacteria 1947
232 Ga0105242_10271018 3300009176 Bacteria 1538
233 Ga0105242_10960324 3300009176 Bacteria 859
234 Ga0105248_10348874 3300009177 Bacteria 1666
235 Ga0105248_11174845 3300009177 Bacteria 867
236 Ga0105237_10034436 3300009545 Bacteria 5128
237 Ga0105237_10123648 3300009545 Bacteria 2582
238 Ga0105237_10444541 3300009545 Bacteria 1302
239 Ga0105249_10006736 3300009553 Bacteria 10010
240 Ga0105249_10007280 3300009553 Bacteria 9652
241 Ga0105249_10017668 3300009553 Bacteria 6336
242 Ga0105249_10019864 3300009553 Bacteria 5999
243 Ga0105249_10025363 3300009553 Bacteria 5336
244 Ga0105249_10049597 3300009553 Unclassified 3828
245 Ga0105249_10073910 3300009553 Unclassified 3154
246 Ga0105249_10168859 3300009553 Bacteria 2120
247 Ga0105249_10267243 3300009553 Unclassified 1702
248 Ga0105249_10296354 3300009553 Unclassified 1620
249 Ga0105249_10315322 3300009553 Bacteria 1573
250 Ga0105249_10354695 3300009553 Bacteria 1487
251 Ga0105249_11266700 3300009553 Bacteria 809
252 Ga0105239_10258199 3300010375 Bacteria 1958
253 Ga0105239_10346493 3300010375 Bacteria 1677
254 Ga0105246_10005671 3300011119 Bacteria 7618
255 Ga0105246_10301533 3300011119 Unclassified 1294
256 Ga0157373_10001922 3300013100 Bacteria 15789
257 Ga0157374_10002882 3300013296 Bacteria 14430
258 Ga0157374_10005717 3300013296 Bacteria 10490
259 Ga0157374_10272331 3300013296 Bacteria 1670
260 Ga0157378_10123712 3300013297 Bacteria 2387
261 Ga0157378_10200812 3300013297 Bacteria 1886
262 Ga0157378_10232109 3300013297 Unclassified 1759
263 Ga0157378_10821303 3300013297 Unclassified 956
264 Ga0163162_10002903 3300013306 Bacteria 16325
265 Ga0163162_10007169 3300013306 Bacteria 10824
266 Ga0163162_10172884 3300013306 Bacteria 2285
267 Ga0163162_10259946 3300013306 Bacteria 1868
268 Ga0163162_10321164 3300013306 Unclassified 1681
269 Ga0157372_10158258 3300013307 Bacteria 2617
270 Ga0157372_10304365 3300013307 Unclassified 1854
271 Ga0157372_10472189 3300013307 Bacteria 1462
272 Ga0157372_10825860 3300013307 Bacteria 1076
273 Ga0157372_10871045 3300013307 Unclassified 1045
274 Ga0157375_10011189 3300013308 Bacteria 7916
275 Ga0157375_10013253 3300013308 Bacteria 7330
276 Ga0157375_10022035 3300013308 Bacteria 5859
277 Ga0157375_10040426 3300013308 Bacteria 4495
278 Ga0157375_10094421 3300013308 Bacteria 3060
279 Ga0157375_10333400 3300013308 Bacteria 1682
280 Ga0163163_10000291 3300014325 Bacteria 49869
281 Ga0163163_10112985 3300014325 Bacteria 2746
282 Ga0163163_10131378 3300014325 Unclassified 2544
283 Ga0163163_10146317 3300014325 Unclassified 2407
284 Ga0163163_10169231 3300014325 Bacteria 2231
285 Ga0163163_10312638 3300014325 Bacteria 1624
286 Ga0163163_10592471 3300014325 Unclassified 1172
287 Ga0157380_10007052 3300014326 Bacteria 7955
288 Ga0157380_10054411 3300014326 Bacteria 3176
289 Ga0157380_10301292 3300014326 Bacteria 1477
290 Ga0157380_10777407 3300014326 Bacteria 972
291 Ga0157380_10917655 3300014326 Bacteria 903
292 Ga0157377_10004471 3300014745 Bacteria 6445
293 Ga0157377_10005773 3300014745 Bacteria 5843
294 Ga0157377_10126233 3300014745 Bacteria 1557
295 Ga0157379_10044735 3300014968 Unclassified 3952
296 Ga0157379_10238756 3300014968 Bacteria 1648
297 Ga0157379_10255475 3300014968 Bacteria 1591
298 Ga0157379_10472873 3300014968 Unclassified 1159
299 Ga0157379_10538306 3300014968 Unclassified 1085
300 Ga0157376_10007675 3300014969 Bacteria 7726
301 Ga0157376_10019909 3300014969 Bacteria 5181
302 Ga0157376_10042292 3300014969 Bacteria 3735
303 Ga0157376_10169939 3300014969 Unclassified 1984
304 Ga0157376_10270202 3300014969 Bacteria 1597
305 Ga0157376_10405084 3300014969 Bacteria 1320
306 Ga0163161_10004692 3300017792 Bacteria 9505
307 Ga0163161_10188499 3300017792 Bacteria 1584
308 Ga0163161_10543237 3300017792 Unclassified 952
309 Ga0207697_10044900 3300025315 Bacteria 1818
310 Ga0207682_10093839 3300025893 Bacteria 1305
311 Ga0207642_10021560 3300025899 Bacteria 2538
312 Ga0207710_10001169 3300025900 Bacteria 13363
313 Ga0207688_10018285 3300025901 Bacteria 3815
314 Ga0207688_10056851 3300025901 Bacteria 2198
315 Ga0207680_10000143 3300025903 Bacteria 34125
316 Ga0207680_10067568 3300025903 Unclassified 2202
317 Ga0207647_10001440 3300025904 Bacteria 18249
318 Ga0207647_10051923 3300025904 Bacteria 2531
319 Ga0207645_10001094 3300025907 Bacteria 22378
320 Ga0207645_10019751 3300025907 Bacteria 4414
321 Ga0207645_10276091 3300025907 Unclassified 1115
322 Ga0207645_10725362 3300025907 Unclassified 676
323 Ga0207643_10005716 3300025908 Bacteria 6650
324 Ga0207643_10027154 3300025908 Bacteria 3172
325 Ga0207654_10006391 3300025911 Bacteria 5930
326 Ga0207671_10023966 3300025914 Bacteria 4594
327 Ga0207671_10452471 3300025914 Bacteria 1023
328 Ga0207662_10015609 3300025918 Bacteria 4275
329 Ga0207649_10041888 3300025920 Bacteria 2790
330 Ga0207649_10124479 3300025920 Bacteria 1742
331 Ga0207649_10147263 3300025920 Bacteria 1618
332 Ga0207681_10094617 3300025923 Bacteria 2141
333 Ga0207681_10109297 3300025923 Bacteria 2009
334 Ga0207650_10013442 3300025925 Bacteria 5668
335 Ga0207650_10017123 3300025925 Bacteria 5073
336 Ga0207650_10057050 3300025925 Unclassified 2904
337 Ga0207650_10171041 3300025925 Bacteria 1727
338 Ga0207659_10092331 3300025926 Bacteria 2263
339 Ga0207659_10176206 3300025926 Bacteria 1690
340 Ga0207644_10016189 3300025931 Bacteria 5017
341 Ga0207690_10119304 3300025932 Bacteria 1913
342 Ga0207690_10133236 3300025932 Bacteria 1822
343 Ga0207690_10902232 3300025932 Bacteria 733
344 Ga0207706_10016213 3300025933 Bacteria 6733
345 Ga0207706_10025162 3300025933 Bacteria 5336
346 Ga0207706_10044736 3300025933 Bacteria 3923
347 Ga0207706_10132577 3300025933 Unclassified 2192
348 Ga0207706_10151281 3300025933 Bacteria 2041
349 Ga0207686_10005851 3300025934 Bacteria 6599
350 Ga0207686_10087347 3300025934 Unclassified 2050
351 Ga0207686_10114290 3300025934 Unclassified 1826
352 Ga0207686_10265425 3300025934 Bacteria 1260
353 Ga0207686_10617374 3300025934 Bacteria 855
354 Ga0207670_10009430 3300025936 Bacteria 5572
355 Ga0207670_10016388 3300025936 Bacteria 4453
356 Ga0207670_10020834 3300025936 Bacteria 4035
357 Ga0207670_10076691 3300025936 Unclassified 2326
