F461827

General Info

Members Datasets Scaffolds Average Seq Length
545 271 1090 296

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100036969|Ga0070713_1000369691
Length 330
Sequence VTASTKALRRVLDEKTEPAAPAAWPVEASFRGELYCGIANAMTIDVEDYFQVEAFAAVIDRSGWEGLPRRVDRNTERLLEILAESGVEATFFMLGWVAERHPALVRRVVAGGHELASHGLSHLRVDRQSPEEFRQDVRRSRQVLEDLGGVPVRGYRAPTFSIGGASRWAHSILAEEGYCYSSSVYPVKHDLYGTPEAPRTPFSPVPGMLEIPLTAVRILGIDMPASGGGYFRLLPYPITRGLLSYARRANRSPAIFYLHPWEIDPEQPRQQSASLKSRFRHYLNLDRTEPRLHRLLKNFIWTRMDRLFLSDGGGRFPVITSWTDRKQASP

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
113 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
185 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
190 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
270 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
271 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.41
Metatranscriptomes 4.22
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0
Rhizoplane 0
Rhizosphere 95.23
Stem 0
Stem Tuber 0
Unclassified 2.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100036969 3300005436 Bacteria 3944
2 JGI24741J21665_1002418 3300001915 Bacteria 4850
3 JGI24741J21665_1005109 3300001915 Bacteria 2799
4 JGI24741J21665_1005241 3300001915 Bacteria 2744
5 JGI24740J21852_10003322 3300001979 Bacteria 7087
6 JGI24740J21852_10023879 3300001979 Bacteria 2081
7 Ga0055531_10006447 3300003794 Bacteria 6663
8 Ga0055531_10008018 3300003794 Bacteria 5646
9 Ga0058861_11999342 3300004800 Bacteria 1811
10 Ga0058862_10140000 3300004803 Bacteria 1640
11 Ga0065704_10001226 3300005289 Bacteria 15861
12 Ga0070658_10012893 3300005327 Bacteria 6710
13 Ga0070658_10135645 3300005327 Bacteria 2053
14 Ga0070676_10000173 3300005328 Bacteria 26358
15 Ga0070683_100008824 3300005329 Bacteria 8577
16 Ga0070683_100091852 3300005329 Bacteria 2851
17 Ga0070690_100001817 3300005330 Bacteria 11312
18 Ga0070670_100011602 3300005331 Bacteria 7531
19 Ga0070670_100027162 3300005331 Bacteria 4924
20 Ga0070670_100082084 3300005331 Bacteria 2770
21 Ga0070677_10000168 3300005333 Bacteria 22559
22 Ga0068869_100006310 3300005334 Bacteria 7508
23 Ga0068869_100067615 3300005334 Bacteria 2637
24 Ga0068869_100074656 3300005334 Bacteria 2517
25 Ga0070666_10000033 3300005335 Bacteria 121625
26 Ga0070666_10003721 3300005335 Bacteria 9242
27 Ga0070666_10293920 3300005335 Bacteria 1156
28 Ga0070680_100008556 3300005336 Bacteria 7841
29 Ga0070680_100009034 3300005336 Bacteria 7642
30 Ga0070680_100011178 3300005336 Bacteria 6945
31 Ga0070680_100012641 3300005336 Bacteria 6563
32 Ga0070680_100030316 3300005336 Bacteria 4345
33 Ga0070682_100298268 3300005337 Bacteria 1181
34 Ga0068868_100008605 3300005338 Bacteria 7309
35 Ga0068868_100391042 3300005338 Bacteria 1198
36 Ga0070660_100009523 3300005339 Bacteria 6837
37 Ga0070660_100124618 3300005339 Bacteria 2058
38 Ga0070689_100012837 3300005340 Bacteria 6048
39 Ga0070689_100216910 3300005340 Bacteria 1568
40 Ga0070691_10000037 3300005341 Bacteria 37778
41 Ga0070691_10004331 3300005341 Bacteria 6449
42 Ga0070691_10055584 3300005341 Bacteria 1896
43 Ga0070687_100038733 3300005343 Bacteria 2391
44 Ga0070687_100049357 3300005343 Bacteria 2168
45 Ga0070661_100001543 3300005344 Bacteria 16021
46 Ga0070661_100002860 3300005344 Bacteria 11868
47 Ga0070692_10000085 3300005345 Bacteria 19863
48 Ga0070692_10005350 3300005345 Bacteria 5463
49 Ga0070692_10073956 3300005345 Bacteria 1822
50 Ga0070668_100000070 3300005347 Bacteria 63762
51 Ga0070669_100000075 3300005353 Bacteria 98073
52 Ga0070669_100060008 3300005353 Bacteria 2793
53 Ga0070675_100006004 3300005354 Bacteria 9307
54 Ga0070671_100000015 3300005355 Bacteria 166132
55 Ga0070671_100000171 3300005355 Bacteria 42862
56 Ga0070671_100008128 3300005355 Bacteria 8399
57 Ga0070671_100115691 3300005355 Bacteria 2255
58 Ga0070674_100003209 3300005356 Bacteria 9125
59 Ga0070673_100000217 3300005364 Bacteria 28612
60 Ga0070673_100026515 3300005364 Bacteria 4281
61 Ga0070673_100048269 3300005364 Bacteria 3318
62 Ga0070673_100149157 3300005364 Bacteria 1979
63 Ga0070659_100022358 3300005366 Bacteria 4827
64 Ga0070659_100050259 3300005366 Bacteria 3278
65 Ga0070659_100065664 3300005366 Bacteria 2874
66 Ga0070659_100077260 3300005366 Bacteria 2655
67 Ga0070667_100001588 3300005367 Bacteria 20343
68 Ga0070667_100229713 3300005367 Bacteria 1654
69 Ga0070709_10200771 3300005434 Unclassified 1412
70 Ga0070713_100012076 3300005436 Bacteria 6324
71 Ga0070701_10010850 3300005438 Bacteria 4046
72 Ga0070705_100000179 3300005440 Bacteria 37005
73 Ga0070705_100032333 3300005440 Bacteria 2906
74 Ga0070700_100077195 3300005441 Bacteria 2141
75 Ga0070694_100000220 3300005444 Bacteria 29943
76 Ga0070694_100006455 3300005444 Bacteria 7120
77 Ga0070663_100001765 3300005455 Bacteria 12034
78 Ga0070663_100004906 3300005455 Bacteria 7898
79 Ga0070663_100011041 3300005455 Bacteria 5654
80 Ga0070663_100066172 3300005455 Bacteria 2618
81 Ga0070663_100558913 3300005455 Unclassified 957
82 Ga0070678_100000478 3300005456 Bacteria 19187
83 Ga0070678_100061396 3300005456 Bacteria 2770
84 Ga0070681_10003009 3300005458 Bacteria 15640
85 Ga0070681_10014674 3300005458 Bacteria 7791
86 Ga0070681_10115993 3300005458 Bacteria 2615
87 Ga0070681_10234482 3300005458 Bacteria 1749
