F461872
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 545 | 261 | 545 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300025961|Ga0207712_11698883|Ga0207712_116988831 |
| Length | 99 |
| Sequence | MVDEDDVLEALSNVIDPELGLDFVELGLVYGVEIDDGGKVDITFTLTTPACPIGPQVTEQMKEFVSEVEGVQKVLPKMVFSPPWSPERMSEDAKFALGY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 72 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 73 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 87 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 90 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 133 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 134 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 135 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 136 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 143 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 144 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 145 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 146 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 147 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 148 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 149 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 150 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 157 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 159 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 160 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 161 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 162 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 163 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 164 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 165 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 166 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 167 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 168 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 169 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 170 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 171 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 174 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 175 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 176 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 177 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 204 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 205 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 207 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 208 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 209 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 210 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 211 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 212 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 213 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 214 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 215 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 216 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 241 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 256 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 261 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.08 |
| Metatranscriptomes | 0.92 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.73 |
| Nodule | 0 |
| Rhizoplane | 4.77 |
| Rhizosphere | 92.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10002441 | 3300003373 | Bacteria | 4373 |
| 2 | JGI25407J50210_10010090 | 3300003373 | Bacteria | 2399 |
| 3 | JGI25407J50210_10131222 | 3300003373 | Bacteria | 617 |
| 4 | Ga0070658_10451413 | 3300005327 | Bacteria | 1108 |
| 5 | Ga0070658_11486536 | 3300005327 | Unclassified | 587 |
| 6 | Ga0070683_100101991 | 3300005329 | Bacteria | 2703 |
| 7 | Ga0068869_100619115 | 3300005334 | Bacteria | 916 |
| 8 | Ga0070680_100062430 | 3300005336 | Bacteria | 3051 |
| 9 | Ga0070680_101001067 | 3300005336 | Bacteria | 722 |
| 10 | Ga0070682_100577982 | 3300005337 | Bacteria | 884 |
| 11 | Ga0070682_101263597 | 3300005337 | Bacteria | 626 |
| 12 | Ga0068868_100365484 | 3300005338 | Bacteria | 1239 |
| 13 | Ga0070660_100421217 | 3300005339 | Bacteria | 1106 |
| 14 | Ga0070689_101909285 | 3300005340 | Unclassified | 542 |
| 15 | Ga0070661_100224286 | 3300005344 | Bacteria | 1442 |
| 16 | Ga0070661_100846330 | 3300005344 | Bacteria | 753 |
| 17 | Ga0070692_10232754 | 3300005345 | Bacteria | 1094 |
| 18 | Ga0070692_10260833 | 3300005345 | Unclassified | 1042 |
| 19 | Ga0070692_10464253 | 3300005345 | Bacteria | 813 |
| 20 | Ga0070669_100702618 | 3300005353 | Unclassified | 854 |
| 21 | Ga0070659_100618902 | 3300005366 | Bacteria | 932 |
| 22 | Ga0070659_101123901 | 3300005366 | Unclassified | 693 |
| 23 | Ga0070659_101195331 | 3300005366 | Unclassified | 672 |
| 24 | Ga0070659_101565781 | 3300005366 | Unclassified | 588 |
| 25 | Ga0070701_10098613 | 3300005438 | Bacteria | 1614 |
| 26 | Ga0070705_101272593 | 3300005440 | Archaea | 609 |
| 27 | Ga0070700_100109114 | 3300005441 | Bacteria | 1837 |
| 28 | Ga0070700_100413316 | 3300005441 | Bacteria | 1018 |
| 29 | Ga0070700_100788411 | 3300005441 | Unclassified | 764 |
| 30 | Ga0070663_100403568 | 3300005455 | Bacteria | 1118 |
| 31 | Ga0070663_100782934 | 3300005455 | Bacteria | 817 |
| 32 | Ga0070662_100803233 | 3300005457 | Unclassified | 800 |
| 33 | Ga0070681_10134554 | 3300005458 | Bacteria | 2403 |
| 34 | Ga0070681_10851049 | 3300005458 | Bacteria | 830 |
| 35 | Ga0070681_11026151 | 3300005458 | Unclassified | 745 |
| 36 | Ga0070681_12039474 | 3300005458 | Bacteria | 502 |
| 37 | Ga0068867_100293670 | 3300005459 | Bacteria | 1337 |
| 38 | Ga0068867_101599412 | 3300005459 | Bacteria | 609 |
| 39 | Ga0070685_10429564 | 3300005466 | Bacteria | 921 |
| 40 | Ga0070685_10968327 | 3300005466 | Bacteria | 637 |
| 41 | Ga0070706_100461562 | 3300005467 | Bacteria | 1182 |
| 42 | Ga0070706_100994217 | 3300005467 | Unclassified | 774 |
| 43 | Ga0070707_101034071 | 3300005468 | Bacteria | 787 |
| 44 | Ga0070679_100178981 | 3300005530 | Bacteria | 2093 |
| 45 | Ga0070684_100043620 | 3300005535 | Bacteria | 3874 |
| 46 | Ga0070684_100179337 | 3300005535 | Bacteria | 1925 |