358 Ga0207669_10058895 3300025937 Bacteria 2346
359 Ga0207704_10158974 3300025938 Bacteria 1605
360 Ga0207704_10357986 3300025938 Bacteria 1138
361 Ga0207691_10027599 3300025940 Bacteria 5322
362 Ga0207691_10047277 3300025940 Bacteria 3949
363 Ga0207691_10060522 3300025940 Bacteria 3440
364 Ga0207691_10100077 3300025940 Bacteria 2588
365 Ga0207691_10373039 3300025940 Bacteria 1219
366 Ga0207689_10004463 3300025942 Bacteria 12688
367 Ga0207689_10010546 3300025942 Bacteria 7956
368 Ga0207689_10010855 3300025942 Bacteria 7836
369 Ga0207689_10021822 3300025942 Bacteria 5384
370 Ga0207689_10034332 3300025942 Bacteria 4213
371 Ga0207689_10060323 3300025942 Bacteria 3119
372 Ga0207689_10060960 3300025942 Bacteria 3102
373 Ga0207689_10351271 3300025942 Unclassified 1226
374 Ga0207689_10356935 3300025942 Bacteria 1215
375 Ga0207689_10461268 3300025942 Unclassified 1062
376 Ga0207661_10009064 3300025944 Bacteria 7130
377 Ga0207679_10029691 3300025945 Bacteria 3809
378 Ga0207679_10057464 3300025945 Bacteria 2878
379 Ga0207679_10239726 3300025945 Bacteria 1536
380 Ga0207679_10440883 3300025945 Unclassified 1153
381 Ga0207651_10096165 3300025960 Bacteria 2183
382 Ga0207651_10114328 3300025960 Bacteria 2033
383 Ga0207651_10124342 3300025960 Bacteria 1962
384 Ga0207651_10305297 3300025960 Unclassified 1325
385 Ga0207651_10443524 3300025960 Bacteria 1112
386 Ga0207712_10002687 3300025961 Bacteria 11355
387 Ga0207712_10018778 3300025961 Bacteria 4508
388 Ga0207712_10039413 3300025961 Bacteria 3237
389 Ga0207712_10051816 3300025961 Bacteria 2872
390 Ga0207712_10429639 3300025961 Bacteria 1116
391 Ga0207712_10437847 3300025961 Unclassified 1106
392 Ga0207668_10016218 3300025972 Unclassified 4645
393 Ga0207668_10057724 3300025972 Unclassified 2709
394 Ga0207640_10065437 3300025981 Bacteria 2426
395 Ga0207640_10133216 3300025981 Bacteria 1799
396 Ga0207640_10488960 3300025981 Bacteria 1022
397 Ga0207640_10543234 3300025981 Bacteria 975
398 Ga0207640_10621912 3300025981 Bacteria 917
399 Ga0207658_10023748 3300025986 Unclassified 4283
400 Ga0207658_10037846 3300025986 Bacteria 3471
401 Ga0207658_10160332 3300025986 Bacteria 1843
402 Ga0207677_10019976 3300026023 Bacteria 4057
403 Ga0207677_10145361 3300026023 Unclassified 1821
404 Ga0207677_10720289 3300026023 Bacteria 887
405 Ga0207703_10047882 3300026035 Bacteria 3448
406 Ga0207703_10117164 3300026035 Unclassified 2281
407 Ga0207703_10242537 3300026035 Bacteria 1621
408 Ga0207639_10003629 3300026041 Bacteria 10365
409 Ga0207639_10201956 3300026041 Bacteria 1705
410 Ga0207678_10026498 3300026067 Bacteria 5056
411 Ga0207708_10015218 3300026075 Bacteria 5767
412 Ga0207708_10324012 3300026075 Bacteria 1258
413 Ga0207641_10002394 3300026088 Bacteria 17303
414 Ga0207641_10006787 3300026088 Bacteria 9592
415 Ga0207641_10247296 3300026088 Bacteria 1664
416 Ga0207641_10359346 3300026088 Unclassified 1390
417 Ga0207641_11029081 3300026088 Bacteria 821
418 Ga0207648_10008405 3300026089 Bacteria 9998
419 Ga0207648_10017531 3300026089 Bacteria 6510
420 Ga0207648_10057583 3300026089 Bacteria 3390
421 Ga0207648_10114317 3300026089 Unclassified 2371
422 Ga0207648_10243805 3300026089 Bacteria 1601
423 Ga0207676_10049439 3300026095 Bacteria 3271
424 Ga0207676_10088892 3300026095 Unclassified 2530
425 Ga0207676_10204746 3300026095 Unclassified 1746
426 Ga0207676_10360638 3300026095 Bacteria 1347
427 Ga0207676_10392065 3300026095 Bacteria 1295
428 Ga0207674_10002593 3300026116 Bacteria 22767
429 Ga0207674_10010658 3300026116 Bacteria 10394
430 Ga0207674_10047528 3300026116 Bacteria 4398
431 Ga0207674_10064985 3300026116 Unclassified 3679
432 Ga0207674_10214035 3300026116 Unclassified 1876
433 Ga0207674_10436843 3300026116 Unclassified 1265
434 Ga0207674_10513391 3300026116 Bacteria 1157
435 Ga0207675_100003136 3300026118 Bacteria 16207
436 Ga0207675_100049699 3300026118 Bacteria 3913
437 Ga0207675_100056577 3300026118 Bacteria 3658
438 Ga0207675_100073007 3300026118 Bacteria 3209
439 Ga0207675_100103758 3300026118 Bacteria 2679
440 Ga0207675_100211192 3300026118 Unclassified 1867
441 Ga0207683_10002268 3300026121 Bacteria 16855
442 Ga0207683_10167792 3300026121 Bacteria 1987
443 Ga0207698_10015088 3300026142 Bacteria 5163
444 Ga0207698_10049040 3300026142 Unclassified 3211
445 Ga0207698_10204643 3300026142 Bacteria 1771
446 Ga0207698_10489675 3300026142 Bacteria 1194
447 Ga0207428_10387376 3300027907 Unclassified 1025
448 Ga0268266_10039603 3300028379 Bacteria 4015
449 Ga0268266_10460328 3300028379 Unclassified 1210
450 Ga0268266_10513969 3300028379 Bacteria 1144
451 Ga0268265_10086472 3300028380 Bacteria 2492
452 Ga0268265_10256902 3300028380 Bacteria 1551
453 Ga0268265_10346909 3300028380 Unclassified 1354
454 Ga0268265_10704855 3300028380 Bacteria 976
455 Ga0268264_10001339 3300028381 Bacteria 23170
456 Ga0268264_10074647 3300028381 Unclassified 2881
457 Ga0268264_10092410 3300028381 Bacteria 2612
458 Ga0268264_10246674 3300028381 Bacteria 1657
459 Ga0268264_10294092 3300028381 Unclassified 1526
460 Ga0307515_10000251 3300028794 Bacteria 132970
461 Ga0307511_10000138 3300030521 Bacteria 67742
462 Ga0307513_10262733 3300031456 Bacteria 1515
463 Ga0307508_10276992 3300031616 Bacteria 1271
464 Ga0307410_10226213 3300031852 Bacteria 1442
465 Ga0307406_10519100 3300031901 Unclassified 969
466 Ga0373936_0213268 3300035113 Bacteria 855
467 Ga0373954_0199752 3300035118 Bacteria 982
468 Ga0373956_0046887 3300035119 Bacteria 1932
469 Ga0373955_0033269 3300035172 Bacteria 2714
470 Ga0373935_0372792 3300035692 Bacteria 1021
471 Ga0373947_0519612 3300035725 Unclassified 810
472 Ga0373937_0008186 3300036401 Bacteria 9081
473 Ga0395900_1101953 3300037418 Bacteria 711
474 Ga0395905_0012427 3300037471 Bacteria 8195
475 Ga0395905_0377900 3300037471 Bacteria 1310
476 Ga0439439_0005943 3300041406 Bacteria 2811
477 Ga0439466_0083777 3300041411 Unclassified 1004
478 Ga0439465_0026644 3300041413 Unclassified 1829
479 Ga0439442_007625 3300042002 Bacteria 2181
480 Ga0450897_004621 3300042128 Bacteria 1160
481 Ga0439434_0004879 3300042435 Bacteria 3925
482 Ga0453683_0680881 3300044673 Bacteria 673
483 Ga0453684_0055495 3300044712 Bacteria 5150