88 Ga0068867_100000469 3300005459 Bacteria 26732
89 Ga0068867_100015053 3300005459 Bacteria 5485
90 Ga0068867_100015271 3300005459 Bacteria 5444
91 Ga0070707_100411419 3300005468 Bacteria 1313
92 Ga0070698_100069652 3300005471 Bacteria 3530
93 Ga0070679_100013618 3300005530 Bacteria 7791
94 Ga0070679_100016512 3300005530 Bacteria 7126
95 Ga0070679_100098555 3300005530 Bacteria 2910
96 Ga0070684_100029943 3300005535 Bacteria 4620
97 Ga0070697_100102223 3300005536 Bacteria 2381
98 Ga0068853_100000230 3300005539 Bacteria 39593
99 Ga0068853_100003892 3300005539 Bacteria 11443
100 Ga0068853_100021177 3300005539 Bacteria 5415
101 Ga0068853_100064640 3300005539 Bacteria 3173
102 Ga0070672_100001586 3300005543 Bacteria 14104
103 Ga0070672_100296411 3300005543 Bacteria 1370
104 Ga0070686_100001382 3300005544 Bacteria 13710
105 Ga0070695_100000506 3300005545 Bacteria 20395
106 Ga0070696_100000916 3300005546 Bacteria 19195
107 Ga0070696_100011894 3300005546 Bacteria 5834
108 Ga0070696_100023355 3300005546 Bacteria 4203
109 Ga0070693_100000176 3300005547 Bacteria 29487
110 Ga0070693_100053792 3300005547 Bacteria 2313
111 Ga0070665_100002427 3300005548 Bacteria 20542
112 Ga0070665_100008037 3300005548 Bacteria 10684
113 Ga0070665_100051684 3300005548 Bacteria 4121
114 Ga0070665_100062461 3300005548 Bacteria 3735
115 Ga0070665_100079156 3300005548 Bacteria 3293
116 Ga0070704_100000866 3300005549 Bacteria 15126
117 Ga0070704_100036897 3300005549 Bacteria 3334
118 Ga0068855_100022497 3300005563 Bacteria 7555
119 Ga0068855_100051160 3300005563 Bacteria 4866
120 Ga0068855_100070367 3300005563 Bacteria 4070
121 Ga0068855_100080935 3300005563 Bacteria 3765
122 Ga0068855_100166173 3300005563 Bacteria 2501
123 Ga0070664_100033673 3300005564 Bacteria 4294
124 Ga0070664_100207677 3300005564 Bacteria 1749
125 Ga0068857_100014775 3300005577 Bacteria 6812
126 Ga0068857_100086276 3300005577 Bacteria 2806
127 Ga0068857_100220134 3300005577 Bacteria 1734
128 Ga0068854_100001581 3300005578 Bacteria 13851
129 Ga0068854_100005157 3300005578 Bacteria 8237
130 Ga0068854_100044910 3300005578 Bacteria 3139
131 Ga0068854_100104377 3300005578 Bacteria 2129
132 Ga0068856_100003096 3300005614 Bacteria 16974
133 Ga0068856_100072556 3300005614 Bacteria 3408
134 Ga0068856_100131631 3300005614 Unclassified 2506
135 Ga0068856_100264691 3300005614 Bacteria 1735
136 Ga0070702_100000085 3300005615 Bacteria 27444
137 Ga0070702_100093309 3300005615 Bacteria 1830
138 Ga0068852_100002323 3300005616 Bacteria 13070
139 Ga0068852_100007332 3300005616 Bacteria 8046
140 Ga0068852_100287002 3300005616 Bacteria 1588
141 Ga0068859_100000214 3300005617 Bacteria 57556
142 Ga0068859_100011679 3300005617 Bacteria 8826
143 Ga0068859_100020495 3300005617 Bacteria 6636
144 Ga0068864_100000744 3300005618 Bacteria 27304
145 Ga0068864_100007717 3300005618 Bacteria 8865
146 Ga0068864_100013894 3300005618 Bacteria 6675
147 Ga0068864_100231433 3300005618 Bacteria 1709
148 Ga0068866_10006778 3300005718 Bacteria 4779
149 Ga0068861_100002123 3300005719 Bacteria 12827
150 Ga0068861_100011410 3300005719 Bacteria 6176
151 Ga0068861_100357766 3300005719 Bacteria 1283
152 Ga0068851_10000214 3300005834 Bacteria 27780
153 Ga0068851_10008800 3300005834 Bacteria 4678
154 Ga0068851_10032684 3300005834 Bacteria 2589
155 Ga0068870_10072049 3300005840 Bacteria 1887
156 Ga0068863_100003324 3300005841 Bacteria 15881
157 Ga0068863_100016871 3300005841 Bacteria 7003
158 Ga0068858_100008573 3300005842 Bacteria 9817
159 Ga0068858_100036723 3300005842 Bacteria 4543
160 Ga0068858_100038178 3300005842 Bacteria 4454
161 Ga0068858_100146173 3300005842 Bacteria 2220
162 Ga0068860_100003606 3300005843 Bacteria 15909
163 Ga0068860_100034085 3300005843 Bacteria 4883
164 Ga0068860_100049887 3300005843 Bacteria 3986
165 Ga0068860_100191914 3300005843 Bacteria 1977
166 Ga0068862_100000340 3300005844 Bacteria 50605
167 Ga0068862_100081574 3300005844 Bacteria 2806
168 Ga0070717_10016641 3300006028 Bacteria 5707
169 Ga0075365_10028734 3300006038 Bacteria 3548
170 Ga0070716_100057980 3300006173 Bacteria 2227
171 Ga0070712_100058940 3300006175 Bacteria 2702
172 Ga0070712_100314125 3300006175 Bacteria 1272
173 Ga0075362_10020302 3300006177 Bacteria 2775
174 Ga0075367_10051413 3300006178 Bacteria 2436
175 Ga0097621_100002029 3300006237 Bacteria 13855
176 Ga0097621_100027101 3300006237 Bacteria 4503
177 Ga0097621_100270868 3300006237 Bacteria 1492
178 Ga0068871_100006855 3300006358 Bacteria 8109
179 Ga0068871_100027442 3300006358 Bacteria 4453
180 Ga0075428_100000144 3300006844 Bacteria 64080
181 Ga0075428_100031913 3300006844 Bacteria 5820
182 Ga0075434_100000493 3300006871 Bacteria 29762
183 Ga0075429_100000057 3300006880 Bacteria 53985
184 Ga0068865_100010257 3300006881 Bacteria 5827
185 Ga0068865_100015559 3300006881 Bacteria 4853
186 Ga0075436_100000503 3300006914 Bacteria 25269
187 Ga0097620_100000214 3300006931 Bacteria 57556
188 Ga0097620_100011679 3300006931 Bacteria 8826
189 Ga0097620_100020494 3300006931 Bacteria 6636
190 Ga0075435_100000045 3300007076 Bacteria 62303
191 Ga0099794_10070948 3300007265 Bacteria 1706
192 Ga0099795_10027769 3300007788 Bacteria 1918
193 Ga0105240_10224960 3300009093 Bacteria 2184