| 47 | Ga0070684_101192366 | 3300005535 | Bacteria | 716 |
| 48 | Ga0068853_100587738 | 3300005539 | Bacteria | 1057 |
| 49 | Ga0070672_100798806 | 3300005543 | Bacteria | 830 |
| 50 | Ga0070695_101145834 | 3300005545 | Bacteria | 638 |
| 51 | Ga0070696_100333358 | 3300005546 | Bacteria | 1171 |
| 52 | Ga0070693_100193735 | 3300005547 | Bacteria | 1316 |
| 53 | Ga0070693_100360597 | 3300005547 | Bacteria | 997 |
| 54 | Ga0070704_100844182 | 3300005549 | Bacteria | 821 |
| 55 | Ga0070664_100097258 | 3300005564 | Bacteria | 2556 |
| 56 | Ga0070664_100419322 | 3300005564 | Bacteria | 1226 |
| 57 | Ga0070664_100640204 | 3300005564 | Bacteria | 988 |
| 58 | Ga0068854_100866703 | 3300005578 | Bacteria | 792 |
| 59 | Ga0068854_101059417 | 3300005578 | Bacteria | 721 |
| 60 | Ga0068854_102078569 | 3300005578 | Unclassified | 524 |
| 61 | Ga0068856_101560684 | 3300005614 | Unclassified | 674 |
| 62 | Ga0068856_101599155 | 3300005614 | Bacteria | 665 |
| 63 | Ga0070702_100214753 | 3300005615 | Bacteria | 1283 |
| 64 | Ga0068852_101031107 | 3300005616 | Bacteria | 842 |
| 65 | Ga0068859_100223946 | 3300005617 | Bacteria | 1969 |
| 66 | Ga0068864_100313241 | 3300005618 | Bacteria | 1472 |
| 67 | Ga0068864_100944858 | 3300005618 | Bacteria | 853 |
| 68 | Ga0068866_10332313 | 3300005718 | Bacteria | 960 |
| 69 | Ga0068866_10981821 | 3300005718 | Archaea | 599 |
| 70 | Ga0068861_100401058 | 3300005719 | Bacteria | 1217 |
| 71 | Ga0068861_100641398 | 3300005719 | Bacteria | 980 |
| 72 | Ga0068870_10493497 | 3300005840 | Bacteria | 815 |
| 73 | Ga0068870_11106990 | 3300005840 | Unclassified | 570 |
| 74 | Ga0068858_100858563 | 3300005842 | Bacteria | 887 |
| 75 | Ga0068858_101650168 | 3300005842 | Bacteria | 633 |
| 76 | Ga0068858_102251979 | 3300005842 | Bacteria | 539 |
| 77 | Ga0068860_100904378 | 3300005843 | Bacteria | 899 |
| 78 | Ga0081455_10004507 | 3300005937 | Bacteria | 15570 |
| 79 | Ga0081455_10181093 | 3300005937 | Bacteria | 1595 |
| 80 | Ga0081455_10211013 | 3300005937 | Bacteria | 1447 |
| 81 | Ga0081538_10000398 | 3300005981 | Bacteria | 49598 |
| 82 | Ga0081538_10001873 | 3300005981 | Bacteria | 21209 |
| 83 | Ga0081538_10006655 | 3300005981 | Bacteria | 10129 |
| 84 | Ga0081538_10019419 | 3300005981 | Bacteria | 5052 |
| 85 | Ga0081538_10119320 | 3300005981 | Bacteria | 1272 |
| 86 | Ga0081538_10328557 | 3300005981 | Bacteria | 556 |
| 87 | Ga0081540_1099156 | 3300005983 | Bacteria | 1259 |
| 88 | Ga0081539_10015236 | 3300005985 | Bacteria | 5603 |
| 89 | Ga0075364_10294812 | 3300006051 | Bacteria | 1104 |
| 90 | Ga0075432_10072748 | 3300006058 | Bacteria | 1237 |
| 91 | Ga0075432_10172934 | 3300006058 | Bacteria | 841 |
| 92 | Ga0070712_100000008 | 3300006175 | Bacteria | 149644 |
| 93 | Ga0097621_101624028 | 3300006237 | Bacteria | 615 |
| 94 | Ga0097621_102019968 | 3300006237 | Bacteria | 551 |
| 95 | Ga0075428_100013459 | 3300006844 | Bacteria | 9104 |
| 96 | Ga0075428_100240783 | 3300006844 | Bacteria | 1952 |
| 97 | Ga0075428_100318399 | 3300006844 | Bacteria | 1672 |
| 98 | Ga0075428_102215271 | 3300006844 | Bacteria | 567 |
| 99 | Ga0075431_100223420 | 3300006847 | Bacteria | 1921 |
| 100 | Ga0075431_100677823 | 3300006847 | Bacteria | 1010 |
| 101 | Ga0075433_10075636 | 3300006852 | Bacteria | 2963 |
| 102 | Ga0075429_100389828 | 3300006880 | Bacteria | 1220 |
| 103 | Ga0075429_100449080 | 3300006880 | Unclassified | 1130 |
| 104 | Ga0075429_100842775 | 3300006880 | Bacteria | 803 |
| 105 | Ga0075429_101514283 | 3300006880 | Bacteria | 584 |
| 106 | Ga0068865_100110562 | 3300006881 | Bacteria | 2027 |
| 107 | Ga0068865_100390417 | 3300006881 | Bacteria | 1137 |
| 108 | Ga0068865_100763115 | 3300006881 | Bacteria | 832 |
| 109 | Ga0097620_100223925 | 3300006931 | Bacteria | 1969 |
| 110 | Ga0105244_10169008 | 3300009036 | Bacteria | 1041 |
| 111 | Ga0111539_10004797 | 3300009094 | Bacteria | 17637 |
| 112 | Ga0111539_10011390 | 3300009094 | Bacteria | 11165 |
| 113 | Ga0111539_10243695 | 3300009094 | Unclassified | 2093 |
| 114 | Ga0111539_10557021 | 3300009094 | Bacteria | 1335 |
| 115 | Ga0111539_10922834 | 3300009094 | Bacteria | 1015 |
| 116 | Ga0111539_12060695 | 3300009094 | Bacteria | 662 |
| 117 | Ga0111539_12316123 | 3300009094 | Bacteria | 623 |
| 118 | Ga0105245_10318320 | 3300009098 | Bacteria | 1532 |
| 119 | Ga0105245_10323174 | 3300009098 | Bacteria | 1521 |
| 120 | Ga0105245_10342413 | 3300009098 | Bacteria | 1479 |
| 121 | Ga0105245_10848241 | 3300009098 | Bacteria | 953 |
| 122 | Ga0105245_11427127 | 3300009098 | Bacteria | 742 |
| 123 | Ga0105245_13086045 | 3300009098 | Unclassified | 516 |
| 124 | Ga0105245_13143382 | 3300009098 | Bacteria | 512 |
| 125 | Ga0105245_13280968 | 3300009098 | Bacteria | 501 |
| 126 | Ga0114129_10642668 | 3300009147 | Bacteria | 1370 |
| 127 | Ga0114129_10701091 | 3300009147 | Unclassified | 1301 |
| 128 | Ga0114129_10812074 | 3300009147 | Bacteria | 1192 |
| 129 | Ga0114129_10856573 | 3300009147 | Bacteria | 1155 |
| 130 | Ga0114129_12448064 | 3300009147 | Unclassified | 625 |
| 131 | Ga0114129_13497554 | 3300009147 | Bacteria | 502 |
| 132 | Ga0105243_10315449 | 3300009148 | Bacteria | 1422 |
| 133 | Ga0105243_10426903 | 3300009148 | Bacteria | 1238 |
| 134 | Ga0105243_11029811 | 3300009148 | Bacteria | 828 |
| 135 | Ga0105243_11318740 | 3300009148 | Bacteria | 740 |
| 136 | Ga0105243_12162986 | 3300009148 | Bacteria | 593 |
| 137 | Ga0105243_12458573 | 3300009148 | Bacteria | 560 |
| 138 | Ga0105241_10749323 | 3300009174 | Bacteria | 895 |
| 139 | Ga0105242_10742513 | 3300009176 | Bacteria | 965 |
| 140 | Ga0105242_11022599 | 3300009176 | Bacteria | 835 |
| 141 | Ga0105242_12305732 | 3300009176 | Bacteria | 585 |
| 142 | Ga0105237_10676390 | 3300009545 | Bacteria | 1039 |
| 143 | Ga0105238_10428287 | 3300009551 | Bacteria | 1318 |
| 144 | Ga0105249_10009238 | 3300009553 | Bacteria | 8624 |
| 145 | Ga0105249_11137165 | 3300009553 | Bacteria | 851 |
| 146 | Ga0105249_11225619 | 3300009553 | Bacteria | 821 |
| 147 | Ga0105249_12341909 | 3300009553 | Bacteria | 607 |
| 148 | Ga0099796_10256902 | 3300010159 | Unclassified | 727 |
| 149 | Ga0105239_10224909 | 3300010375 | Bacteria | 2105 |
| 150 | Ga0105239_10225128 | 3300010375 | Bacteria | 2104 |