484 Ga0453684_0121228 3300044712 Bacteria 3157
485 Ga0495592_0090305 3300046454 Bacteria 2198
486 Ga0495638_0093872 3300046460 Bacteria 1804
487 Ga0495650_0010917 3300046471 Bacteria 5027
488 Ga0495608_0039503 3300046511 Bacteria 3163
489 Ga0495628_0021658 3300046516 Bacteria 5284
490 Ga0495630_0002943 3300046517 Bacteria 11831
491 Ga0495643_0021900 3300046522 Bacteria 3656
492 Ga0495652_0090166 3300046529 Bacteria 2509
493 Ga0495586_0134474 3300046535 Bacteria 1385
494 Ga0495621_0003264 3300046539 Bacteria 4458
495 Ga0495668_0015303 3300046616 Bacteria 4484
496 Ga0495625_0096412 3300046660 Bacteria 2038
497 Ga0495635_0058812 3300046663 Bacteria 2644
498 Ga0495599_0428246 3300046678 Bacteria 785
499 Ga0495658_0084119 3300046683 Bacteria 1873
500 Ga0495600_0417943 3300046809 Bacteria 832
501 Ga0495604_0100466 3300047317 Bacteria 2127
502 Ga0495674_0247716 3300047319 Bacteria 1467
503 Ga0495684_0169275 3300047471 Bacteria 1626
504 Ga0495686_0075283 3300047472 Bacteria 2070
505 Ga0496110_0174120 3300048913 Bacteria 1953
506 Ga0501031_0002980 3300049568 Bacteria 10838
507 Ga0501032_0001819 3300049569 Bacteria 16849
508 Ga0501034_0009140 3300049571 Bacteria 10401
509 Ga0501036_0002939 3300049572 Bacteria 13533
510 Ga0501037_0006843 3300049573 Bacteria 8330
511 Ga0501037_0196857 3300049573 Bacteria 1425
512 Ga0501038_0031413 3300049574 Bacteria 4693
513 Ga0501038_0032542 3300049574 Bacteria 4600
514 Ga0501039_0021426 3300049575 Bacteria 4958
515 Ga0501039_0030288 3300049575 Bacteria 4172
516 Ga0501043_0003722 3300049579 Bacteria 12533
517 Ga0501043_0023028 3300049579 Bacteria 4885
518 Ga0501043_0090559 3300049579 Bacteria 2405
519 Ga0501046_0086039 3300049580 Bacteria 2423
520 Ga0501047_0076780 3300049581 Bacteria 3215
521 Ga0501047_0091822 3300049581 Bacteria 2914
522 Ga0501048_0053691 3300049582 Bacteria 2864
523 Ga0501073_0008529 3300049589 Bacteria 7598
524 Ga0501073_0198683 3300049589 Bacteria 1387
525 Ga0501074_0004288 3300049590 Bacteria 10181
526 Ga0501079_0274908 3300049741 Bacteria 1317
527 Ga0501080_0220570 3300049742 Bacteria 1735
528 Ga0501083_0179335 3300049744 Bacteria 1383
529 Ga0501035_0034165 3300049822 Bacteria 4622
530 Ga0501035_0208195 3300049822 Bacteria 1674
531 Ga0501044_0028871 3300049823 Bacteria 5851
532 Ga0501044_0133028 3300049823 Unclassified 2480
533 nmdc:mga0k408_138676_c1 3300050493 Bacteria 1446
534 nmdc:mga0k408_43685_c1 3300050493 Bacteria 2583
535 nmdc:mga05p37_121488_c1 3300050507 Bacteria 3208
536 nmdc:mga09592_178711_c1 3300050508 Bacteria 1836
537 nmdc:mga09592_7777_c1 3300050508 Bacteria 8710
538 nmdc:mga0qj67_127718_c1 3300050509 Bacteria 2058
539 nmdc:mga06r32_53835_c1 3300050510 Bacteria 3857
540 nmdc:mga08y16_908280_c1 3300050511 Bacteria 866
541 nmdc:mga0n895_591325_c1 3300050512 Bacteria 1113
542 Ga0500568_0002589 3300053139 Bacteria 10519
543 Ga0500616_0011570 3300053153 Bacteria 5202
544 Ga0500611_000096 3300053727 Bacteria 24910

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026088 Ga0207641_11029081 Ga0207641_110290812 175
2 3300014969 Ga0157376_10270202 Ga0157376_102702022 180
3 3300025923 Ga0207681_10109297 Ga0207681_101092973 180
4 3300005539 Ga0068853_100324281 Ga0068853_1003242813 184
5 3300009545 Ga0105237_10444541 Ga0105237_104445412 185
6 3300005334 Ga0068869_100269356 Ga0068869_1002693562 187
7 3300009553 Ga0105249_10315322 Ga0105249_103153222 187
8 3300009545 Ga0105237_10034436 Ga0105237_100344365 189
9 3300025914 Ga0207671_10452471 Ga0207671_104524712 190
10 3300031852 Ga0307410_10226213 Ga0307410_102262132 195
11 3300053139 Ga0500568_0002589 Ga0500568_0002589_5284_5898 195
12 3300005327 Ga0070658_10341260 Ga0070658_103412602 196
13 3300005331 Ga0070670_100183751 Ga0070670_1001837511 196
14 3300005331 Ga0070670_100665972 Ga0070670_1006659722 196
15 3300005338 Ga0068868_100150522 Ga0068868_1001505223 196
16 3300005364 Ga0070673_100213718 Ga0070673_1002137182 196
17 3300005366 Ga0070659_100167342 Ga0070659_1001673423 196
18 3300005539 Ga0068853_100109982 Ga0068853_1001099824 196
19 3300005539 Ga0068853_100607761 Ga0068853_1006077612 196
20 3300005543 Ga0070672_100084486 Ga0070672_1000844863 196
21 3300005577 Ga0068857_100074620 Ga0068857_1000746203 196
22 3300005616 Ga0068852_100053055 Ga0068852_1000530555 196
23 3300005616 Ga0068852_100215352 Ga0068852_1002153523 196
24 3300006195 Ga0075366_10009888 Ga0075366_100098888 196
25 3300013307 Ga0157372_10158258 Ga0157372_101582582 196
26 3300013307 Ga0157372_10304365 Ga0157372_103043652 196
27 3300013307 Ga0157372_10472189 Ga0157372_104721892 196
28 3300013307 Ga0157372_10825860 Ga0157372_108258602 196
29 3300025904 Ga0207647_10001440 Ga0207647_1000144018 196
30 3300025920 Ga0207649_10147263 Ga0207649_101472631 196
31 3300025932 Ga0207690_10119304 Ga0207690_101193044 196
32 3300025940 Ga0207691_10373039 Ga0207691_103730391 196
33 3300025960 Ga0207651_10305297 Ga0207651_103052972 196
34 3300026023 Ga0207677_10720289 Ga0207677_107202892 196
35 3300026116 Ga0207674_10064985 Ga0207674_100649853 196
36 3300026142 Ga0207698_10015088 Ga0207698_100150883 196
37 3300028794 Ga0307515_10000251 Ga0307515_1000025171 196
38 3300031456 Ga0307513_10262733 Ga0307513_102627332 196
39 3300031616 Ga0307508_10276992 Ga0307508_102769922 196
40 3300044712 Ga0453684_0055495 Ga0453684_0055495_4039_4683 196
41 3300046660 Ga0495625_0096412 Ga0495625_0096412_212_928 196
42 3300047472 Ga0495686_0075283 Ga0495686_0075283_157_774 196
43 3300049579 Ga0501043_0090559 Ga0501043_0090559_1394_2038 196
44 3300050493 nmdc:mga0k408_138676_c1 nmdc:mga0k408_138676_c1_29_646 196
45 3300003322 rootL2_10098982 rootL2_100989824 197
46 3300003322 rootL2_10315015 rootL2_103150153 197
47 3300005288 Ga0065714_10122454 Ga0065714_101224542 197
48 3300005290 Ga0065712_10006497 Ga0065712_100064972 197
49 3300005290 Ga0065712_10007690 Ga0065712_100076902 197
50 3300005290 Ga0065712_10098895 Ga0065712_100988952 197
51 3300005293 Ga0065715_10129527 Ga0065715_101295272 197
52 3300005295 Ga0065707_10113208 Ga0065707_101132082 197
53 3300005295 Ga0065707_10340952 Ga0065707_103409522 197
54 3300005328 Ga0070676_10020723 Ga0070676_100207234 197
55 3300005328 Ga0070676_10022991 Ga0070676_100229914 197