194 Ga0105240_10226668 3300009093 Bacteria 2174
195 Ga0105240_10397661 3300009093 Bacteria 1553
196 Ga0111539_10015569 3300009094 Bacteria 9454
197 Ga0105245_10011673 3300009098 Bacteria 7645
198 Ga0105245_10170908 3300009098 Bacteria 2070
199 Ga0114129_10000030 3300009147 Bacteria 111905
200 Ga0105243_10004585 3300009148 Bacteria 10899
201 Ga0105243_10226034 3300009148 Bacteria 1657
202 Ga0105248_10030482 3300009177 Bacteria 6022
203 Ga0105248_10052033 3300009177 Bacteria 4596
204 Ga0105248_10304741 3300009177 Bacteria 1794
205 Ga0105237_10100540 3300009545 Bacteria 2883
206 Ga0105237_10161009 3300009545 Bacteria 2243
207 Ga0105238_10207639 3300009551 Bacteria 1934
208 Ga0099796_10001645 3300010159 Bacteria 4618
209 Ga0099796_10024069 3300010159 Bacteria 1908
210 Ga0157319_1000001 3300012497 Bacteria 423237
211 Ga0157371_10005276 3300013102 Bacteria 10947
212 Ga0157371_10009110 3300013102 Bacteria 7842
213 Ga0157371_10032214 3300013102 Bacteria 3773
214 Ga0157370_10063350 3300013104 Bacteria 3503
215 Ga0157370_10132271 3300013104 Bacteria 2327
216 Ga0157370_10146286 3300013104 Bacteria 2200
217 Ga0157369_10001963 3300013105 Bacteria 24794
218 Ga0157369_10009545 3300013105 Bacteria 11098
219 Ga0157369_10021870 3300013105 Bacteria 7149
220 Ga0157369_10029974 3300013105 Bacteria 6005
221 Ga0157378_10338517 3300013297 Bacteria 1466
222 Ga0163162_10007407 3300013306 Bacteria 10674
223 Ga0157372_10000910 3300013307 Bacteria 32175
224 Ga0157372_10005809 3300013307 Bacteria 13143
225 Ga0157372_10010067 3300013307 Bacteria 10052
226 Ga0157375_10425157 3300013308 Bacteria 1494
227 Ga0157380_10373901 3300014326 Bacteria 1342
228 Ga0157377_10229345 3300014745 Bacteria 1193
229 Ga0157379_10010899 3300014968 Bacteria 7924
230 Ga0157376_10055391 3300014969 Bacteria 3308
231 Ga0197907_10290566 3300020069 Bacteria 7649
232 Ga0197907_11167786 3300020069 Unclassified 1602
233 Ga0206356_10354731 3300020070 Bacteria 12816
234 Ga0206356_11679441 3300020070 Bacteria 2531
235 Ga0206355_1115151 3300020076 Bacteria 1582
236 Ga0206351_10277699 3300020077 Bacteria 9021
237 Ga0206352_10150590 3300020078 Unclassified 1302
238 Ga0206352_10151450 3300020078 Bacteria 18008
239 Ga0206350_10404670 3300020080 Bacteria 7197
240 Ga0206350_11055005 3300020080 Bacteria 3146
241 Ga0206354_10331306 3300020081 Bacteria 1414
242 Ga0206354_10512105 3300020081 Bacteria 5523
243 Ga0206353_10118324 3300020082 Bacteria 5282
244 Ga0206353_10400038 3300020082 Bacteria 11765
245 Ga0206353_10954058 3300020082 Bacteria 2014
246 Ga0206353_11238528 3300020082 Bacteria 2319
247 Ga0213872_10000105 3300021361 Bacteria 77592
248 Ga0213876_10083191 3300021384 Bacteria 1693
249 Ga0213876_10168108 3300021384 Bacteria 1167
250 Ga0213875_10008687 3300021388 Bacteria 5187
251 Ga0213875_10074951 3300021388 Bacteria 1579
252 Ga0213871_10029284 3300021441 Bacteria 1426
253 Ga0224712_10004755 3300022467 Bacteria 3701
254 Ga0224712_10006825 3300022467 Bacteria 3285
255 Ga0209759_1001839 3300025256 Bacteria 10621
256 Ga0209257_1006999 3300025304 Bacteria 7000
257 Ga0207697_10000603 3300025315 Bacteria 20456
258 Ga0207656_10002693 3300025321 Bacteria 6030
259 Ga0207656_10021283 3300025321 Bacteria 2590
260 Ga0207682_10000250 3300025893 Bacteria 24262
261 Ga0207682_10020907 3300025893 Bacteria 2573
262 Ga0207642_10004308 3300025899 Bacteria 4586
263 Ga0207680_10000637 3300025903 Bacteria 16555
264 Ga0207680_10004895 3300025903 Bacteria 6376
265 Ga0207647_10000379 3300025904 Bacteria 36174
266 Ga0207647_10014111 3300025904 Bacteria 5519
267 Ga0207647_10042841 3300025904 Bacteria 2836
268 Ga0207699_10047294 3300025906 Bacteria 2522
269 Ga0207699_10173068 3300025906 Unclassified 1446
270 Ga0207643_10057142 3300025908 Bacteria 2221
271 Ga0207705_10000029 3300025909 Bacteria 239897
272 Ga0207705_10000284 3300025909 Bacteria 48119
273 Ga0207705_10002723 3300025909 Bacteria 13536
274 Ga0207705_10005608 3300025909 Bacteria 9375
275 Ga0207707_10000157 3300025912 Bacteria 71284
276 Ga0207707_10001266 3300025912 Bacteria 23581
277 Ga0207707_10002000 3300025912 Bacteria 18509
278 Ga0207707_10003415 3300025912 Bacteria 14076
279 Ga0207707_10216825 3300025912 Bacteria 1666
280 Ga0207695_10000619 3300025913 Bacteria 71420
281 Ga0207695_10000889 3300025913 Bacteria 54328
282 Ga0207695_10008414 3300025913 Bacteria 12923
283 Ga0207695_10019660 3300025913 Bacteria 7767
284 Ga0207695_10185821 3300025913 Bacteria 1997
285 Ga0207695_10401934 3300025913 Bacteria 1254
286 Ga0207693_10002633 3300025915 Bacteria 15590
287 Ga0207693_10194115 3300025915 Bacteria 1597
288 Ga0207693_10209870 3300025915 Bacteria 1531
289 Ga0207660_10000852 3300025917 Bacteria 20097
290 Ga0207660_10001458 3300025917 Bacteria 15889
291 Ga0207660_10003232 3300025917 Bacteria 10663
292 Ga0207660_10004042 3300025917 Bacteria 9572
293 Ga0207660_10006053 3300025917 Bacteria 7851
294 Ga0207660_10010980 3300025917 Bacteria 5888
295 Ga0207660_10109028 3300025917 Bacteria 2080
296 Ga0207662_10045471 3300025918 Bacteria 2595
297 Ga0207662_10048126 3300025918 Bacteria 2526
298 Ga0207657_10000670 3300025919 Bacteria 36488
299 Ga0207657_10004021 3300025919 Bacteria 15622
300 Ga0207657_10006728 3300025919 Bacteria 11869
301 Ga0207657_10010467 3300025919 Bacteria 9254