| 151 | Ga0105239_10771556 | 3300010375 | Bacteria | 1101 |
| 152 | Ga0105239_12269308 | 3300010375 | Unclassified | 631 |
| 153 | Ga0105246_10144257 | 3300011119 | Bacteria | 1794 |
| 154 | Ga0105246_10916375 | 3300011119 | Bacteria | 787 |
| 155 | Ga0105246_12419665 | 3300011119 | Unclassified | 515 |
| 156 | Ga0157322_1027413 | 3300012490 | Bacteria | 588 |
| 157 | Ga0157324_1053699 | 3300012506 | Bacteria | 532 |
| 158 | Ga0157324_1059522 | 3300012506 | Bacteria | 519 |
| 159 | Ga0157342_1011857 | 3300012507 | Unclassified | 911 |
| 160 | Ga0157369_10252067 | 3300013105 | Bacteria | 1842 |
| 161 | Ga0157374_12074564 | 3300013296 | Bacteria | 595 |
| 162 | Ga0157378_10828908 | 3300013297 | Bacteria | 952 |
| 163 | Ga0157378_12867965 | 3300013297 | Unclassified | 534 |
| 164 | Ga0163162_10188173 | 3300013306 | Bacteria | 2192 |
| 165 | Ga0163162_11672593 | 3300013306 | Bacteria | 727 |
| 166 | Ga0163162_12859560 | 3300013306 | Unclassified | 556 |
| 167 | Ga0157372_10510051 | 3300013307 | Bacteria | 1402 |
| 168 | Ga0157372_10555291 | 3300013307 | Bacteria | 1339 |
| 169 | Ga0157372_10574372 | 3300013307 | Unclassified | 1314 |
| 170 | Ga0157372_11252820 | 3300013307 | Bacteria | 856 |
| 171 | Ga0157375_10604807 | 3300013308 | Bacteria | 1255 |
| 172 | Ga0157375_10981788 | 3300013308 | Bacteria | 985 |
| 173 | Ga0157375_11491671 | 3300013308 | Bacteria | 798 |
| 174 | Ga0163163_10381694 | 3300014325 | Bacteria | 1467 |
| 175 | Ga0163163_11646039 | 3300014325 | Bacteria | 703 |
| 176 | Ga0163163_12152006 | 3300014325 | Bacteria | 617 |
| 177 | Ga0157380_10436467 | 3300014326 | Bacteria | 1253 |
| 178 | Ga0157380_10822063 | 3300014326 | Bacteria | 948 |
| 179 | Ga0157380_11256629 | 3300014326 | Bacteria | 786 |
| 180 | Ga0182008_10906796 | 3300014497 | Unclassified | 519 |
| 181 | Ga0157377_10247436 | 3300014745 | Bacteria | 1154 |
| 182 | Ga0157377_11443606 | 3300014745 | Bacteria | 544 |
| 183 | Ga0157377_11498394 | 3300014745 | Bacteria | 536 |
| 184 | Ga0157379_10228934 | 3300014968 | Bacteria | 1685 |
| 185 | Ga0157379_10667586 | 3300014968 | Bacteria | 974 |
| 186 | Ga0157376_10855826 | 3300014969 | Bacteria | 925 |
| 187 | Ga0206355_1007951 | 3300020076 | Bacteria | 511 |
| 188 | Ga0206353_10646032 | 3300020082 | Bacteria | 564 |
| 189 | Ga0154015_1370048 | 3300020610 | Bacteria | 545 |
| 190 | Ga0213876_10300243 | 3300021384 | Bacteria | 854 |
| 191 | Ga0207426_1006751 | 3300025302 | Bacteria | 4918 |
| 192 | Ga0207426_1115271 | 3300025302 | Bacteria | 671 |
| 193 | Ga0207643_10078414 | 3300025908 | Bacteria | 1911 |
| 194 | Ga0207643_10284558 | 3300025908 | Bacteria | 1026 |
| 195 | Ga0207643_10288326 | 3300025908 | Bacteria | 1019 |
| 196 | Ga0207705_10971064 | 3300025909 | Bacteria | 657 |
| 197 | Ga0207684_11369004 | 3300025910 | Bacteria | 580 |
| 198 | Ga0207707_10598496 | 3300025912 | Bacteria | 933 |
| 199 | Ga0207707_10864486 | 3300025912 | Bacteria | 750 |
| 200 | Ga0207671_10908176 | 3300025914 | Bacteria | 696 |
| 201 | Ga0207693_10000002 | 3300025915 | Bacteria | 304011 |
| 202 | Ga0207660_10944250 | 3300025917 | Bacteria | 704 |
| 203 | Ga0207660_11383802 | 3300025917 | Bacteria | 570 |
| 204 | Ga0207657_10314924 | 3300025919 | Bacteria | 1238 |
| 205 | Ga0207649_11062037 | 3300025920 | Bacteria | 638 |
| 206 | Ga0207652_10619879 | 3300025921 | Bacteria | 969 |
| 207 | Ga0207646_11533332 | 3300025922 | Bacteria | 576 |
| 208 | Ga0207687_10791141 | 3300025927 | Bacteria | 809 |
| 209 | Ga0207687_11953875 | 3300025927 | Bacteria | 501 |
| 210 | Ga0207644_10973845 | 3300025931 | Bacteria | 712 |
| 211 | Ga0207690_10327774 | 3300025932 | Bacteria | 1205 |
| 212 | Ga0207690_10438586 | 3300025932 | Bacteria | 1048 |
| 213 | Ga0207690_11278688 | 3300025932 | Unclassified | 613 |
| 214 | Ga0207690_11679631 | 3300025932 | Unclassified | 531 |
| 215 | Ga0207706_10119870 | 3300025933 | Bacteria | 2313 |
| 216 | Ga0207706_10324411 | 3300025933 | Bacteria | 1340 |
| 217 | Ga0207686_10876712 | 3300025934 | Bacteria | 723 |
| 218 | Ga0207709_10542891 | 3300025935 | Bacteria | 913 |
| 219 | Ga0207709_11712121 | 3300025935 | Unclassified | 523 |
| 220 | Ga0207709_11754390 | 3300025935 | Bacteria | 516 |
| 221 | Ga0207670_10855915 | 3300025936 | Bacteria | 760 |
| 222 | Ga0207669_11290697 | 3300025937 | Bacteria | 620 |
| 223 | Ga0207704_10495780 | 3300025938 | Bacteria | 983 |
| 224 | Ga0207691_10237856 | 3300025940 | Bacteria | 1575 |
| 225 | Ga0207711_10145924 | 3300025941 | Bacteria | 2132 |
| 226 | Ga0207689_10516844 | 3300025942 | Bacteria | 1001 |
| 227 | Ga0207689_11190719 | 3300025942 | Bacteria | 641 |
| 228 | Ga0207661_10019392 | 3300025944 | Bacteria | 5070 |
| 229 | Ga0207661_10554137 | 3300025944 | Bacteria | 1053 |
| 230 | Ga0207661_10660439 | 3300025944 | Bacteria | 961 |
| 231 | Ga0207661_10722245 | 3300025944 | Bacteria | 917 |
| 232 | Ga0207661_11607857 | 3300025944 | Unclassified | 595 |
| 233 | Ga0207661_11799654 | 3300025944 | Bacteria | 558 |
| 234 | Ga0207679_10369039 | 3300025945 | Bacteria | 1256 |
| 235 | Ga0207679_10663420 | 3300025945 | Bacteria | 944 |
| 236 | Ga0207651_10975064 | 3300025960 | Bacteria | 757 |
| 237 | Ga0207712_11698883 | 3300025961 | Unclassified | 566 |
| 238 | Ga0207640_10435636 | 3300025981 | Bacteria | 1076 |
| 239 | Ga0207640_11546686 | 3300025981 | Bacteria | 597 |
| 240 | Ga0207677_10286049 | 3300026023 | Bacteria | 1355 |
| 241 | Ga0207677_10370282 | 3300026023 | Bacteria | 1206 |
| 242 | Ga0207677_11826292 | 3300026023 | Unclassified | 564 |
| 243 | Ga0207678_10156817 | 3300026067 | Bacteria | 1944 |
| 244 | Ga0207708_10005757 | 3300026075 | Bacteria | 9158 |
| 245 | Ga0207708_10213861 | 3300026075 | Bacteria | 1542 |
| 246 | Ga0207708_10445448 | 3300026075 | Bacteria | 1078 |
| 247 | Ga0207708_10897565 | 3300026075 | Unclassified | 767 |
| 248 | Ga0207708_10912785 | 3300026075 | Bacteria | 760 |
| 249 | Ga0207702_12418239 | 3300026078 | Bacteria | 512 |
| 250 | Ga0207648_10182808 | 3300026089 | Bacteria | 1856 |
| 251 | Ga0207648_11166538 | 3300026089 | Bacteria | 723 |
| 252 | Ga0207648_11860674 | 3300026089 | Archaea | 563 |
| 253 | Ga0207676_10560236 | 3300026095 | Unclassified | 1093 |