56 3300005328 Ga0070676_10058594 Ga0070676_100585943 197
57 3300005328 Ga0070676_10262227 Ga0070676_102622271 197
58 3300005329 Ga0070683_100007495 Ga0070683_1000074951 197
59 3300005329 Ga0070683_100008296 Ga0070683_1000082966 197
60 3300005330 Ga0070690_100004288 Ga0070690_10000428810 197
61 3300005331 Ga0070670_100014926 Ga0070670_1000149266 197
62 3300005331 Ga0070670_100020723 Ga0070670_1000207233 197
63 3300005331 Ga0070670_100041924 Ga0070670_1000419242 197
64 3300005331 Ga0070670_100097616 Ga0070670_1000976164 197
65 3300005331 Ga0070670_100232342 Ga0070670_1002323421 197
66 3300005331 Ga0070670_100298205 Ga0070670_1002982052 197
67 3300005333 Ga0070677_10312560 Ga0070677_103125601 197
68 3300005334 Ga0068869_100001737 Ga0068869_1000017376 197
69 3300005334 Ga0068869_100029015 Ga0068869_1000290154 197
70 3300005334 Ga0068869_100057728 Ga0068869_1000577282 197
71 3300005334 Ga0068869_100063976 Ga0068869_1000639762 197
72 3300005334 Ga0068869_100066249 Ga0068869_1000662492 197
73 3300005334 Ga0068869_100176048 Ga0068869_1001760482 197
74 3300005334 Ga0068869_100367595 Ga0068869_1003675952 197
75 3300005335 Ga0070666_10000343 Ga0070666_1000034327 197
76 3300005335 Ga0070666_10049250 Ga0070666_100492503 197
77 3300005335 Ga0070666_10113935 Ga0070666_101139352 197
78 3300005335 Ga0070666_10142434 Ga0070666_101424342 197
79 3300005337 Ga0070682_100172780 Ga0070682_1001727802 197
80 3300005338 Ga0068868_100001438 Ga0068868_1000014384 197
81 3300005338 Ga0068868_100022095 Ga0068868_1000220956 197
82 3300005338 Ga0068868_100054884 Ga0068868_1000548844 197
83 3300005338 Ga0068868_100091371 Ga0068868_1000913714 197
84 3300005338 Ga0068868_100121815 Ga0068868_1001218154 197
85 3300005338 Ga0068868_100446509 Ga0068868_1004465092 197
86 3300005338 Ga0068868_100936540 Ga0068868_1009365401 197
87 3300005339 Ga0070660_100128883 Ga0070660_1001288834 197
88 3300005340 Ga0070689_100006180 Ga0070689_1000061806 197
89 3300005340 Ga0070689_100011429 Ga0070689_1000114295 197
90 3300005340 Ga0070689_100030912 Ga0070689_1000309125 197
91 3300005340 Ga0070689_100059038 Ga0070689_1000590385 197
92 3300005340 Ga0070689_100327116 Ga0070689_1003271162 197
93 3300005343 Ga0070687_100207424 Ga0070687_1002074242 197
94 3300005344 Ga0070661_100007580 Ga0070661_1000075806 197
95 3300005344 Ga0070661_100026972 Ga0070661_1000269724 197
96 3300005344 Ga0070661_100098831 Ga0070661_1000988311 197
97 3300005347 Ga0070668_100112809 Ga0070668_1001128091 197
98 3300005347 Ga0070668_100155417 Ga0070668_1001554172 197
99 3300005353 Ga0070669_100006405 Ga0070669_1000064058 197
100 3300005353 Ga0070669_100021734 Ga0070669_1000217345 197
101 3300005353 Ga0070669_100078084 Ga0070669_1000780842 197
102 3300005353 Ga0070669_100453399 Ga0070669_1004533991 197
103 3300005354 Ga0070675_100047469 Ga0070675_1000474695 197
104 3300005354 Ga0070675_100146396 Ga0070675_1001463963 197
105 3300005354 Ga0070675_100209227 Ga0070675_1002092272 197
106 3300005354 Ga0070675_100220645 Ga0070675_1002206452 197
107 3300005354 Ga0070675_100363534 Ga0070675_1003635342 197
108 3300005355 Ga0070671_100009808 Ga0070671_1000098086 197
109 3300005355 Ga0070671_100241392 Ga0070671_1002413921 197
110 3300005356 Ga0070674_100024438 Ga0070674_1000244384 197
111 3300005356 Ga0070674_100522031 Ga0070674_1005220311 197
112 3300005364 Ga0070673_100008635 Ga0070673_1000086358 197
113 3300005364 Ga0070673_100014035 Ga0070673_1000140352 197
114 3300005364 Ga0070673_100024564 Ga0070673_1000245645 197
115 3300005364 Ga0070673_100067345 Ga0070673_1000673452 197
116 3300005364 Ga0070673_100074170 Ga0070673_1000741704 197
117 3300005364 Ga0070673_100075945 Ga0070673_1000759454 197
118 3300005364 Ga0070673_100325998 Ga0070673_1003259982 197
119 3300005364 Ga0070673_100621270 Ga0070673_1006212701 197
120 3300005365 Ga0070688_100013508 Ga0070688_1000135083 197
121 3300005365 Ga0070688_100014621 Ga0070688_1000146213 197
122 3300005365 Ga0070688_100047235 Ga0070688_1000472352 197
123 3300005365 Ga0070688_100645290 Ga0070688_1006452901 197
124 3300005366 Ga0070659_100150711 Ga0070659_1001507112 197
125 3300005366 Ga0070659_100180741 Ga0070659_1001807413 197
126 3300005367 Ga0070667_100009014 Ga0070667_1000090146 197
127 3300005367 Ga0070667_100223318 Ga0070667_1002233182 197
128 3300005367 Ga0070667_100820751 Ga0070667_1008207511 197
129 3300005441 Ga0070700_100262039 Ga0070700_1002620392 197
130 3300005455 Ga0070663_100065342 Ga0070663_1000653422 197
131 3300005455 Ga0070663_100437369 Ga0070663_1004373692 197
132 3300005456 Ga0070678_100117032 Ga0070678_1001170321 197
133 3300005456 Ga0070678_100179503 Ga0070678_1001795033 197
134 3300005457 Ga0070662_100005363 Ga0070662_1000053636 197
135 3300005457 Ga0070662_100101298 Ga0070662_1001012982 197
136 3300005459 Ga0068867_100014632 Ga0068867_1000146326 197
137 3300005459 Ga0068867_100025843 Ga0068867_1000258431 197
138 3300005459 Ga0068867_100091115 Ga0068867_1000911152 197
139 3300005466 Ga0070685_10015189 Ga0070685_100151892 197
140 3300005466 Ga0070685_10027916 Ga0070685_100279165 197
141 3300005466 Ga0070685_10237405 Ga0070685_102374052 197
142 3300005471 Ga0070698_100031402 Ga0070698_1000314026 197
143 3300005471 Ga0070698_100049843 Ga0070698_1000498434 197
144 3300005535 Ga0070684_100010482 Ga0070684_1000104828 197
145 3300005535 Ga0070684_100102457 Ga0070684_1001024573 197
146 3300005536 Ga0070697_100375133 Ga0070697_1003751332 197
147 3300005539 Ga0068853_100006317 Ga0068853_1000063172 197
148 3300005539 Ga0068853_100007339 Ga0068853_1000073393 197
149 3300005539 Ga0068853_100096336 Ga0068853_1000963364 197
150 3300005543 Ga0070672_100198501 Ga0070672_1001985012 197
151 3300005545 Ga0070695_100366588 Ga0070695_1003665882 197
152 3300005547 Ga0070693_100131867 Ga0070693_1001318672 197
153 3300005548 Ga0070665_100014018 Ga0070665_1000140185 197
154 3300005548 Ga0070665_100226519 Ga0070665_1002265191 197
155 3300005548 Ga0070665_100639134 Ga0070665_1006391342 197
156 3300005548 Ga0070665_100897692 Ga0070665_1008976921 197
157 3300005549 Ga0070704_100260834 Ga0070704_1002608342 197
158 3300005564 Ga0070664_100024452 Ga0070664_1000244526 197
159 3300005564 Ga0070664_100034101 Ga0070664_1000341014 197