302 Ga0207657_10188213 3300025919 Bacteria 1666
303 Ga0207649_10000079 3300025920 Bacteria 82899
304 Ga0207649_10003527 3300025920 Bacteria 8553
305 Ga0207649_10025659 3300025920 Bacteria 3438
306 Ga0207652_10000025 3300025921 Bacteria 157704
307 Ga0207652_10002397 3300025921 Bacteria 15829
308 Ga0207652_10004097 3300025921 Bacteria 11891
309 Ga0207652_10008318 3300025921 Bacteria 8340
310 Ga0207652_10008675 3300025921 Bacteria 8184
311 Ga0207652_10017927 3300025921 Bacteria 5801
312 Ga0207652_10188412 3300025921 Bacteria 1855
313 Ga0207681_10000002 3300025923 Bacteria 985597
314 Ga0207681_10060407 3300025923 Bacteria 2602
315 Ga0207694_10128447 3300025924 Bacteria 2030
316 Ga0207694_10192602 3300025924 Bacteria 1657
317 Ga0207650_10007364 3300025925 Bacteria 7489
318 Ga0207659_10016526 3300025926 Bacteria 4804
319 Ga0207687_10035477 3300025927 Bacteria 3392
320 Ga0207687_10059848 3300025927 Bacteria 2685
321 Ga0207664_10037906 3300025929 Bacteria 3734
322 Ga0207664_10372163 3300025929 Bacteria 1267
323 Ga0207644_10000002 3300025931 Bacteria 942221
324 Ga0207644_10054938 3300025931 Bacteria 2869
325 Ga0207644_10088189 3300025931 Bacteria 2307
326 Ga0207690_10000629 3300025932 Bacteria 22819
327 Ga0207690_10001405 3300025932 Bacteria 15134
328 Ga0207690_10042762 3300025932 Bacteria 2978
329 Ga0207709_10002543 3300025935 Bacteria 11355
330 Ga0207670_10026717 3300025936 Bacteria 3641
331 Ga0207670_10140689 3300025936 Bacteria 1779
332 Ga0207704_10005525 3300025938 Bacteria 5827
333 Ga0207704_10006778 3300025938 Bacteria 5366
334 Ga0207691_10000122 3300025940 Bacteria 70474
335 Ga0207711_10032347 3300025941 Bacteria 4422
336 Ga0207711_10150663 3300025941 Bacteria 2098
337 Ga0207689_10000617 3300025942 Bacteria 33992
338 Ga0207689_10000742 3300025942 Bacteria 31331
339 Ga0207689_10037870 3300025942 Bacteria 3997
340 Ga0207689_10099123 3300025942 Bacteria 2394
341 Ga0207661_10007925 3300025944 Bacteria 7571
342 Ga0207661_10044747 3300025944 Bacteria 3500
343 Ga0207667_10000601 3300025949 Bacteria 46666
344 Ga0207667_10001187 3300025949 Bacteria 32735
345 Ga0207667_10002459 3300025949 Bacteria 23161
346 Ga0207667_10076568 3300025949 Bacteria 3471
347 Ga0207651_10000980 3300025960 Bacteria 12604
348 Ga0207651_10015452 3300025960 Bacteria 4436
349 Ga0207651_10192858 3300025960 Bacteria 1627
350 Ga0207712_10049247 3300025961 Bacteria 2935
351 Ga0207668_10022640 3300025972 Bacteria 4026
352 Ga0207668_10057959 3300025972 Bacteria 2704
353 Ga0207640_10000212 3300025981 Bacteria 40885
354 Ga0207640_10000259 3300025981 Bacteria 35866
355 Ga0207640_10000650 3300025981 Bacteria 20302
356 Ga0207640_10002580 3300025981 Bacteria 9703
357 Ga0207658_10010313 3300025986 Bacteria 6350
358 Ga0207658_10015499 3300025986 Bacteria 5228
359 Ga0207658_10195620 3300025986 Bacteria 1684
360 Ga0207677_10018991 3300026023 Bacteria 4140
361 Ga0207677_10294916 3300026023 Bacteria 1337
362 Ga0207703_10027745 3300026035 Bacteria 4459
363 Ga0207703_10047844 3300026035 Bacteria 3449
364 Ga0207703_10061043 3300026035 Bacteria 3085
365 Ga0207639_10000223 3300026041 Bacteria 42347
366 Ga0207639_10000338 3300026041 Bacteria 32510
367 Ga0207639_10003050 3300026041 Bacteria 11282
368 Ga0207639_10104529 3300026041 Bacteria 2296
369 Ga0207639_10244021 3300026041 Bacteria 1563
370 Ga0207678_10000425 3300026067 Bacteria 38212
371 Ga0207678_10003575 3300026067 Bacteria 13974
372 Ga0207678_10003859 3300026067 Bacteria 13474
373 Ga0207678_10004362 3300026067 Bacteria 12711
374 Ga0207678_10009103 3300026067 Bacteria 8743
375 Ga0207678_10081097 3300026067 Bacteria 2777
376 Ga0207678_10153703 3300026067 Bacteria 1965
377 Ga0207678_10155027 3300026067 Bacteria 1955
378 Ga0207702_10004041 3300026078 Bacteria 13174
379 Ga0207702_10080301 3300026078 Bacteria 2829
380 Ga0207702_10182920 3300026078 Bacteria 1931
381 Ga0207702_10263384 3300026078 Bacteria 1624
382 Ga0207702_10728618 3300026078 Bacteria 978
383 Ga0207641_10004493 3300026088 Bacteria 12065
384 Ga0207641_10017631 3300026088 Bacteria 5847
385 Ga0207648_10010174 3300026089 Bacteria 8944
386 Ga0207648_10023233 3300026089 Bacteria 5561
387 Ga0207648_10059472 3300026089 Bacteria 3333
388 Ga0207648_10110409 3300026089 Bacteria 2414
389 Ga0207676_10003155 3300026095 Bacteria 11763
390 Ga0207676_10033984 3300026095 Bacteria 3858
391 Ga0207676_10034389 3300026095 Bacteria 3837
392 Ga0207676_10080954 3300026095 Unclassified 2637
393 Ga0207676_10733361 3300026095 Bacteria 960
394 Ga0207674_10007841 3300026116 Bacteria 12411
395 Ga0207674_10017442 3300026116 Bacteria 7835
396 Ga0207674_10122000 3300026116 Bacteria 2573
397 Ga0207675_100000169 3300026118 Bacteria 58328
398 Ga0207675_100001161 3300026118 Bacteria 26205
399 Ga0207675_100020283 3300026118 Bacteria 6198
400 Ga0207675_100073386 3300026118 Bacteria 3202
401 Ga0207683_10000005 3300026121 Bacteria 187889
402 Ga0207683_10121771 3300026121 Bacteria 2343
403 Ga0207698_10001096 3300026142 Bacteria 15766
404 Ga0207698_10003678 3300026142 Bacteria 9267
405 Ga0207698_10037775 3300026142 Bacteria 3560
406 Ga0209974_10074554 3300027876 Bacteria 1161
407 Ga0207428_10000317 3300027907 Bacteria 63048
408 Ga0268266_10003773 3300028379 Bacteria 14844
409 Ga0268266_10011343 3300028379 Bacteria 7750