| 254 | Ga0207676_11066075 | 3300026095 | Bacteria | 798 |
| 255 | Ga0207676_11714988 | 3300026095 | Bacteria | 626 |
| 256 | Ga0207675_100386734 | 3300026118 | Bacteria | 1377 |
| 257 | Ga0207683_10434706 | 3300026121 | Bacteria | 1209 |
| 258 | Ga0207683_10796438 | 3300026121 | Bacteria | 877 |
| 259 | Ga0207683_11510442 | 3300026121 | Bacteria | 620 |
| 260 | Ga0207698_10234862 | 3300026142 | Bacteria | 1667 |
| 261 | Ga0207698_10494096 | 3300026142 | Bacteria | 1190 |
| 262 | Ga0207698_10522015 | 3300026142 | Bacteria | 1159 |
| 263 | Ga0207428_10064979 | 3300027907 | Bacteria | 2880 |
| 264 | Ga0207428_10189504 | 3300027907 | Unclassified | 1551 |
| 265 | Ga0207428_10740445 | 3300027907 | Bacteria | 701 |
| 266 | Ga0268264_11031957 | 3300028381 | Bacteria | 829 |
| 267 | Ga0268264_12109318 | 3300028381 | Bacteria | 572 |
| 268 | Ga0307408_100089992 | 3300031548 | Bacteria | 2315 |
| 269 | Ga0307408_100131681 | 3300031548 | Bacteria | 1952 |
| 270 | Ga0307408_101529833 | 3300031548 | Unclassified | 632 |
| 271 | Ga0307408_101738237 | 3300031548 | Bacteria | 595 |
| 272 | Ga0307405_10660239 | 3300031731 | Bacteria | 861 |
| 273 | Ga0307405_11048876 | 3300031731 | Bacteria | 698 |
| 274 | Ga0307413_10488078 | 3300031824 | Bacteria | 986 |
| 275 | Ga0307413_10492876 | 3300031824 | Bacteria | 982 |
| 276 | Ga0307413_10704161 | 3300031824 | Bacteria | 839 |
| 277 | Ga0307413_10774212 | 3300031824 | Bacteria | 804 |
| 278 | Ga0307413_10856736 | 3300031824 | Bacteria | 768 |
| 279 | Ga0307410_10155440 | 3300031852 | Bacteria | 1708 |
| 280 | Ga0307410_10240776 | 3300031852 | Bacteria | 1402 |
| 281 | Ga0307410_10384592 | 3300031852 | Bacteria | 1130 |
| 282 | Ga0307410_11178694 | 3300031852 | Bacteria | 667 |
| 283 | Ga0307410_11788476 | 3300031852 | Bacteria | 546 |
| 284 | Ga0307410_11811216 | 3300031852 | Bacteria | 542 |
| 285 | Ga0307410_12009546 | 3300031852 | Bacteria | 516 |
| 286 | Ga0307406_10119231 | 3300031901 | Bacteria | 1831 |
| 287 | Ga0307406_11100383 | 3300031901 | Bacteria | 686 |
| 288 | Ga0307406_11898455 | 3300031901 | Unclassified | 531 |
| 289 | Ga0307406_12095974 | 3300031901 | Bacteria | 507 |
| 290 | Ga0307407_11116148 | 3300031903 | Bacteria | 613 |
| 291 | Ga0307412_10056363 | 3300031911 | Bacteria | 2619 |
| 292 | Ga0307412_10593706 | 3300031911 | Bacteria | 937 |
| 293 | Ga0307412_11244505 | 3300031911 | Bacteria | 668 |
| 294 | Ga0307409_100155714 | 3300031995 | Bacteria | 1991 |
| 295 | Ga0307409_100259550 | 3300031995 | Bacteria | 1594 |
| 296 | Ga0307409_100311608 | 3300031995 | Bacteria | 1469 |
| 297 | Ga0307409_100366075 | 3300031995 | Bacteria | 1365 |
| 298 | Ga0307409_100409667 | 3300031995 | Bacteria | 1297 |
| 299 | Ga0307409_100660141 | 3300031995 | Bacteria | 1041 |
| 300 | Ga0307416_100273520 | 3300032002 | Bacteria | 1660 |
| 301 | Ga0307416_100311152 | 3300032002 | Bacteria | 1572 |
| 302 | Ga0307416_100331773 | 3300032002 | Bacteria | 1529 |
| 303 | Ga0307416_101450641 | 3300032002 | Bacteria | 792 |
| 304 | Ga0307416_102162223 | 3300032002 | Bacteria | 658 |
| 305 | Ga0307414_10793510 | 3300032004 | Bacteria | 863 |
| 306 | Ga0307414_10926595 | 3300032004 | Bacteria | 800 |
| 307 | Ga0307411_10746876 | 3300032005 | Bacteria | 857 |
| 308 | Ga0307411_11159828 | 3300032005 | Bacteria | 699 |
| 309 | Ga0307415_100005507 | 3300032126 | Bacteria | 6729 |
| 310 | Ga0307415_100236456 | 3300032126 | Bacteria | 1475 |
| 311 | Ga0307415_100238314 | 3300032126 | Unclassified | 1470 |
| 312 | Ga0307415_100445266 | 3300032126 | Bacteria | 1118 |
| 313 | Ga0307415_100783990 | 3300032126 | Bacteria | 868 |
| 314 | Ga0307415_101459164 | 3300032126 | Bacteria | 653 |
| 315 | Ga0307415_101585870 | 3300032126 | Bacteria | 628 |
| 316 | Ga0307415_102046326 | 3300032126 | Bacteria | 558 |
| 317 | Ga0373960_0190451 | 3300035121 | Unclassified | 720 |
| 318 | Ga0373931_0532602 | 3300035691 | Unclassified | 761 |
| 319 | Ga0373947_0151885 | 3300035725 | Bacteria | 1492 |
| 320 | Ga0395899_0256195 | 3300037312 | Bacteria | 1199 |
| 321 | Ga0395900_0421278 | 3300037418 | Unclassified | 1296 |
| 322 | Ga0395900_0492620 | 3300037418 | Unclassified | 1177 |
| 323 | Ga0395900_1299081 | 3300037418 | Unclassified | 642 |
| 324 | Ga0395900_1667910 | 3300037418 | Bacteria | 548 |
| 325 | Ga0395898_0558228 | 3300037466 | Bacteria | 1087 |
| 326 | Ga0395898_1799683 | 3300037466 | Bacteria | 534 |
| 327 | Ga0395905_0301576 | 3300037471 | Bacteria | 1490 |
| 328 | Ga0395905_0458368 | 3300037471 | Unclassified | 1173 |
| 329 | Ga0395901_0313264 | 3300038443 | Bacteria | 1625 |
| 330 | Ga0395901_0650830 | 3300038443 | Bacteria | 1057 |
| 331 | Ga0395901_1056933 | 3300038443 | Bacteria | 784 |
| 332 | Ga0451787_323018 | 3300041441 | Bacteria | 592 |
| 333 | Ga0451789_1082744 | 3300041443 | Bacteria | 725 |
| 334 | Ga0451789_1158005 | 3300041443 | Unclassified | 538 |
| 335 | Ga0451791_1407336 | 3300041451 | Bacteria | 765 |
| 336 | Ga0451793_1630748 | 3300041452 | Unclassified | 561 |
| 337 | Ga0451797_1079570 | 3300041453 | Bacteria | 1432 |
| 338 | Ga0451795_0597290 | 3300041456 | Unclassified | 687 |
| 339 | Ga0451795_0683988 | 3300041456 | Bacteria | 901 |
| 340 | Ga0451800_0192531 | 3300041459 | Unclassified | 816 |
| 341 | Ga0451800_0294588 | 3300041459 | Bacteria | 734 |
| 342 | Ga0451804_0797679 | 3300041463 | Bacteria | 790 |
| 343 | Ga0451807_1967488 | 3300041486 | Bacteria | 537 |
| 344 | Ga0451833_1428254 | 3300041491 | Bacteria | 515 |
| 345 | Ga0451845_0767674 | 3300041501 | Bacteria | 607 |
| 346 | Ga0451847_0314040 | 3300041503 | Bacteria | 912 |
| 347 | Ga0451843_0136082 | 3300041509 | Unclassified | 914 |
| 348 | Ga0439448_0177693 | 3300042005 | Bacteria | 743 |
| 349 | Ga0439450_102253 | 3300042008 | Bacteria | 728 |
| 350 | Ga0450888_019593 | 3300042126 | Bacteria | 854 |
| 351 | Ga0439444_0092503 | 3300042437 | Bacteria | 676 |
| 352 | Ga0439459_0123402 | 3300042438 | Bacteria | 655 |
| 353 | Ga0439464_0193869 | 3300042439 | Bacteria | 646 |
| 354 | Ga0439464_0285829 | 3300042439 | Bacteria | 537 |
| 355 | Ga0466972_0305581 | 3300044658 | Bacteria | 743 |
| 356 | Ga0466972_0613129 | 3300044658 | Bacteria | 515 |