160 3300005564 Ga0070664_100074769 Ga0070664_1000747694 197
161 3300005564 Ga0070664_100156791 Ga0070664_1001567912 197
162 3300005564 Ga0070664_100162738 Ga0070664_1001627383 197
163 3300005564 Ga0070664_100520314 Ga0070664_1005203142 197
164 3300005577 Ga0068857_100026901 Ga0068857_1000269017 197
165 3300005577 Ga0068857_100231154 Ga0068857_1002311543 197
166 3300005578 Ga0068854_100079992 Ga0068854_1000799924 197
167 3300005578 Ga0068854_100162105 Ga0068854_1001621053 197
168 3300005578 Ga0068854_100359769 Ga0068854_1003597692 197
169 3300005578 Ga0068854_100596925 Ga0068854_1005969251 197
170 3300005616 Ga0068852_100049368 Ga0068852_1000493684 197
171 3300005617 Ga0068859_100000066 Ga0068859_10000006666 197
172 3300005617 Ga0068859_100015491 Ga0068859_1000154915 197
173 3300005617 Ga0068859_100025287 Ga0068859_1000252875 197
174 3300005617 Ga0068859_100030780 Ga0068859_1000307807 197
175 3300005617 Ga0068859_100091324 Ga0068859_1000913242 197
176 3300005617 Ga0068859_100093399 Ga0068859_1000933995 197
177 3300005617 Ga0068859_100147331 Ga0068859_1001473314 197
178 3300005617 Ga0068859_100250180 Ga0068859_1002501801 197
179 3300005617 Ga0068859_100279610 Ga0068859_1002796103 197
180 3300005617 Ga0068859_100871955 Ga0068859_1008719551 197
181 3300005618 Ga0068864_100002791 Ga0068864_10000279113 197
182 3300005618 Ga0068864_100014307 Ga0068864_1000143074 197
183 3300005618 Ga0068864_100025879 Ga0068864_1000258796 197
184 3300005618 Ga0068864_100282096 Ga0068864_1002820962 197
185 3300005618 Ga0068864_100873521 Ga0068864_1008735211 197
186 3300005718 Ga0068866_10058029 Ga0068866_100580292 197
187 3300005718 Ga0068866_10067772 Ga0068866_100677723 197
188 3300005718 Ga0068866_10079811 Ga0068866_100798112 197
189 3300005719 Ga0068861_100031835 Ga0068861_1000318355 197
190 3300005719 Ga0068861_100058009 Ga0068861_1000580093 197
191 3300005719 Ga0068861_100089572 Ga0068861_1000895722 197
192 3300005840 Ga0068870_10006697 Ga0068870_100066975 197
193 3300005840 Ga0068870_10012321 Ga0068870_100123214 197
194 3300005841 Ga0068863_100052577 Ga0068863_1000525774 197
195 3300005841 Ga0068863_100067901 Ga0068863_1000679015 197
196 3300005841 Ga0068863_100159058 Ga0068863_1001590584 197
197 3300005841 Ga0068863_100200627 Ga0068863_1002006272 197
198 3300005841 Ga0068863_100235648 Ga0068863_1002356482 197
199 3300005842 Ga0068858_100076474 Ga0068858_1000764743 197
200 3300005842 Ga0068858_100219235 Ga0068858_1002192352 197
201 3300005842 Ga0068858_100378159 Ga0068858_1003781592 197
202 3300005843 Ga0068860_100033850 Ga0068860_1000338502 197
203 3300005843 Ga0068860_100048239 Ga0068860_1000482394 197
204 3300005843 Ga0068860_100085768 Ga0068860_1000857683 197
205 3300005843 Ga0068860_100300310 Ga0068860_1003003102 197
206 3300005843 Ga0068860_100449180 Ga0068860_1004491801 197
207 3300005844 Ga0068862_100008687 Ga0068862_1000086873 197
208 3300005844 Ga0068862_100043060 Ga0068862_1000430605 197
209 3300005844 Ga0068862_100139344 Ga0068862_1001393444 197
210 3300005844 Ga0068862_100198895 Ga0068862_1001988952 197
211 3300005844 Ga0068862_100655857 Ga0068862_1006558572 197
212 3300006195 Ga0075366_10081022 Ga0075366_100810222 197
213 3300006237 Ga0097621_100033676 Ga0097621_1000336765 197
214 3300006237 Ga0097621_100137485 Ga0097621_1001374852 197
215 3300006237 Ga0097621_100280189 Ga0097621_1002801892 197
216 3300006237 Ga0097621_100456278 Ga0097621_1004562781 197
217 3300006237 Ga0097621_100869669 Ga0097621_1008696691 197
218 3300006358 Ga0068871_100027169 Ga0068871_1000271695 197
219 3300006358 Ga0068871_100037855 Ga0068871_1000378555 197
220 3300006358 Ga0068871_100262435 Ga0068871_1002624352 197
221 3300006844 Ga0075428_100019102 Ga0075428_1000191024 197
222 3300006844 Ga0075428_100094079 Ga0075428_1000940793 197
223 3300006844 Ga0075428_100127646 Ga0075428_1001276463 197
224 3300006844 Ga0075428_100268199 Ga0075428_1002681991 197
225 3300006846 Ga0075430_100090947 Ga0075430_1000909472 197
226 3300006847 Ga0075431_100033404 Ga0075431_1000334045 197
227 3300006871 Ga0075434_100213813 Ga0075434_1002138132 197
228 3300006880 Ga0075429_100011301 Ga0075429_1000113015 197
229 3300006880 Ga0075429_100035795 Ga0075429_1000357954 197
230 3300006881 Ga0068865_100041856 Ga0068865_1000418562 197
231 3300006881 Ga0068865_100055639 Ga0068865_1000556393 197
232 3300006881 Ga0068865_100300841 Ga0068865_1003008412 197
233 3300006931 Ga0097620_100000066 Ga0097620_10000006666 197
234 3300006931 Ga0097620_100015491 Ga0097620_1000154915 197
235 3300006931 Ga0097620_100025287 Ga0097620_1000252875 197
236 3300006931 Ga0097620_100030780 Ga0097620_1000307807 197
237 3300006931 Ga0097620_100091324 Ga0097620_1000913242 197
238 3300006931 Ga0097620_100093398 Ga0097620_1000933985 197
239 3300006931 Ga0097620_100147322 Ga0097620_1001473222 197
240 3300006931 Ga0097620_100250201 Ga0097620_1002502011 197
241 3300006931 Ga0097620_100279611 Ga0097620_1002796113 197
242 3300006931 Ga0097620_100871962 Ga0097620_1008719621 197
243 3300009094 Ga0111539_10841852 Ga0111539_108418522 197
244 3300009098 Ga0105245_10176718 Ga0105245_101767182 197
245 3300009098 Ga0105245_10255674 Ga0105245_102556742 197
246 3300009101 Ga0105247_10004254 Ga0105247_100042545 197
247 3300009101 Ga0105247_10006282 Ga0105247_100062827 197
248 3300009101 Ga0105247_10054184 Ga0105247_100541842 197
249 3300009101 Ga0105247_10314884 Ga0105247_103148842 197
250 3300009147 Ga0114129_10079010 Ga0114129_100790103 197
251 3300009147 Ga0114129_10840440 Ga0114129_108404401 197
252 3300009147 Ga0114129_10879857 Ga0114129_108798572 197
253 3300009174 Ga0105241_10008638 Ga0105241_100086384 197
254 3300009176 Ga0105242_10055283 Ga0105242_100552834 197
255 3300009176 Ga0105242_10061357 Ga0105242_100613574 197
256 3300009176 Ga0105242_10086718 Ga0105242_100867184 197
257 3300009176 Ga0105242_10120644 Ga0105242_101206444 197
258 3300009176 Ga0105242_10122758 Ga0105242_101227582 197
259 3300009176 Ga0105242_10124855 Ga0105242_101248554 197
260 3300009176 Ga0105242_10163993 Ga0105242_101639933 197
261 3300009176 Ga0105242_10271018 Ga0105242_102710182 197
262 3300009176 Ga0105242_10960324 Ga0105242_109603242 197
263 3300009177 Ga0105248_10348874 Ga0105248_103488742 197