410 Ga0268266_10118410 3300028379 Bacteria 2354
411 Ga0268266_10190506 3300028379 Bacteria 1872
412 Ga0268265_10000241 3300028380 Bacteria 62423
413 Ga0268265_10006556 3300028380 Bacteria 7880
414 Ga0268265_10062821 3300028380 Bacteria 2855
415 Ga0268265_10069159 3300028380 Bacteria 2741
416 Ga0268264_10000010 3300028381 Bacteria 596543
417 Ga0268264_10047269 3300028381 Bacteria 3578
418 Ga0268264_10163375 3300028381 Bacteria 2008
419 Ga0307515_10147462 3300028794 Bacteria 2483
420 Ga0307513_10037674 3300031456 Bacteria 5379
421 Ga0307514_10000947 3300031649 Bacteria 43838
422 Ga0316576_10395402 3300031727 Bacteria 1025
423 Ga0316578_10007811 3300031728 Bacteria 5400
424 Ga0316577_10174706 3300031733 Bacteria 1213
425 Ga0307413_10085438 3300031824 Bacteria 2037
426 Ga0307416_100486166 3300032002 Bacteria 1296
427 Ga0307414_10020208 3300032004 Bacteria 4146
428 Ga0316580_10034413 3300032139 Bacteria 1568
429 Ga0316593_10000079 3300032168 Bacteria 11831
430 Ga0316592_1004796 3300033524 Bacteria 2534
431 Ga0316596_1000281 3300033541 Bacteria 7987
432 Ga0373934_0007484 3300035086 Bacteria 4055
433 Ga0373936_0003037 3300035113 Bacteria 6273
434 Ga0373936_0003482 3300035113 Bacteria 5915
435 Ga0373957_0016732 3300035120 Unclassified 2544
436 Ga0373943_0001731 3300035170 Bacteria 9898
437 Ga0373943_0069974 3300035170 Bacteria 1774
438 Ga0373955_0125342 3300035172 Bacteria 1496
439 Ga0316574_0078722 3300035398 Bacteria 2090
440 Ga0373924_0018755 3300035410 Bacteria 2672
441 Ga0373935_0091300 3300035692 Bacteria 1995
442 Ga0373927_0025973 3300035695 Bacteria 3828
443 Ga0373927_0045901 3300035695 Bacteria 2827
444 Ga0373933_0002279 3300035724 Bacteria 10938
445 Ga0373947_0008785 3300035725 Bacteria 5807
446 Ga0373947_0013024 3300035725 Bacteria 4768
447 Ga0373947_0017805 3300035725 Bacteria 4087
448 Ga0373937_0027821 3300036401 Bacteria 5114
449 Ga0316582_0179509 3300036647 Bacteria 1440
450 Ga0373925_0011918 3300037068 Bacteria 6292
451 Ga0373925_0022882 3300037068 Bacteria 4560
452 Ga0373925_0026056 3300037068 Bacteria 4275
453 Ga0373925_0103151 3300037068 Bacteria 2195
454 Ga0395899_0094161 3300037312 Bacteria 2168
455 Ga0395899_0143350 3300037312 Bacteria 1698
456 Ga0395899_0211492 3300037312 Bacteria 1347
457 Ga0395900_0005790 3300037418 Bacteria 12909
458 Ga0395900_0202655 3300037418 Bacteria 2007
459 Ga0395900_0452187 3300037418 Bacteria 1240
460 Ga0395898_0038257 3300037466 Bacteria 4756
461 Ga0395898_0267063 3300037466 Bacteria 1632
462 Ga0395898_0405592 3300037466 Bacteria 1299
463 Ga0395905_0009833 3300037471 Bacteria 9322
464 Ga0395905_0028760 3300037471 Bacteria 5237
465 Ga0436364_0055799 3300037853 Bacteria 1132
466 Ga0436364_1090988 3300037853 Bacteria 5157
467 Ga0436364_1331161 3300037853 Bacteria 8026
468 Ga0395901_0140511 3300038443 Bacteria 2538
469 Ga0395901_0175400 3300038443 Bacteria 2248
470 Ga0436365_1570244 3300039437 Bacteria 1486
471 Ga0436360_0493941 3300039438 Bacteria 2263
472 Ga0436360_0669451 3300039438 Bacteria 5473
473 Ga0436360_1230711 3300039438 Unclassified 1430
474 Ga0436361_0947109 3300039447 Bacteria 78044
475 Ga0436361_1005581 3300039447 Bacteria 4887
476 Ga0436362_0029875 3300039453 Bacteria 803
477 Ga0436362_0270489 3300039453 Unclassified 2911
478 Ga0436362_0729897 3300039453 Bacteria 2984
479 Ga0451577_0011063 3300042876 Bacteria 8569
480 Ga0451577_0026524 3300042876 Bacteria 5247
481 Ga0451577_0036818 3300042876 Bacteria 4405
482 Ga0451577_0376737 3300042876 Bacteria 1288
483 Ga0453683_0009654 3300044673 Bacteria 6435
484 Ga0453684_0029179 3300044712 Bacteria 7845
485 Ga0453684_0306215 3300044712 Bacteria 1804
486 Ga0451576_0000863 3300045051 Bacteria 58426
487 Ga0451576_0003705 3300045051 Bacteria 20668
488 Ga0451576_0008339 3300045051 Bacteria 12179
489 Ga0466967_0139779 3300045976 Bacteria 2255
490 Ga0495629_0130133 3300046459 Bacteria 1753
491 Ga0495580_0000301 3300046472 Bacteria 40177
492 Ga0495580_0007574 3300046472 Bacteria 8711
493 Ga0495582_0016734 3300046473 Bacteria 4016
494 Ga0495665_0193456 3300046531 Bacteria 1055
495 Ga0495640_0128733 3300046533 Bacteria 1640
496 Ga0495634_0235522 3300046642 Bacteria 1125
497 Ga0495635_0320318 3300046663 Unclassified 1038
498 Ga0495599_0137250 3300046678 Bacteria 1518
499 Ga0495658_0012437 3300046683 Bacteria 4310
500 Ga0495613_0122199 3300046689 Bacteria 1869
501 Ga0495680_0133345 3300047322 Bacteria 1823
502 Ga0495686_0001317 3300047472 Bacteria 27841
503 Ga0496125_0003747 3300048928 Bacteria 18099
504 Ga0496126_0137493 3300048929 Bacteria 2106
505 Ga0501033_0055770 3300049570 Bacteria 2921
506 Ga0501036_0272954 3300049572 Bacteria 1416
507 Ga0501036_0526908 3300049572 Bacteria 982
508 Ga0501038_0031005 3300049574 Bacteria 4726
509 Ga0501038_0088733 3300049574 Bacteria 2595
510 Ga0501040_0048018 3300049576 Bacteria 2917
511 Ga0501041_0254467 3300049577 Bacteria 1104
512 Ga0501042_0365116 3300049578 Bacteria 1045
513 Ga0501043_0259123 3300049579 Bacteria 1338
514 Ga0501047_0186898 3300049581 Bacteria 1937
515 Ga0501047_0227116 3300049581 Bacteria 1721
516 Ga0501070_0003748 3300049586 Bacteria 13126
517 Ga0501070_0234135 3300049586 Bacteria 1504
518 Ga0501072_0211143 3300049588 Bacteria 1547
519 Ga0501073_0261238 3300049589 Unclassified 1195