| 357 | Ga0466965_0286716 | 3300044683 | Bacteria | 890 |
| 358 | Ga0466965_0288620 | 3300044683 | Bacteria | 888 |
| 359 | Ga0466965_0500261 | 3300044683 | Bacteria | 681 |
| 360 | Ga0466965_0519218 | 3300044683 | Bacteria | 670 |
| 361 | Ga0466961_0418749 | 3300044693 | Bacteria | 812 |
| 362 | Ga0466963_0017791 | 3300044694 | Bacteria | 4434 |
| 363 | Ga0466963_0070694 | 3300044694 | Bacteria | 2348 |
| 364 | Ga0466963_0281990 | 3300044694 | Bacteria | 1168 |
| 365 | Ga0466963_0574795 | 3300044694 | Unclassified | 796 |
| 366 | Ga0466964_0212425 | 3300044706 | Bacteria | 935 |
| 367 | Ga0466964_0365269 | 3300044706 | Unclassified | 745 |
| 368 | Ga0466971_0073776 | 3300044719 | Bacteria | 1551 |
| 369 | Ga0466971_0092959 | 3300044719 | Bacteria | 1382 |
| 370 | Ga0466957_0090422 | 3300044842 | Bacteria | 1917 |
| 371 | Ga0466957_0365781 | 3300044842 | Bacteria | 981 |
| 372 | Ga0466957_0715777 | 3300044842 | Bacteria | 707 |
| 373 | Ga0466957_0864262 | 3300044842 | Bacteria | 645 |
| 374 | Ga0466957_1012944 | 3300044842 | Bacteria | 597 |
| 375 | Ga0466960_0027385 | 3300044901 | Bacteria | 2599 |
| 376 | Ga0466960_0199677 | 3300044901 | Bacteria | 1092 |
| 377 | Ga0466960_0270615 | 3300044901 | Bacteria | 949 |
| 378 | Ga0466960_0509568 | 3300044901 | Bacteria | 706 |
| 379 | Ga0466958_0459711 | 3300045836 | Unclassified | 824 |
| 380 | Ga0466967_0015338 | 3300045976 | Bacteria | 6001 |
| 381 | Ga0466967_0035695 | 3300045976 | Bacteria | 4235 |
| 382 | Ga0466967_0044190 | 3300045976 | Bacteria | 3862 |
| 383 | Ga0466967_0067025 | 3300045976 | Bacteria | 3201 |
| 384 | Ga0466967_0123510 | 3300045976 | Bacteria | 2395 |
| 385 | Ga0466967_0125747 | 3300045976 | Bacteria | 2375 |
| 386 | Ga0466967_0152209 | 3300045976 | Bacteria | 2163 |
| 387 | Ga0466967_0178197 | 3300045976 | Bacteria | 2003 |
| 388 | Ga0466967_0225720 | 3300045976 | Bacteria | 1782 |
| 389 | Ga0466967_0332484 | 3300045976 | Bacteria | 1467 |
| 390 | Ga0466967_0536400 | 3300045976 | Bacteria | 1151 |
| 391 | Ga0466967_0580628 | 3300045976 | Bacteria | 1105 |
| 392 | Ga0466967_0874352 | 3300045976 | Unclassified | 893 |
| 393 | Ga0466967_0949841 | 3300045976 | Bacteria | 855 |
| 394 | Ga0466967_1031703 | 3300045976 | Bacteria | 819 |
| 395 | Ga0466967_1094199 | 3300045976 | Bacteria | 794 |
| 396 | Ga0466967_1459042 | 3300045976 | Bacteria | 681 |
| 397 | Ga0495629_1015956 | 3300046459 | Bacteria | 539 |
| 398 | Ga0495638_0492627 | 3300046460 | Bacteria | 619 |
| 399 | Ga0495582_0259934 | 3300046473 | Bacteria | 996 |
| 400 | Ga0495664_0190226 | 3300046477 | Bacteria | 1244 |
| 401 | Ga0495664_0483766 | 3300046477 | Bacteria | 740 |
| 402 | Ga0495584_0493716 | 3300046491 | Bacteria | 623 |
| 403 | Ga0495596_0054736 | 3300046500 | Bacteria | 1560 |
| 404 | Ga0495596_0261474 | 3300046500 | Unclassified | 672 |
| 405 | Ga0495618_0475359 | 3300046514 | Bacteria | 756 |
| 406 | Ga0495620_0222617 | 3300046515 | Bacteria | 722 |
| 407 | Ga0495644_0040291 | 3300046523 | Unclassified | 1761 |
| 408 | Ga0495644_0190413 | 3300046523 | Unclassified | 790 |
| 409 | Ga0495644_0313624 | 3300046523 | Bacteria | 615 |
| 410 | Ga0495663_0070414 | 3300046525 | Unclassified | 1113 |
| 411 | Ga0495663_0321424 | 3300046525 | Bacteria | 560 |
| 412 | Ga0495663_0387447 | 3300046525 | Bacteria | 513 |
| 413 | Ga0495652_0516793 | 3300046529 | Bacteria | 826 |
| 414 | Ga0495586_0420656 | 3300046535 | Bacteria | 769 |
| 415 | Ga0495587_0838132 | 3300046536 | Bacteria | 501 |
| 416 | Ga0495609_0198630 | 3300046538 | Bacteria | 839 |
| 417 | Ga0495667_0291207 | 3300046559 | Bacteria | 1035 |
| 418 | Ga0495656_0246822 | 3300046615 | Bacteria | 901 |
| 419 | Ga0495656_0428681 | 3300046615 | Bacteria | 695 |
| 420 | Ga0495611_0405155 | 3300046648 | Bacteria | 623 |
| 421 | Ga0495661_0599909 | 3300046665 | Bacteria | 518 |
| 422 | Ga0495658_1099620 | 3300046683 | Bacteria | 507 |
| 423 | Ga0495613_1059135 | 3300046689 | Bacteria | 519 |
| 424 | Ga0495589_0455344 | 3300046794 | Bacteria | 585 |
| 425 | Ga0495604_0948881 | 3300047317 | Bacteria | 535 |
| 426 | Ga0495680_0306092 | 3300047322 | Bacteria | 1115 |
| 427 | Ga0496101_1120558 | 3300048904 | Unclassified | 618 |
| 428 | Ga0496102_0194993 | 3300048905 | Bacteria | 1909 |
| 429 | Ga0496102_1156394 | 3300048905 | Bacteria | 693 |
| 430 | Ga0496102_1386986 | 3300048905 | Bacteria | 622 |
| 431 | Ga0496103_0883193 | 3300048906 | Unclassified | 561 |
| 432 | Ga0496109_1011052 | 3300048912 | Bacteria | 769 |
| 433 | Ga0496110_0081063 | 3300048913 | Bacteria | 2893 |
| 434 | Ga0496110_0140211 | 3300048913 | Bacteria | 2186 |
| 435 | Ga0496110_0780777 | 3300048913 | Bacteria | 859 |
| 436 | Ga0496111_0269833 | 3300048914 | Bacteria | 1262 |
| 437 | Ga0496112_0019897 | 3300048915 | Bacteria | 6352 |
| 438 | Ga0496112_0628569 | 3300048915 | Bacteria | 1004 |
| 439 | Ga0496113_0238226 | 3300048916 | Bacteria | 1452 |
| 440 | Ga0496114_0234232 | 3300048917 | Unclassified | 1614 |
| 441 | Ga0496117_0305738 | 3300048920 | Bacteria | 840 |
| 442 | Ga0496121_0001852 | 3300048924 | Bacteria | 34009 |
| 443 | Ga0496121_0159888 | 3300048924 | Bacteria | 1649 |
| 444 | Ga0496123_0270192 | 3300048926 | Bacteria | 828 |
| 445 | Ga0496126_0454244 | 3300048929 | Bacteria | 1031 |
| 446 | Ga0501291_080724 | 3300049514 | Bacteria | 647 |
| 447 | Ga0501031_0006574 | 3300049568 | Bacteria | 7585 |
| 448 | Ga0501031_0116167 | 3300049568 | Bacteria | 1748 |
| 449 | Ga0501031_0360305 | 3300049568 | Unclassified | 941 |
| 450 | Ga0501032_0004579 | 3300049569 | Bacteria | 10405 |
| 451 | Ga0501033_0040455 | 3300049570 | Bacteria | 3479 |
| 452 | Ga0501034_0609513 | 3300049571 | Bacteria | 996 |
| 453 | Ga0501034_0678880 | 3300049571 | Bacteria | 930 |
| 454 | Ga0501036_0007948 | 3300049572 | Bacteria | 8680 |
| 455 | Ga0501036_0527475 | 3300049572 | Unclassified | 982 |
| 456 | Ga0501037_0031528 | 3300049573 | Bacteria | 3913 |
| 457 | Ga0501038_0023733 | 3300049574 | Bacteria | 5480 |
| 458 | Ga0501038_0080995 | 3300049574 | Bacteria | 2736 |
| 459 | Ga0501039_0014446 | 3300049575 | Bacteria | 6046 |
| 460 | Ga0501039_0096452 | 3300049575 | Bacteria | 2305 |
| 461 | Ga0501039_0148573 | 3300049575 | Bacteria | 1842 |