264 3300009177 Ga0105248_11174845 Ga0105248_111748451 197
265 3300009545 Ga0105237_10123648 Ga0105237_101236484 197
266 3300009553 Ga0105249_10006736 Ga0105249_100067362 197
267 3300009553 Ga0105249_10007280 Ga0105249_100072807 197
268 3300009553 Ga0105249_10017668 Ga0105249_100176684 197
269 3300009553 Ga0105249_10019864 Ga0105249_100198645 197
270 3300009553 Ga0105249_10025363 Ga0105249_100253636 197
271 3300009553 Ga0105249_10049597 Ga0105249_100495974 197
272 3300009553 Ga0105249_10073910 Ga0105249_100739104 197
273 3300009553 Ga0105249_10168859 Ga0105249_101688592 197
274 3300009553 Ga0105249_10267243 Ga0105249_102672432 197
275 3300009553 Ga0105249_10296354 Ga0105249_102963541 197
276 3300009553 Ga0105249_10354695 Ga0105249_103546952 197
277 3300009553 Ga0105249_11266700 Ga0105249_112667001 197
278 3300010375 Ga0105239_10258199 Ga0105239_102581992 197
279 3300010375 Ga0105239_10346493 Ga0105239_103464932 197
280 3300011119 Ga0105246_10005671 Ga0105246_100056712 197
281 3300011119 Ga0105246_10301533 Ga0105246_103015332 197
282 3300013100 Ga0157373_10001922 Ga0157373_1000192212 197
283 3300013296 Ga0157374_10002882 Ga0157374_100028825 197
284 3300013296 Ga0157374_10005717 Ga0157374_100057174 197
285 3300013296 Ga0157374_10272331 Ga0157374_102723312 197
286 3300013297 Ga0157378_10123712 Ga0157378_101237121 197
287 3300013297 Ga0157378_10200812 Ga0157378_102008122 197
288 3300013297 Ga0157378_10232109 Ga0157378_102321092 197
289 3300013297 Ga0157378_10821303 Ga0157378_108213032 197
290 3300013306 Ga0163162_10002903 Ga0163162_1000290315 197
291 3300013306 Ga0163162_10007169 Ga0163162_100071696 197
292 3300013306 Ga0163162_10172884 Ga0163162_101728841 197
293 3300013306 Ga0163162_10259946 Ga0163162_102599462 197
294 3300013306 Ga0163162_10321164 Ga0163162_103211643 197
295 3300013307 Ga0157372_10871045 Ga0157372_108710452 197
296 3300013308 Ga0157375_10011189 Ga0157375_1001118910 197
297 3300013308 Ga0157375_10013253 Ga0157375_100132535 197
298 3300013308 Ga0157375_10022035 Ga0157375_100220354 197
299 3300013308 Ga0157375_10040426 Ga0157375_100404263 197
300 3300013308 Ga0157375_10094421 Ga0157375_100944212 197
301 3300013308 Ga0157375_10333400 Ga0157375_103334002 197
302 3300014325 Ga0163163_10000291 Ga0163163_1000029128 197
303 3300014325 Ga0163163_10112985 Ga0163163_101129853 197
304 3300014325 Ga0163163_10131378 Ga0163163_101313784 197
305 3300014325 Ga0163163_10146317 Ga0163163_101463172 197
306 3300014325 Ga0163163_10169231 Ga0163163_101692312 197
307 3300014325 Ga0163163_10312638 Ga0163163_103126382 197
308 3300014325 Ga0163163_10592471 Ga0163163_105924711 197
309 3300014326 Ga0157380_10007052 Ga0157380_100070525 197
310 3300014326 Ga0157380_10054411 Ga0157380_100544113 197
311 3300014326 Ga0157380_10301292 Ga0157380_103012923 197
312 3300014326 Ga0157380_10777407 Ga0157380_107774071 197
313 3300014326 Ga0157380_10917655 Ga0157380_109176552 197
314 3300014745 Ga0157377_10004471 Ga0157377_100044718 197
315 3300014745 Ga0157377_10005773 Ga0157377_100057736 197
316 3300014745 Ga0157377_10126233 Ga0157377_101262333 197
317 3300014968 Ga0157379_10044735 Ga0157379_100447354 197
318 3300014968 Ga0157379_10238756 Ga0157379_102387563 197
319 3300014968 Ga0157379_10255475 Ga0157379_102554752 197
320 3300014968 Ga0157379_10472873 Ga0157379_104728732 197
321 3300014968 Ga0157379_10538306 Ga0157379_105383062 197
322 3300014969 Ga0157376_10007675 Ga0157376_100076755 197
323 3300014969 Ga0157376_10019909 Ga0157376_100199094 197
324 3300014969 Ga0157376_10042292 Ga0157376_100422925 197
325 3300014969 Ga0157376_10169939 Ga0157376_101699393 197
326 3300014969 Ga0157376_10405084 Ga0157376_104050841 197
327 3300017792 Ga0163161_10004692 Ga0163161_1000469212 197
328 3300017792 Ga0163161_10188499 Ga0163161_101884993 197
329 3300017792 Ga0163161_10543237 Ga0163161_105432372 197
330 3300025315 Ga0207697_10044900 Ga0207697_100449003 197
331 3300025893 Ga0207682_10093839 Ga0207682_100938392 197
332 3300025899 Ga0207642_10021560 Ga0207642_100215604 197
333 3300025900 Ga0207710_10001169 Ga0207710_100011699 197
334 3300025901 Ga0207688_10018285 Ga0207688_100182854 197
335 3300025901 Ga0207688_10056851 Ga0207688_100568514 197
336 3300025903 Ga0207680_10000143 Ga0207680_1000014334 197
337 3300025903 Ga0207680_10067568 Ga0207680_100675683 197
338 3300025904 Ga0207647_10051923 Ga0207647_100519234 197
339 3300025907 Ga0207645_10001094 Ga0207645_1000109418 197
340 3300025907 Ga0207645_10019751 Ga0207645_100197514 197
341 3300025907 Ga0207645_10276091 Ga0207645_102760912 197
342 3300025907 Ga0207645_10725362 Ga0207645_107253621 197
343 3300025908 Ga0207643_10005716 Ga0207643_100057167 197
344 3300025908 Ga0207643_10027154 Ga0207643_100271544 197
345 3300025911 Ga0207654_10006391 Ga0207654_100063915 197
346 3300025914 Ga0207671_10023966 Ga0207671_100239665 197
347 3300025918 Ga0207662_10015609 Ga0207662_100156094 197
348 3300025920 Ga0207649_10041888 Ga0207649_100418884 197
349 3300025920 Ga0207649_10124479 Ga0207649_101244792 197
350 3300025923 Ga0207681_10094617 Ga0207681_100946174 197
351 3300025925 Ga0207650_10013442 Ga0207650_100134427 197
352 3300025925 Ga0207650_10017123 Ga0207650_100171236 197
353 3300025925 Ga0207650_10057050 Ga0207650_100570503 197
354 3300025925 Ga0207650_10171041 Ga0207650_101710412 197
355 3300025926 Ga0207659_10092331 Ga0207659_100923312 197
356 3300025926 Ga0207659_10176206 Ga0207659_101762061 197
357 3300025931 Ga0207644_10016189 Ga0207644_100161897 197
358 3300025932 Ga0207690_10133236 Ga0207690_101332362 197
359 3300025932 Ga0207690_10902232 Ga0207690_109022321 197
360 3300025933 Ga0207706_10016213 Ga0207706_100162133 197
361 3300025933 Ga0207706_10025162 Ga0207706_100251627 197
362 3300025933 Ga0207706_10044736 Ga0207706_100447363 197
363 3300025933 Ga0207706_10132577 Ga0207706_101325772 197
364 3300025933 Ga0207706_10151281 Ga0207706_101512813 197
365 3300025934 Ga0207686_10005851 Ga0207686_100058514 197
366 3300025934 Ga0207686_10087347 Ga0207686_100873473 197
367 3300025934 Ga0207686_10114290 Ga0207686_101142902 197
368 3300025934 Ga0207686_10265425 Ga0207686_102654252 197
369 3300025934 Ga0207686_10617374 Ga0207686_106173742 197