520 Ga0501074_0018021 3300049590 Bacteria 5129
521 Ga0501076_0445531 3300049592 Bacteria 1066
522 Ga0501080_0011993 3300049742 Bacteria 7938
523 Ga0501080_0204992 3300049742 Bacteria 1809
524 Ga0501083_0008903 3300049744 Bacteria 7090
525 Ga0501044_0353646 3300049823 Bacteria 1388
526 Ga0501045_0031743 3300049824 Bacteria 3826
527 nmdc:mga03683_83907_c1 3300050489 Bacteria 1380
528 nmdc:mga0yw44_184853_c1 3300050492 Bacteria 1373
529 nmdc:mga0k408_195053_c1 3300050493 Bacteria 1209
530 nmdc:mga06z11_229651_c1 3300050494 Bacteria 1087
531 nmdc:mga05p37_3416_c1 3300050507 Bacteria 18528
532 nmdc:mga09592_411_c1 3300050508 Bacteria 31378
533 nmdc:mga08y16_575_c1 3300050511 Bacteria 34221
534 nmdc:mga0n895_503_c1 3300050512 Bacteria 26505
535 nmdc:mga0rr50_2120_c1 3300050513 Bacteria 11093
536 nmdc:mga08x19_704_c1 3300050514 Bacteria 21380
537 nmdc:mga0a205_5704_c1 3300050515 Bacteria 11217
538 Ga0495601_0072829 3300053077 Bacteria 2195
539 Ga0495619_0024834 3300053085 Bacteria 3845
540 Ga0500562_004642 3300053108 Bacteria 3467
541 Ga0501084_0412825 3300054114 Unclassified 1141
542 Ga0501082_0078467 3300060353 Bacteria 2848
543 Ga0530510_0119905 3300061734 Bacteria 1930
544 2842780405 2842775625 Bacteria 5587290
545 2883581192 2883577096 Bacteria 4709178
546 Ga0070713_100036969
547 JGI24741J21665_1002418
548 JGI24741J21665_1005109
549 JGI24741J21665_1005241
550 JGI24740J21852_10003322
551 JGI24740J21852_10023879
552 Ga0055531_10006447
553 Ga0055531_10008018
554 Ga0058861_11999342
555 Ga0058862_10140000
556 Ga0065704_10001226
557 Ga0070658_10012893
558 Ga0070658_10135645
559 Ga0070676_10000173
560 Ga0070683_100008824
561 Ga0070683_100091852
562 Ga0070690_100001817
563 Ga0070670_100011602
564 Ga0070670_100027162
565 Ga0070670_100082084
566 Ga0070677_10000168
567 Ga0068869_100006310
568 Ga0068869_100067615
569 Ga0068869_100074656
570 Ga0070666_10000033
571 Ga0070666_10003721
572 Ga0070666_10293920
573 Ga0070680_100008556
574 Ga0070680_100009034
575 Ga0070680_100011178
576 Ga0070680_100012641
577 Ga0070680_100030316
578 Ga0070682_100298268
579 Ga0068868_100008605
580 Ga0068868_100391042
581 Ga0070660_100009523
582 Ga0070660_100124618
583 Ga0070689_100012837
584 Ga0070689_100216910
585 Ga0070691_10000037
586 Ga0070691_10004331
587 Ga0070691_10055584
588 Ga0070687_100038733
589 Ga0070687_100049357
590 Ga0070661_100001543
591 Ga0070661_100002860
592 Ga0070692_10000085
593 Ga0070692_10005350
594 Ga0070692_10073956
595 Ga0070668_100000070
596 Ga0070669_100000075
597 Ga0070669_100060008
598 Ga0070675_100006004
599 Ga0070671_100000015
600 Ga0070671_100000171
601 Ga0070671_100008128
602 Ga0070671_100115691
603 Ga0070674_100003209
604 Ga0070673_100000217
605 Ga0070673_100026515
606 Ga0070673_100048269
607 Ga0070673_100149157
608 Ga0070659_100022358
609 Ga0070659_100050259
610 Ga0070659_100065664
611 Ga0070659_100077260
612 Ga0070667_100001588
613 Ga0070667_100229713
614 Ga0070709_10200771
615 Ga0070713_100012076
616 Ga0070701_10010850
617 Ga0070705_100000179
618 Ga0070705_100032333
619 Ga0070700_100077195
620 Ga0070694_100000220
621 Ga0070694_100006455
622 Ga0070663_100001765
623 Ga0070663_100004906
624 Ga0070663_100011041
625 Ga0070663_100066172
626 Ga0070663_100558913
627 Ga0070678_100000478
628 Ga0070678_100061396
629 Ga0070681_10003009
630 Ga0070681_10014674
631 Ga0070681_10115993
632 Ga0070681_10234482
633 Ga0068867_100000469
634 Ga0068867_100015053
635 Ga0068867_100015271
636 Ga0070707_100411419
637 Ga0070698_100069652
638 Ga0070679_100013618
639 Ga0070679_100016512
640 Ga0070679_100098555
641 Ga0070684_100029943
642 Ga0070697_100102223
643 Ga0068853_100000230
644 Ga0068853_100003892
645 Ga0068853_100021177
646 Ga0068853_100064640
647 Ga0070672_100001586
648 Ga0070672_100296411
649 Ga0070686_100001382
650 Ga0070695_100000506
651 Ga0070696_100000916
652 Ga0070696_100011894
653 Ga0070696_100023355
654 Ga0070693_100000176
655 Ga0070693_100053792
656 Ga0070665_100002427
657 Ga0070665_100008037
658 Ga0070665_100051684
659 Ga0070665_100062461
660 Ga0070665_100079156
661 Ga0070704_100000866
662 Ga0070704_100036897
663 Ga0068855_100022497
664 Ga0068855_100051160
665 Ga0068855_100070367
666 Ga0068855_100080935
667 Ga0068855_100166173
668 Ga0070664_100033673
669 Ga0070664_100207677
670 Ga0068857_100014775
671 Ga0068857_100086276
672 Ga0068857_100220134
673 Ga0068854_100001581
674 Ga0068854_100005157
675 Ga0068854_100044910
676 Ga0068854_100104377
677 Ga0068856_100003096
678 Ga0068856_100072556
679 Ga0068856_100131631
680 Ga0068856_100264691
681 Ga0070702_100000085
682 Ga0070702_100093309
683 Ga0068852_100002323
684 Ga0068852_100007332
685 Ga0068852_100287002
686 Ga0068859_100000214
687 Ga0068859_100011679
688 Ga0068859_100020495
689 Ga0068864_100000744
690 Ga0068864_100007717
691 Ga0068864_100013894
692 Ga0068864_100231433
693 Ga0068866_10006778
694 Ga0068861_100002123
695 Ga0068861_100011410
696 Ga0068861_100357766
697 Ga0068851_10000214
698 Ga0068851_10008800
699 Ga0068851_10032684
700 Ga0068870_10072049
701 Ga0068863_100003324
702 Ga0068863_100016871
703 Ga0068858_100008573
704 Ga0068858_100036723
705 Ga0068858_100038178
706 Ga0068858_100146173
707 Ga0068860_100003606
708 Ga0068860_100034085
709 Ga0068860_100049887
710 Ga0068860_100191914