| 462 | Ga0501040_0138989 | 3300049576 | Bacteria | 1710 |
| 463 | Ga0501040_1348335 | 3300049576 | Unclassified | 518 |
| 464 | Ga0501041_0888280 | 3300049577 | Unclassified | 572 |
| 465 | Ga0501041_0893918 | 3300049577 | Bacteria | 570 |
| 466 | Ga0501042_0008431 | 3300049578 | Bacteria | 6805 |
| 467 | Ga0501042_0066927 | 3300049578 | Bacteria | 2568 |
| 468 | Ga0501042_0482086 | 3300049578 | Unclassified | 900 |
| 469 | Ga0501042_1431987 | 3300049578 | Unclassified | 504 |
| 470 | Ga0501043_0029483 | 3300049579 | Bacteria | 4311 |
| 471 | Ga0501046_0004826 | 3300049580 | Bacteria | 12153 |
| 472 | Ga0501046_0419561 | 3300049580 | Bacteria | 965 |
| 473 | Ga0501047_0068981 | 3300049581 | Bacteria | 3405 |
| 474 | Ga0501048_0045758 | 3300049582 | Bacteria | 3125 |
| 475 | Ga0501048_0051780 | 3300049582 | Bacteria | 2921 |
| 476 | Ga0501048_0360572 | 3300049582 | Bacteria | 1037 |
| 477 | Ga0501048_1128209 | 3300049582 | Unclassified | 564 |
| 478 | Ga0501067_0009483 | 3300049583 | Bacteria | 5392 |
| 479 | Ga0501067_0774289 | 3300049583 | Bacteria | 540 |
| 480 | Ga0501068_0292112 | 3300049584 | Bacteria | 1042 |
| 481 | Ga0501069_0155231 | 3300049585 | Bacteria | 1316 |
| 482 | Ga0501069_0172902 | 3300049585 | Bacteria | 1247 |
| 483 | Ga0501069_0552142 | 3300049585 | Bacteria | 689 |
| 484 | Ga0501070_0023847 | 3300049586 | Bacteria | 5127 |
| 485 | Ga0501070_0169118 | 3300049586 | Bacteria | 1801 |
| 486 | Ga0501070_1277338 | 3300049586 | Bacteria | 561 |
| 487 | Ga0501072_0023897 | 3300049588 | Bacteria | 4750 |
| 488 | Ga0501072_0202904 | 3300049588 | Bacteria | 1581 |
| 489 | Ga0501072_0540157 | 3300049588 | Unclassified | 921 |
| 490 | Ga0501073_0017616 | 3300049589 | Bacteria | 5172 |
| 491 | Ga0501073_0965249 | 3300049589 | Bacteria | 587 |
| 492 | Ga0501074_0611682 | 3300049590 | Bacteria | 770 |
| 493 | Ga0501074_1034400 | 3300049590 | Bacteria | 577 |
| 494 | Ga0501075_0022229 | 3300049591 | Bacteria | 4631 |
| 495 | Ga0501075_0139403 | 3300049591 | Bacteria | 1848 |
| 496 | Ga0501076_0042705 | 3300049592 | Bacteria | 3570 |
| 497 | Ga0501076_0475613 | 3300049592 | Unclassified | 1029 |
| 498 | Ga0501209_263459 | 3300049656 | Bacteria | 540 |
| 499 | Ga0501079_0106256 | 3300049741 | Bacteria | 2178 |
| 500 | Ga0501079_0186378 | 3300049741 | Bacteria | 1620 |
| 501 | Ga0501079_0524354 | 3300049741 | Unclassified | 931 |
| 502 | Ga0501080_0043279 | 3300049742 | Bacteria | 4193 |
| 503 | Ga0501080_0951691 | 3300049742 | Bacteria | 747 |
| 504 | Ga0501081_0323958 | 3300049743 | Bacteria | 1133 |
| 505 | Ga0501083_0011905 | 3300049744 | Bacteria | 6095 |
| 506 | Ga0501035_0124763 | 3300049822 | Bacteria | 2248 |
| 507 | Ga0501044_0368404 | 3300049823 | Bacteria | 1353 |
| 508 | Ga0501045_0045939 | 3300049824 | Bacteria | 3180 |
| 509 | Ga0501045_0080039 | 3300049824 | Bacteria | 2409 |
| 510 | Ga0501045_0547389 | 3300049824 | Bacteria | 858 |
| 511 | Ga0501045_0993405 | 3300049824 | Bacteria | 615 |
| 512 | nmdc:mga05p37_1053182_c1 | 3300050507 | Bacteria | 858 |
| 513 | nmdc:mga05p37_1852931_c1 | 3300050507 | Unclassified | 579 |
| 514 | nmdc:mga05p37_215907_c1 | 3300050507 | Bacteria | 2317 |
| 515 | nmdc:mga05p37_256299_c1 | 3300050507 | Bacteria | 2096 |
| 516 | nmdc:mga05p37_419620_c1 | 3300050507 | Bacteria | 1557 |
| 517 | nmdc:mga05p37_898326_c1 | 3300050507 | Bacteria | 955 |
| 518 | nmdc:mga09592_1125443_c1 | 3300050508 | Unclassified | 652 |
| 519 | nmdc:mga09592_855489_c1 | 3300050508 | Bacteria | 767 |
| 520 | nmdc:mga09592_953084_c1 | 3300050508 | Bacteria | 719 |
| 521 | nmdc:mga0qj67_1278624_c1 | 3300050509 | Bacteria | 569 |
| 522 | nmdc:mga0qj67_144203_c1 | 3300050509 | Bacteria | 1931 |
| 523 | nmdc:mga0qj67_368992_c1 | 3300050509 | Unclassified | 1159 |
| 524 | nmdc:mga0qj67_382527_c1 | 3300050509 | Bacteria | 1136 |
| 525 | nmdc:mga06r32_228166_c1 | 3300050510 | Bacteria | 1850 |
| 526 | nmdc:mga08y16_1693309_c1 | 3300050511 | Bacteria | 588 |
| 527 | nmdc:mga08y16_222939_c1 | 3300050511 | Unclassified | 1951 |
| 528 | nmdc:mga08y16_48355_c1 | 3300050511 | Bacteria | 4452 |
| 529 | nmdc:mga08y16_755028_c1 | 3300050511 | Bacteria | 968 |
| 530 | nmdc:mga08y16_876595_c1 | 3300050511 | Bacteria | 885 |
| 531 | nmdc:mga08y16_92959_c1 | 3300050511 | Bacteria | 3143 |
| 532 | Ga0495655_0234754 | 3300053083 | Unclassified | 612 |
| 533 | Ga0495655_0280057 | 3300053083 | Bacteria | 568 |
| 534 | Ga0495595_0455381 | 3300053084 | Bacteria | 650 |
| 535 | Ga0500616_0035021 | 3300053153 | Bacteria | 2731 |
| 536 | Ga0501084_0116789 | 3300054114 | Bacteria | 2243 |
| 537 | Ga0587073_0231129 | 3300059492 | Bacteria | 570 |
| 538 | Ga0587111_0236668 | 3300060346 | Bacteria | 534 |
| 539 | Ga0501082_0032873 | 3300060353 | Bacteria | 4474 |
| 540 | Ga0501082_0174053 | 3300060353 | Bacteria | 1871 |
| 541 | Ga0466962_0111310 | 3300061719 | Bacteria | 1318 |
| 542 | Ga0530510_0098203 | 3300061734 | Bacteria | 2141 |
| 543 | Ga0530510_0317209 | 3300061734 | Bacteria | 1168 |
| 544 | Ga0530510_0475274 | 3300061734 | Unclassified | 946 |
| 545 | Ga0530510_1273710 | 3300061734 | Bacteria | 564 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005985 | Ga0081539_10015236 | Ga0081539_100152364 | 96 |
| 2 | 3300009176 | Ga0105242_12305732 | Ga0105242_123057322 | 96 |
| 3 | 3300041501 | Ga0451845_0767674 | Ga0451845_0767674_152_448 | 96 |
| 4 | 3300046473 | Ga0495582_0259934 | Ga0495582_0259934_317_613 | 96 |
| 5 | 3300046536 | Ga0495587_0838132 | Ga0495587_0838132_150_446 | 96 |
| 6 | 3300038443 | Ga0395901_0313264 | Ga0395901_0313264_116_418 | 97 |
| 7 | 3300003373 | JGI25407J50210_10002441 | JGI25407J50210_100024414 | 98 |
| 8 | 3300003373 | JGI25407J50210_10010090 | JGI25407J50210_100100902 | 98 |
| 9 | 3300003373 | JGI25407J50210_10131222 | JGI25407J50210_101312221 | 98 |
| 10 | 3300005327 | Ga0070658_10451413 | Ga0070658_104514132 | 98 |
| 11 | 3300005327 | Ga0070658_11486536 | Ga0070658_114865361 | 98 |
| 12 | 3300005329 | Ga0070683_100101991 | Ga0070683_1001019912 | 98 |
| 13 | 3300005334 | Ga0068869_100619115 | Ga0068869_1006191152 | 98 |
| 14 | 3300005336 | Ga0070680_100062430 | Ga0070680_1000624302 | 98 |