370 3300025936 Ga0207670_10009430 Ga0207670_100094302 197
371 3300025936 Ga0207670_10016388 Ga0207670_100163884 197
372 3300025936 Ga0207670_10020834 Ga0207670_100208343 197
373 3300025936 Ga0207670_10076691 Ga0207670_100766912 197
374 3300025937 Ga0207669_10058895 Ga0207669_100588951 197
375 3300025938 Ga0207704_10158974 Ga0207704_101589742 197
376 3300025938 Ga0207704_10357986 Ga0207704_103579862 197
377 3300025940 Ga0207691_10027599 Ga0207691_100275997 197
378 3300025940 Ga0207691_10047277 Ga0207691_100472774 197
379 3300025940 Ga0207691_10060522 Ga0207691_100605222 197
380 3300025940 Ga0207691_10100077 Ga0207691_101000774 197
381 3300025942 Ga0207689_10004463 Ga0207689_1000446310 197
382 3300025942 Ga0207689_10010546 Ga0207689_100105464 197
383 3300025942 Ga0207689_10010855 Ga0207689_100108553 197
384 3300025942 Ga0207689_10021822 Ga0207689_100218225 197
385 3300025942 Ga0207689_10034332 Ga0207689_100343322 197
386 3300025942 Ga0207689_10060323 Ga0207689_100603234 197
387 3300025942 Ga0207689_10060960 Ga0207689_100609602 197
388 3300025942 Ga0207689_10351271 Ga0207689_103512712 197
389 3300025942 Ga0207689_10356935 Ga0207689_103569352 197
390 3300025942 Ga0207689_10461268 Ga0207689_104612682 197
391 3300025944 Ga0207661_10009064 Ga0207661_100090642 197
392 3300025945 Ga0207679_10029691 Ga0207679_100296914 197
393 3300025945 Ga0207679_10057464 Ga0207679_100574644 197
394 3300025945 Ga0207679_10239726 Ga0207679_102397262 197
395 3300025945 Ga0207679_10440883 Ga0207679_104408831 197
396 3300025960 Ga0207651_10096165 Ga0207651_100961654 197
397 3300025960 Ga0207651_10114328 Ga0207651_101143284 197
398 3300025960 Ga0207651_10124342 Ga0207651_101243422 197
399 3300025960 Ga0207651_10443524 Ga0207651_104435242 197
400 3300025961 Ga0207712_10002687 Ga0207712_100026878 197
401 3300025961 Ga0207712_10018778 Ga0207712_100187786 197
402 3300025961 Ga0207712_10039413 Ga0207712_100394134 197
403 3300025961 Ga0207712_10051816 Ga0207712_100518163 197
404 3300025961 Ga0207712_10429639 Ga0207712_104296392 197
405 3300025961 Ga0207712_10437847 Ga0207712_104378471 197
406 3300025972 Ga0207668_10016218 Ga0207668_100162181 197
407 3300025972 Ga0207668_10057724 Ga0207668_100577243 197
408 3300025981 Ga0207640_10065437 Ga0207640_100654374 197
409 3300025981 Ga0207640_10133216 Ga0207640_101332162 197
410 3300025981 Ga0207640_10488960 Ga0207640_104889601 197
411 3300025981 Ga0207640_10543234 Ga0207640_105432342 197
412 3300025981 Ga0207640_10621912 Ga0207640_106219122 197
413 3300025986 Ga0207658_10023748 Ga0207658_100237485 197
414 3300025986 Ga0207658_10037846 Ga0207658_100378464 197
415 3300025986 Ga0207658_10160332 Ga0207658_101603322 197
416 3300026023 Ga0207677_10019976 Ga0207677_100199765 197
417 3300026023 Ga0207677_10145361 Ga0207677_101453612 197
418 3300026035 Ga0207703_10047882 Ga0207703_100478825 197
419 3300026035 Ga0207703_10117164 Ga0207703_101171642 197
420 3300026035 Ga0207703_10242537 Ga0207703_102425371 197
421 3300026041 Ga0207639_10003629 Ga0207639_100036296 197
422 3300026041 Ga0207639_10201956 Ga0207639_102019563 197
423 3300026067 Ga0207678_10026498 Ga0207678_100264981 197
424 3300026075 Ga0207708_10015218 Ga0207708_100152187 197
425 3300026075 Ga0207708_10324012 Ga0207708_103240122 197
426 3300026088 Ga0207641_10002394 Ga0207641_100023946 197
427 3300026088 Ga0207641_10006787 Ga0207641_100067876 197
428 3300026088 Ga0207641_10247296 Ga0207641_102472963 197
429 3300026088 Ga0207641_10359346 Ga0207641_103593462 197
430 3300026089 Ga0207648_10008405 Ga0207648_100084052 197
431 3300026089 Ga0207648_10017531 Ga0207648_100175317 197
432 3300026089 Ga0207648_10057583 Ga0207648_100575834 197
433 3300026089 Ga0207648_10114317 Ga0207648_101143171 197
434 3300026089 Ga0207648_10243805 Ga0207648_102438052 197
435 3300026095 Ga0207676_10049439 Ga0207676_100494393 197
436 3300026095 Ga0207676_10088892 Ga0207676_100888924 197
437 3300026095 Ga0207676_10204746 Ga0207676_102047463 197
438 3300026095 Ga0207676_10360638 Ga0207676_103606383 197
439 3300026095 Ga0207676_10392065 Ga0207676_103920652 197
440 3300026116 Ga0207674_10002593 Ga0207674_100025932 197
441 3300026116 Ga0207674_10010658 Ga0207674_100106589 197
442 3300026116 Ga0207674_10047528 Ga0207674_100475284 197
443 3300026116 Ga0207674_10214035 Ga0207674_102140353 197
444 3300026116 Ga0207674_10436843 Ga0207674_104368432 197
445 3300026116 Ga0207674_10513391 Ga0207674_105133912 197
446 3300026118 Ga0207675_100003136 Ga0207675_1000031369 197
447 3300026118 Ga0207675_100049699 Ga0207675_1000496995 197
448 3300026118 Ga0207675_100056577 Ga0207675_1000565774 197
449 3300026118 Ga0207675_100073007 Ga0207675_1000730074 197
450 3300026118 Ga0207675_100103758 Ga0207675_1001037583 197
451 3300026118 Ga0207675_100211192 Ga0207675_1002111922 197
452 3300026121 Ga0207683_10002268 Ga0207683_1000226812 197
453 3300026121 Ga0207683_10167792 Ga0207683_101677922 197
454 3300026142 Ga0207698_10049040 Ga0207698_100490404 197
455 3300026142 Ga0207698_10204643 Ga0207698_102046432 197
456 3300026142 Ga0207698_10489675 Ga0207698_104896752 197
457 3300027907 Ga0207428_10387376 Ga0207428_103873762 197
458 3300028379 Ga0268266_10039603 Ga0268266_100396035 197
459 3300028379 Ga0268266_10460328 Ga0268266_104603281 197
460 3300028379 Ga0268266_10513969 Ga0268266_105139692 197
461 3300028380 Ga0268265_10086472 Ga0268265_100864722 197
462 3300028380 Ga0268265_10256902 Ga0268265_102569021 197
463 3300028380 Ga0268265_10346909 Ga0268265_103469092 197
464 3300028380 Ga0268265_10704855 Ga0268265_107048551 197
465 3300028381 Ga0268264_10001339 Ga0268264_1000133922 197
466 3300028381 Ga0268264_10074647 Ga0268264_100746474 197
467 3300028381 Ga0268264_10092410 Ga0268264_100924102 197
468 3300028381 Ga0268264_10246674 Ga0268264_102466742 197
469 3300028381 Ga0268264_10294092 Ga0268264_102940922 197
470 3300030521 Ga0307511_10000138 Ga0307511_1000013811 197
471 3300031901 Ga0307406_10519100 Ga0307406_105191002 197
472 3300035113 Ga0373936_0213268 Ga0373936_0213268_69_710 197
473 3300035118 Ga0373954_0199752 Ga0373954_0199752_162_803 197
474 3300035119 Ga0373956_0046887 Ga0373956_0046887_291_932 197
475 3300035172 Ga0373955_0033269 Ga0373955_0033269_1972_2613 197