711 Ga0068862_100000340
712 Ga0068862_100081574
713 Ga0070717_10016641
714 Ga0075365_10028734
715 Ga0070716_100057980
716 Ga0070712_100058940
717 Ga0070712_100314125
718 Ga0075362_10020302
719 Ga0075367_10051413
720 Ga0097621_100002029
721 Ga0097621_100027101
722 Ga0097621_100270868
723 Ga0068871_100006855
724 Ga0068871_100027442
725 Ga0075428_100000144
726 Ga0075428_100031913
727 Ga0075434_100000493
728 Ga0075429_100000057
729 Ga0068865_100010257
730 Ga0068865_100015559
731 Ga0075436_100000503
732 Ga0097620_100000214
733 Ga0097620_100011679
734 Ga0097620_100020494
735 Ga0075435_100000045
736 Ga0099794_10070948
737 Ga0099795_10027769
738 Ga0105240_10224960
739 Ga0105240_10226668
740 Ga0105240_10397661
741 Ga0111539_10015569
742 Ga0105245_10011673
743 Ga0105245_10170908
744 Ga0114129_10000030
745 Ga0105243_10004585
746 Ga0105243_10226034
747 Ga0105248_10030482
748 Ga0105248_10052033
749 Ga0105248_10304741
750 Ga0105237_10100540
751 Ga0105237_10161009
752 Ga0105238_10207639
753 Ga0099796_10001645
754 Ga0099796_10024069
755 Ga0157319_1000001
756 Ga0157371_10005276
757 Ga0157371_10009110
758 Ga0157371_10032214
759 Ga0157370_10063350
760 Ga0157370_10132271
761 Ga0157370_10146286
762 Ga0157369_10001963
763 Ga0157369_10009545
764 Ga0157369_10021870
765 Ga0157369_10029974
766 Ga0157378_10338517
767 Ga0163162_10007407
768 Ga0157372_10000910
769 Ga0157372_10005809
770 Ga0157372_10010067
771 Ga0157375_10425157
772 Ga0157380_10373901
773 Ga0157377_10229345
774 Ga0157379_10010899
775 Ga0157376_10055391
776 Ga0197907_10290566
777 Ga0197907_11167786
778 Ga0206356_10354731
779 Ga0206356_11679441
780 Ga0206355_1115151
781 Ga0206351_10277699
782 Ga0206352_10150590
783 Ga0206352_10151450
784 Ga0206350_10404670
785 Ga0206350_11055005
786 Ga0206354_10331306
787 Ga0206354_10512105
788 Ga0206353_10118324
789 Ga0206353_10400038
790 Ga0206353_10954058
791 Ga0206353_11238528
792 Ga0213872_10000105
793 Ga0213876_10083191
794 Ga0213876_10168108
795 Ga0213875_10008687
796 Ga0213875_10074951
797 Ga0213871_10029284
798 Ga0224712_10004755
799 Ga0224712_10006825
800 Ga0209759_1001839
801 Ga0209257_1006999
802 Ga0207697_10000603
803 Ga0207656_10002693
804 Ga0207656_10021283
805 Ga0207682_10000250
806 Ga0207682_10020907
807 Ga0207642_10004308
808 Ga0207680_10000637
809 Ga0207680_10004895
810 Ga0207647_10000379
811 Ga0207647_10014111
812 Ga0207647_10042841
813 Ga0207699_10047294
814 Ga0207699_10173068
815 Ga0207643_10057142
816 Ga0207705_10000029
817 Ga0207705_10000284
818 Ga0207705_10002723
819 Ga0207705_10005608
820 Ga0207707_10000157
821 Ga0207707_10001266
822 Ga0207707_10002000
823 Ga0207707_10003415
824 Ga0207707_10216825
825 Ga0207695_10000619
826 Ga0207695_10000889
827 Ga0207695_10008414
828 Ga0207695_10019660
829 Ga0207695_10185821
830 Ga0207695_10401934
831 Ga0207693_10002633
832 Ga0207693_10194115
833 Ga0207693_10209870
834 Ga0207660_10000852
835 Ga0207660_10001458
836 Ga0207660_10003232
837 Ga0207660_10004042
838 Ga0207660_10006053
839 Ga0207660_10010980
840 Ga0207660_10109028
841 Ga0207662_10045471
842 Ga0207662_10048126
843 Ga0207657_10000670
844 Ga0207657_10004021
845 Ga0207657_10006728
846 Ga0207657_10010467
847 Ga0207657_10188213
848 Ga0207649_10000079
849 Ga0207649_10003527
850 Ga0207649_10025659
851 Ga0207652_10000025
852 Ga0207652_10002397
853 Ga0207652_10004097
854 Ga0207652_10008318
855 Ga0207652_10008675
856 Ga0207652_10017927
857 Ga0207652_10188412
858 Ga0207681_10000002
859 Ga0207681_10060407
860 Ga0207694_10128447
861 Ga0207694_10192602
862 Ga0207650_10007364
863 Ga0207659_10016526
864 Ga0207687_10035477
865 Ga0207687_10059848
866 Ga0207664_10037906
867 Ga0207664_10372163
868 Ga0207644_10000002
869 Ga0207644_10054938
870 Ga0207644_10088189
871 Ga0207690_10000629
872 Ga0207690_10001405
873 Ga0207690_10042762
874 Ga0207709_10002543
875 Ga0207670_10026717
876 Ga0207670_10140689
877 Ga0207704_10005525
878 Ga0207704_10006778
879 Ga0207691_10000122
880 Ga0207711_10032347
881 Ga0207711_10150663
882 Ga0207689_10000617
883 Ga0207689_10000742
884 Ga0207689_10037870
885 Ga0207689_10099123
886 Ga0207661_10007925
887 Ga0207661_10044747
888 Ga0207667_10000601
889 Ga0207667_10001187
890 Ga0207667_10002459
891 Ga0207667_10076568
892 Ga0207651_10000980
893 Ga0207651_10015452
894 Ga0207651_10192858
895 Ga0207712_10049247
896 Ga0207668_10022640
897 Ga0207668_10057959
898 Ga0207640_10000212
899 Ga0207640_10000259
900 Ga0207640_10000650
901 Ga0207640_10002580
902 Ga0207658_10010313
903 Ga0207658_10015499
904 Ga0207658_10195620
905 Ga0207677_10018991
906 Ga0207677_10294916
907 Ga0207703_10027745
908 Ga0207703_10047844
909 Ga0207703_10061043
910 Ga0207639_10000223
911 Ga0207639_10000338
912 Ga0207639_10003050
913 Ga0207639_10104529
914 Ga0207639_10244021
915 Ga0207678_10000425
916 Ga0207678_10003575
917 Ga0207678_10003859
918 Ga0207678_10004362
919 Ga0207678_10009103
920 Ga0207678_10081097
921 Ga0207678_10153703
922 Ga0207678_10155027
923 Ga0207702_10004041
924 Ga0207702_10080301
925 Ga0207702_10182920
926 Ga0207702_10263384
927 Ga0207702_10728618
928 Ga0207641_10004493
929 Ga0207641_10017631
930 Ga0207648_10010174
931 Ga0207648_10023233
932 Ga0207648_10059472
933 Ga0207648_10110409
934 Ga0207676_10003155
935 Ga0207676_10033984
936 Ga0207676_10034389
937 Ga0207676_10080954