| 15 | 3300005336 | Ga0070680_101001067 | Ga0070680_1010010672 | 98 |
| 16 | 3300005337 | Ga0070682_100577982 | Ga0070682_1005779822 | 98 |
| 17 | 3300005337 | Ga0070682_101263597 | Ga0070682_1012635971 | 98 |
| 18 | 3300005338 | Ga0068868_100365484 | Ga0068868_1003654842 | 98 |
| 19 | 3300005339 | Ga0070660_100421217 | Ga0070660_1004212172 | 98 |
| 20 | 3300005340 | Ga0070689_101909285 | Ga0070689_1019092852 | 98 |
| 21 | 3300005344 | Ga0070661_100224286 | Ga0070661_1002242864 | 98 |
| 22 | 3300005344 | Ga0070661_100846330 | Ga0070661_1008463302 | 98 |
| 23 | 3300005345 | Ga0070692_10232754 | Ga0070692_102327543 | 98 |
| 24 | 3300005345 | Ga0070692_10260833 | Ga0070692_102608332 | 98 |
| 25 | 3300005345 | Ga0070692_10464253 | Ga0070692_104642532 | 98 |
| 26 | 3300005353 | Ga0070669_100702618 | Ga0070669_1007026182 | 98 |
| 27 | 3300005366 | Ga0070659_100618902 | Ga0070659_1006189022 | 98 |
| 28 | 3300005366 | Ga0070659_101123901 | Ga0070659_1011239012 | 98 |
| 29 | 3300005366 | Ga0070659_101195331 | Ga0070659_1011953312 | 98 |
| 30 | 3300005366 | Ga0070659_101565781 | Ga0070659_1015657811 | 98 |
| 31 | 3300005438 | Ga0070701_10098613 | Ga0070701_100986134 | 98 |
| 32 | 3300005440 | Ga0070705_101272593 | Ga0070705_1012725932 | 98 |
| 33 | 3300005441 | Ga0070700_100109114 | Ga0070700_1001091142 | 98 |
| 34 | 3300005441 | Ga0070700_100413316 | Ga0070700_1004133162 | 98 |
| 35 | 3300005441 | Ga0070700_100788411 | Ga0070700_1007884112 | 98 |
| 36 | 3300005455 | Ga0070663_100403568 | Ga0070663_1004035682 | 98 |
| 37 | 3300005455 | Ga0070663_100782934 | Ga0070663_1007829342 | 98 |
| 38 | 3300005457 | Ga0070662_100803233 | Ga0070662_1008032332 | 98 |
| 39 | 3300005458 | Ga0070681_10134554 | Ga0070681_101345542 | 98 |
| 40 | 3300005458 | Ga0070681_10851049 | Ga0070681_108510491 | 98 |
| 41 | 3300005458 | Ga0070681_11026151 | Ga0070681_110261512 | 98 |
| 42 | 3300005458 | Ga0070681_12039474 | Ga0070681_120394741 | 98 |
| 43 | 3300005459 | Ga0068867_100293670 | Ga0068867_1002936702 | 98 |
| 44 | 3300005459 | Ga0068867_101599412 | Ga0068867_1015994122 | 98 |
| 45 | 3300005466 | Ga0070685_10429564 | Ga0070685_104295641 | 98 |
| 46 | 3300005466 | Ga0070685_10968327 | Ga0070685_109683272 | 98 |
| 47 | 3300005467 | Ga0070706_100461562 | Ga0070706_1004615622 | 98 |
| 48 | 3300005467 | Ga0070706_100994217 | Ga0070706_1009942172 | 98 |
| 49 | 3300005468 | Ga0070707_101034071 | Ga0070707_1010340712 | 98 |
| 50 | 3300005530 | Ga0070679_100178981 | Ga0070679_1001789812 | 98 |
| 51 | 3300005535 | Ga0070684_100043620 | Ga0070684_1000436203 | 98 |
| 52 | 3300005535 | Ga0070684_100179337 | Ga0070684_1001793373 | 98 |
| 53 | 3300005535 | Ga0070684_101192366 | Ga0070684_1011923661 | 98 |
| 54 | 3300005539 | Ga0068853_100587738 | Ga0068853_1005877382 | 98 |
| 55 | 3300005543 | Ga0070672_100798806 | Ga0070672_1007988062 | 98 |
| 56 | 3300005545 | Ga0070695_101145834 | Ga0070695_1011458341 | 98 |
| 57 | 3300005546 | Ga0070696_100333358 | Ga0070696_1003333582 | 98 |
| 58 | 3300005547 | Ga0070693_100193735 | Ga0070693_1001937351 | 98 |
| 59 | 3300005547 | Ga0070693_100360597 | Ga0070693_1003605972 | 98 |
| 60 | 3300005549 | Ga0070704_100844182 | Ga0070704_1008441822 | 98 |
| 61 | 3300005564 | Ga0070664_100097258 | Ga0070664_1000972584 | 98 |
| 62 | 3300005564 | Ga0070664_100419322 | Ga0070664_1004193222 | 98 |
| 63 | 3300005564 | Ga0070664_100640204 | Ga0070664_1006402041 | 98 |
| 64 | 3300005578 | Ga0068854_100866703 | Ga0068854_1008667032 | 98 |
| 65 | 3300005578 | Ga0068854_101059417 | Ga0068854_1010594172 | 98 |
| 66 | 3300005578 | Ga0068854_102078569 | Ga0068854_1020785692 | 98 |
| 67 | 3300005614 | Ga0068856_101560684 | Ga0068856_1015606842 | 98 |
| 68 | 3300005614 | Ga0068856_101599155 | Ga0068856_1015991552 | 98 |
| 69 | 3300005615 | Ga0070702_100214753 | Ga0070702_1002147532 | 98 |
| 70 | 3300005616 | Ga0068852_101031107 | Ga0068852_1010311072 | 98 |
| 71 | 3300005617 | Ga0068859_100223946 | Ga0068859_1002239465 | 98 |
| 72 | 3300005618 | Ga0068864_100313241 | Ga0068864_1003132413 | 98 |
| 73 | 3300005618 | Ga0068864_100944858 | Ga0068864_1009448582 | 98 |
| 74 | 3300005718 | Ga0068866_10332313 | Ga0068866_103323132 | 98 |
| 75 | 3300005718 | Ga0068866_10981821 | Ga0068866_109818212 | 98 |
| 76 | 3300005719 | Ga0068861_100401058 | Ga0068861_1004010582 | 98 |
| 77 | 3300005719 | Ga0068861_100641398 | Ga0068861_1006413981 | 98 |
| 78 | 3300005840 | Ga0068870_10493497 | Ga0068870_104934972 | 98 |
| 79 | 3300005840 | Ga0068870_11106990 | Ga0068870_111069902 | 98 |
| 80 | 3300005842 | Ga0068858_100858563 | Ga0068858_1008585632 | 98 |
| 81 | 3300005842 | Ga0068858_101650168 | Ga0068858_1016501682 | 98 |
| 82 | 3300005842 | Ga0068858_102251979 | Ga0068858_1022519792 | 98 |
| 83 | 3300005843 | Ga0068860_100904378 | Ga0068860_1009043782 | 98 |
| 84 | 3300005937 | Ga0081455_10004507 | Ga0081455_1000450712 | 98 |
| 85 | 3300005937 | Ga0081455_10181093 | Ga0081455_101810933 | 98 |
| 86 | 3300005937 | Ga0081455_10211013 | Ga0081455_102110133 | 98 |
| 87 | 3300005981 | Ga0081538_10000398 | Ga0081538_1000039816 | 98 |
| 88 | 3300005981 | Ga0081538_10001873 | Ga0081538_1000187310 | 98 |
| 89 | 3300005981 | Ga0081538_10006655 | Ga0081538_100066552 | 98 |
| 90 | 3300005981 | Ga0081538_10019419 | Ga0081538_100194196 | 98 |
| 91 | 3300005981 | Ga0081538_10119320 | Ga0081538_101193203 | 98 |
| 92 | 3300005981 | Ga0081538_10328557 | Ga0081538_103285572 | 98 |
| 93 | 3300005983 | Ga0081540_1099156 | Ga0081540_10991564 | 98 |
| 94 | 3300006051 | Ga0075364_10294812 | Ga0075364_102948122 | 98 |
| 95 | 3300006058 | Ga0075432_10072748 | Ga0075432_100727481 | 98 |
| 96 | 3300006058 | Ga0075432_10172934 | Ga0075432_101729342 | 98 |
| 97 | 3300006175 | Ga0070712_100000008 | Ga0070712_10000000849 | 98 |
| 98 | 3300006237 | Ga0097621_101624028 | Ga0097621_1016240281 | 98 |
| 99 | 3300006237 | Ga0097621_102019968 | Ga0097621_1020199682 | 98 |
| 100 | 3300006844 | Ga0075428_100013459 | Ga0075428_1000134598 | 98 |
| 101 | 3300006844 | Ga0075428_100240783 | Ga0075428_1002407833 | 98 |
| 102 | 3300006844 | Ga0075428_100318399 | Ga0075428_1003183992 | 98 |
| 103 | 3300006844 | Ga0075428_102215271 | Ga0075428_1022152712 | 98 |