476 3300035692 Ga0373935_0372792 Ga0373935_0372792_364_1005 197
477 3300035725 Ga0373947_0519612 Ga0373947_0519612_157_783 197
478 3300036401 Ga0373937_0008186 Ga0373937_0008186_1708_2349 197
479 3300037418 Ga0395900_1101953 Ga0395900_1101953_43_693 197
480 3300037471 Ga0395905_0012427 Ga0395905_0012427_4105_4755 197
481 3300037471 Ga0395905_0377900 Ga0395905_0377900_22_669 197
482 3300041406 Ga0439439_0005943 Ga0439439_0005943_747_1373 197
483 3300041411 Ga0439466_0083777 Ga0439466_0083777_120_746 197
484 3300041413 Ga0439465_0026644 Ga0439465_0026644_606_1229 197
485 3300042002 Ga0439442_007625 Ga0439442_007625_204_830 197
486 3300042128 Ga0450897_004621 Ga0450897_004621_231_857 197
487 3300042435 Ga0439434_0004879 Ga0439434_0004879_556_1182 197
488 3300044673 Ga0453683_0680881 Ga0453683_0680881_22_642 197
489 3300044712 Ga0453684_0121228 Ga0453684_0121228_1331_1951 197
490 3300046454 Ga0495592_0090305 Ga0495592_0090305_1168_1809 197
491 3300046460 Ga0495638_0093872 Ga0495638_0093872_618_1244 197
492 3300046471 Ga0495650_0010917 Ga0495650_0010917_20_655 197
493 3300046511 Ga0495608_0039503 Ga0495608_0039503_671_1312 197
494 3300046516 Ga0495628_0021658 Ga0495628_0021658_1456_2097 197
495 3300046517 Ga0495630_0002943 Ga0495630_0002943_6989_7630 197
496 3300046522 Ga0495643_0021900 Ga0495643_0021900_2473_3099 197
497 3300046529 Ga0495652_0090166 Ga0495652_0090166_1219_1860 197
498 3300046535 Ga0495586_0134474 Ga0495586_0134474_660_1301 197
499 3300046539 Ga0495621_0003264 Ga0495621_0003264_979_1605 197
500 3300046616 Ga0495668_0015303 Ga0495668_0015303_1477_2130 197
501 3300046663 Ga0495635_0058812 Ga0495635_0058812_1417_2058 197
502 3300046678 Ga0495599_0428246 Ga0495599_0428246_53_694 197
503 3300046683 Ga0495658_0084119 Ga0495658_0084119_666_1307 197
504 3300046809 Ga0495600_0417943 Ga0495600_0417943_181_822 197
505 3300047317 Ga0495604_0100466 Ga0495604_0100466_392_1033 197
506 3300047319 Ga0495674_0247716 Ga0495674_0247716_212_853 197
507 3300047471 Ga0495684_0169275 Ga0495684_0169275_380_1021 197
508 3300048913 Ga0496110_0174120 Ga0496110_0174120_489_1130 197
509 3300049568 Ga0501031_0002980 Ga0501031_0002980_193_822 197
510 3300049569 Ga0501032_0001819 Ga0501032_0001819_2646_3275 197
511 3300049571 Ga0501034_0009140 Ga0501034_0009140_8683_9312 197
512 3300049572 Ga0501036_0002939 Ga0501036_0002939_8976_9605 197
513 3300049573 Ga0501037_0006843 Ga0501037_0006843_4514_5143 197
514 3300049573 Ga0501037_0196857 Ga0501037_0196857_654_1283 197
515 3300049574 Ga0501038_0031413 Ga0501038_0031413_2492_3121 197
516 3300049574 Ga0501038_0032542 Ga0501038_0032542_2707_3336 197
517 3300049575 Ga0501039_0021426 Ga0501039_0021426_2965_3594 197
518 3300049575 Ga0501039_0030288 Ga0501039_0030288_2535_3164 197
519 3300049579 Ga0501043_0003722 Ga0501043_0003722_10893_11522 197
520 3300049579 Ga0501043_0023028 Ga0501043_0023028_1466_2095 197
521 3300049580 Ga0501046_0086039 Ga0501046_0086039_1636_2265 197
522 3300049581 Ga0501047_0076780 Ga0501047_0076780_690_1319 197
523 3300049581 Ga0501047_0091822 Ga0501047_0091822_1432_2061 197
524 3300049582 Ga0501048_0053691 Ga0501048_0053691_919_1548 197
525 3300049589 Ga0501073_0008529 Ga0501073_0008529_2272_2901 197
526 3300049589 Ga0501073_0198683 Ga0501073_0198683_702_1331 197
527 3300049590 Ga0501074_0004288 Ga0501074_0004288_7088_7717 197
528 3300049741 Ga0501079_0274908 Ga0501079_0274908_550_1179 197
529 3300049742 Ga0501080_0220570 Ga0501080_0220570_840_1469 197
530 3300049744 Ga0501083_0179335 Ga0501083_0179335_607_1236 197
531 3300049822 Ga0501035_0034165 Ga0501035_0034165_3943_4572 197
532 3300049822 Ga0501035_0208195 Ga0501035_0208195_571_1200 197
533 3300049823 Ga0501044_0028871 Ga0501044_0028871_4540_5169 197
534 3300049823 Ga0501044_0133028 Ga0501044_0133028_1128_1757 197
535 3300050493 nmdc:mga0k408_43685_c1 nmdc:mga0k408_43685_c1_1239_1862 197
536 3300050507 nmdc:mga05p37_121488_c1 nmdc:mga05p37_121488_c1_558_1184 197
537 3300050508 nmdc:mga09592_178711_c1 nmdc:mga09592_178711_c1_820_1446 197
538 3300050508 nmdc:mga09592_7777_c1 nmdc:mga09592_7777_c1_1928_2554 197
539 3300050509 nmdc:mga0qj67_127718_c1 nmdc:mga0qj67_127718_c1_1164_1790 197
540 3300050510 nmdc:mga06r32_53835_c1 nmdc:mga06r32_53835_c1_1256_1882 197
541 3300050511 nmdc:mga08y16_908280_c1 nmdc:mga08y16_908280_c1_104_730 197
542 3300050512 nmdc:mga0n895_591325_c1 nmdc:mga0n895_591325_c1_182_823 197
543 3300053153 Ga0500616_0011570 Ga0500616_0011570_4165_4839 197
544 3300053727 Ga0500611_000096 Ga0500611_000096_22872_23498 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

102

230

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sjy-assembly1.cif.gz_A-2 crystal structure of nudix hydrolase dr1025 from deinococcus radiodurans 0.8281 78 185
1su2-assembly1.cif.gz_B crystal structure of the nudix hydrolase dr1025 in complex with atp 0.8274 78 185
1soi-assembly1.cif.gz_A-2 crystal structure of nudix hydrolase dr1025 in complex with sm+3 0.8246 76 185
1sz3-assembly1.cif.gz_B crystal structure of nudix hydrolase dr1025 in complexed with gnp and mg+2 0.824 76 185
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.8219 75 195
ID Description Score Start End Superfamily
1sz3B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.824 76 185 3.90.79.10
af_P9WIX7_56_205_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8041 74 196 3.90.79.10
af_Q9VXR9_162_296_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7962 80 196 3.90.79.10
af_Q54U83_212_345_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7934 79 195 3.90.79.10
1vcdB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7835 80 196 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A5J5IE89-F1-model_v4 NUDIX domain-containing protein 0.9803 1 195 GO:0016787
AF-A0A848FX30-F1-model_v4 NUDIX hydrolase 0.9797 1 196 GO:0016787
AF-A0A4Q3SC92-F1-model_v4 NUDIX domain-containing protein 0.9773 1 196 GO:0016787
AF-A0A4Q6A9C2-F1-model_v4 NUDIX domain-containing protein 0.9773 1 174 GO:0016787
AF-A0A4V1UPV7-F1-model_v4 NUDIX domain-containing protein 0.9745 1 196 GO:0016787

Feature Viewer

pLDDT pTM Quality
92.26 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map