938 Ga0207676_10733361
939 Ga0207674_10007841
940 Ga0207674_10017442
941 Ga0207674_10122000
942 Ga0207675_100000169
943 Ga0207675_100001161
944 Ga0207675_100020283
945 Ga0207675_100073386
946 Ga0207683_10000005
947 Ga0207683_10121771
948 Ga0207698_10001096
949 Ga0207698_10003678
950 Ga0207698_10037775
951 Ga0209974_10074554
952 Ga0207428_10000317
953 Ga0268266_10003773
954 Ga0268266_10011343
955 Ga0268266_10118410
956 Ga0268266_10190506
957 Ga0268265_10000241
958 Ga0268265_10006556
959 Ga0268265_10062821
960 Ga0268265_10069159
961 Ga0268264_10000010
962 Ga0268264_10047269
963 Ga0268264_10163375
964 Ga0307515_10147462
965 Ga0307513_10037674
966 Ga0307514_10000947
967 Ga0316576_10395402
968 Ga0316578_10007811
969 Ga0316577_10174706
970 Ga0307413_10085438
971 Ga0307416_100486166
972 Ga0307414_10020208
973 Ga0316580_10034413
974 Ga0316593_10000079
975 Ga0316592_1004796
976 Ga0316596_1000281
977 Ga0373934_0007484
978 Ga0373936_0003037
979 Ga0373936_0003482
980 Ga0373957_0016732
981 Ga0373943_0001731
982 Ga0373943_0069974
983 Ga0373955_0125342
984 Ga0316574_0078722
985 Ga0373924_0018755
986 Ga0373935_0091300
987 Ga0373927_0025973
988 Ga0373927_0045901
989 Ga0373933_0002279
990 Ga0373947_0008785
991 Ga0373947_0013024
992 Ga0373947_0017805
993 Ga0373937_0027821
994 Ga0316582_0179509
995 Ga0373925_0011918
996 Ga0373925_0022882
997 Ga0373925_0026056
998 Ga0373925_0103151
999 Ga0395899_0094161
1000 Ga0395899_0143350
1001 Ga0395899_0211492
1002 Ga0395900_0005790
1003 Ga0395900_0202655
1004 Ga0395900_0452187
1005 Ga0395898_0038257
1006 Ga0395898_0267063
1007 Ga0395898_0405592
1008 Ga0395905_0009833
1009 Ga0395905_0028760
1010 Ga0436364_0055799
1011 Ga0436364_1090988
1012 Ga0436364_1331161
1013 Ga0395901_0140511
1014 Ga0395901_0175400
1015 Ga0436365_1570244
1016 Ga0436360_0493941
1017 Ga0436360_0669451
1018 Ga0436360_1230711
1019 Ga0436361_0947109
1020 Ga0436361_1005581
1021 Ga0436362_0029875
1022 Ga0436362_0270489
1023 Ga0436362_0729897
1024 Ga0451577_0011063
1025 Ga0451577_0026524
1026 Ga0451577_0036818
1027 Ga0451577_0376737
1028 Ga0453683_0009654
1029 Ga0453684_0029179
1030 Ga0453684_0306215
1031 Ga0451576_0000863
1032 Ga0451576_0003705
1033 Ga0451576_0008339
1034 Ga0466967_0139779
1035 Ga0495629_0130133
1036 Ga0495580_0000301
1037 Ga0495580_0007574
1038 Ga0495582_0016734
1039 Ga0495665_0193456
1040 Ga0495640_0128733
1041 Ga0495634_0235522
1042 Ga0495635_0320318
1043 Ga0495599_0137250
1044 Ga0495658_0012437
1045 Ga0495613_0122199
1046 Ga0495680_0133345
1047 Ga0495686_0001317
1048 Ga0496125_0003747
1049 Ga0496126_0137493
1050 Ga0501033_0055770
1051 Ga0501036_0272954
1052 Ga0501036_0526908
1053 Ga0501038_0031005
1054 Ga0501038_0088733
1055 Ga0501040_0048018
1056 Ga0501041_0254467
1057 Ga0501042_0365116
1058 Ga0501043_0259123
1059 Ga0501047_0186898
1060 Ga0501047_0227116
1061 Ga0501070_0003748
1062 Ga0501070_0234135
1063 Ga0501072_0211143
1064 Ga0501073_0261238
1065 Ga0501074_0018021
1066 Ga0501076_0445531
1067 Ga0501080_0011993
1068 Ga0501080_0204992
1069 Ga0501083_0008903
1070 Ga0501044_0353646
1071 Ga0501045_0031743
1072 nmdc:mga03683_83907_c1
1073 nmdc:mga0yw44_184853_c1
1074 nmdc:mga0k408_195053_c1
1075 nmdc:mga06z11_229651_c1
1076 nmdc:mga05p37_3416_c1
1077 nmdc:mga09592_411_c1
1078 nmdc:mga08y16_575_c1
1079 nmdc:mga0n895_503_c1
1080 nmdc:mga0rr50_2120_c1
1081 nmdc:mga08x19_704_c1
1082 nmdc:mga0a205_5704_c1
1083 Ga0495601_0072829
1084 Ga0495619_0024834
1085 Ga0500562_004642
1086 Ga0501084_0412825
1087 Ga0501082_0078467
1088 Ga0530510_0119905
1089 2842780405
1090 2883581192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11959

DUF3473

Domain of unknown function (DUF3473)

182

309

0.99

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

63

178

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j13-assembly1.cif.gz_A structure of a family 4 carbohydrate esterase from bacillus anthracis 0.8624 10 158
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.8553 11 159
7bly-assembly1.cif.gz_A structure of the chitin deacetylase angcda from aspergillus niger 0.7394 10 281
2vyo-assembly1.cif.gz_A chitin deacetylase family member from encephalitozoon cuniculi 0.7237 8 285
6hpa-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme 0.7206 9 293
ID Description Score Start End Superfamily
2j13A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8624 10 158 3.20.20.370
af_Q06702_109_291_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7522 12 234 3.20.20.370
af_O53444_35_232_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7273 1 283 3.20.20.370
2vyoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7237 8 285 3.20.20.370
af_O53444_35_232_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7139 1 283 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A4Y1YQ65-F1-model_v4 NodB homology domain-containing protein 0.9924 11 286 GO:0005975
GO:0016810
AF-A0A1I7GTK6-F1-model_v4 Polysaccharide deacetylase family protein, PEP-CTERM locus subfamily 0.992 11 286 GO:0005975
GO:0016810
AF-A0A3B1ANM9-F1-model_v4 FIG004655: Polysaccharide deacetylase 0.9913 15 283 GO:0005975
GO:0016810
AF-A0A2G6N9Y0-F1-model_v4 Polysaccharide deacetylase 0.9907 11 278 GO:0005975
GO:0016810
AF-A0A259ETA3-F1-model_v4 deleted 0.9886 60 283

Map