| 104 | 3300006847 | Ga0075431_100223420 | Ga0075431_1002234202 | 98 |
| 105 | 3300006847 | Ga0075431_100677823 | Ga0075431_1006778231 | 98 |
| 106 | 3300006852 | Ga0075433_10075636 | Ga0075433_100756365 | 98 |
| 107 | 3300006880 | Ga0075429_100389828 | Ga0075429_1003898282 | 98 |
| 108 | 3300006880 | Ga0075429_100449080 | Ga0075429_1004490802 | 98 |
| 109 | 3300006880 | Ga0075429_100842775 | Ga0075429_1008427752 | 98 |
| 110 | 3300006880 | Ga0075429_101514283 | Ga0075429_1015142832 | 98 |
| 111 | 3300006881 | Ga0068865_100110562 | Ga0068865_1001105622 | 98 |
| 112 | 3300006881 | Ga0068865_100390417 | Ga0068865_1003904172 | 98 |
| 113 | 3300006881 | Ga0068865_100763115 | Ga0068865_1007631152 | 98 |
| 114 | 3300006931 | Ga0097620_100223925 | Ga0097620_1002239255 | 98 |
| 115 | 3300009036 | Ga0105244_10169008 | Ga0105244_101690082 | 98 |
| 116 | 3300009094 | Ga0111539_10004797 | Ga0111539_1000479715 | 98 |
| 117 | 3300009094 | Ga0111539_10011390 | Ga0111539_1001139010 | 98 |
| 118 | 3300009094 | Ga0111539_10243695 | Ga0111539_102436954 | 98 |
| 119 | 3300009094 | Ga0111539_10557021 | Ga0111539_105570213 | 98 |
| 120 | 3300009094 | Ga0111539_10922834 | Ga0111539_109228342 | 98 |
| 121 | 3300009094 | Ga0111539_12060695 | Ga0111539_120606952 | 98 |
| 122 | 3300009094 | Ga0111539_12316123 | Ga0111539_123161232 | 98 |
| 123 | 3300009098 | Ga0105245_10318320 | Ga0105245_103183203 | 98 |
| 124 | 3300009098 | Ga0105245_10323174 | Ga0105245_103231742 | 98 |
| 125 | 3300009098 | Ga0105245_10342413 | Ga0105245_103424134 | 98 |
| 126 | 3300009098 | Ga0105245_10848241 | Ga0105245_108482412 | 98 |
| 127 | 3300009098 | Ga0105245_11427127 | Ga0105245_114271271 | 98 |
| 128 | 3300009098 | Ga0105245_13086045 | Ga0105245_130860452 | 98 |
| 129 | 3300009098 | Ga0105245_13143382 | Ga0105245_131433821 | 98 |
| 130 | 3300009098 | Ga0105245_13280968 | Ga0105245_132809681 | 98 |
| 131 | 3300009147 | Ga0114129_10642668 | Ga0114129_106426682 | 98 |
| 132 | 3300009147 | Ga0114129_10701091 | Ga0114129_107010913 | 98 |
| 133 | 3300009147 | Ga0114129_10812074 | Ga0114129_108120743 | 98 |
| 134 | 3300009147 | Ga0114129_10856573 | Ga0114129_108565732 | 98 |
| 135 | 3300009147 | Ga0114129_12448064 | Ga0114129_124480642 | 98 |
| 136 | 3300009147 | Ga0114129_13497554 | Ga0114129_134975541 | 98 |
| 137 | 3300009148 | Ga0105243_10315449 | Ga0105243_103154492 | 98 |
| 138 | 3300009148 | Ga0105243_10426903 | Ga0105243_104269033 | 98 |
| 139 | 3300009148 | Ga0105243_11029811 | Ga0105243_110298112 | 98 |
| 140 | 3300009148 | Ga0105243_11318740 | Ga0105243_113187401 | 98 |
| 141 | 3300009148 | Ga0105243_12162986 | Ga0105243_121629861 | 98 |
| 142 | 3300009148 | Ga0105243_12458573 | Ga0105243_124585731 | 98 |
| 143 | 3300009174 | Ga0105241_10749323 | Ga0105241_107493233 | 98 |
| 144 | 3300009176 | Ga0105242_10742513 | Ga0105242_107425132 | 98 |
| 145 | 3300009176 | Ga0105242_11022599 | Ga0105242_110225992 | 98 |
| 146 | 3300009545 | Ga0105237_10676390 | Ga0105237_106763902 | 98 |
| 147 | 3300009551 | Ga0105238_10428287 | Ga0105238_104282872 | 98 |
| 148 | 3300009553 | Ga0105249_10009238 | Ga0105249_100092389 | 98 |
| 149 | 3300009553 | Ga0105249_11137165 | Ga0105249_111371652 | 98 |
| 150 | 3300009553 | Ga0105249_11225619 | Ga0105249_112256192 | 98 |
| 151 | 3300009553 | Ga0105249_12341909 | Ga0105249_123419091 | 98 |
| 152 | 3300010159 | Ga0099796_10256902 | Ga0099796_102569021 | 98 |
| 153 | 3300010375 | Ga0105239_10224909 | Ga0105239_102249094 | 98 |
| 154 | 3300010375 | Ga0105239_10225128 | Ga0105239_102251282 | 98 |
| 155 | 3300010375 | Ga0105239_10771556 | Ga0105239_107715563 | 98 |
| 156 | 3300010375 | Ga0105239_12269308 | Ga0105239_122693082 | 98 |
| 157 | 3300011119 | Ga0105246_10144257 | Ga0105246_101442572 | 98 |
| 158 | 3300011119 | Ga0105246_10916375 | Ga0105246_109163752 | 98 |
| 159 | 3300011119 | Ga0105246_12419665 | Ga0105246_124196652 | 98 |
| 160 | 3300012490 | Ga0157322_1027413 | Ga0157322_10274132 | 98 |
| 161 | 3300012506 | Ga0157324_1053699 | Ga0157324_10536991 | 98 |
| 162 | 3300012506 | Ga0157324_1059522 | Ga0157324_10595222 | 98 |
| 163 | 3300012507 | Ga0157342_1011857 | Ga0157342_10118572 | 98 |
| 164 | 3300013105 | Ga0157369_10252067 | Ga0157369_102520673 | 98 |
| 165 | 3300013296 | Ga0157374_12074564 | Ga0157374_120745641 | 98 |
| 166 | 3300013297 | Ga0157378_10828908 | Ga0157378_108289081 | 98 |
| 167 | 3300013297 | Ga0157378_12867965 | Ga0157378_128679651 | 98 |
| 168 | 3300013306 | Ga0163162_10188173 | Ga0163162_101881732 | 98 |
| 169 | 3300013306 | Ga0163162_11672593 | Ga0163162_116725932 | 98 |
| 170 | 3300013306 | Ga0163162_12859560 | Ga0163162_128595602 | 98 |
| 171 | 3300013307 | Ga0157372_10510051 | Ga0157372_105100512 | 98 |
| 172 | 3300013307 | Ga0157372_10555291 | Ga0157372_105552911 | 98 |
| 173 | 3300013307 | Ga0157372_10574372 | Ga0157372_105743722 | 98 |
| 174 | 3300013307 | Ga0157372_11252820 | Ga0157372_112528202 | 98 |
| 175 | 3300013308 | Ga0157375_10604807 | Ga0157375_106048072 | 98 |
| 176 | 3300013308 | Ga0157375_10981788 | Ga0157375_109817882 | 98 |
| 177 | 3300013308 | Ga0157375_11491671 | Ga0157375_114916711 | 98 |
| 178 | 3300014325 | Ga0163163_10381694 | Ga0163163_103816942 | 98 |
| 179 | 3300014325 | Ga0163163_11646039 | Ga0163163_116460391 | 98 |
| 180 | 3300014325 | Ga0163163_12152006 | Ga0163163_121520062 | 98 |
| 181 | 3300014326 | Ga0157380_10436467 | Ga0157380_104364672 | 98 |
| 182 | 3300014326 | Ga0157380_10822063 | Ga0157380_108220633 | 98 |
| 183 | 3300014326 | Ga0157380_11256629 | Ga0157380_112566292 | 98 |
| 184 | 3300014497 | Ga0182008_10906796 | Ga0182008_109067961 | 98 |
| 185 | 3300014745 | Ga0157377_10247436 | Ga0157377_102474362 | 98 |
| 186 | 3300014745 | Ga0157377_11443606 | Ga0157377_114436062 | 98 |
| 187 | 3300014745 | Ga0157377_11498394 | Ga0157377_114983942 | 98 |
| 188 | 3300014968 | Ga0157379_10228934 | Ga0157379_102289343 | 98 |
| 189 | 3300014968 | Ga0157379_10667586 | Ga0157379_106675862 | 98 |
| 190 | 3300014969 | Ga0157376_10855826 | Ga0157376_108558262 | 98 |
| 191 | 3300020076 | Ga0206355_1007951 | Ga0206355_10079512 | 98 |
| 192 | 3300020082 | Ga0206353_10646032 | Ga0206353_106460322 | 98 |
| 193 | 3300020610 | Ga0154015_1370048 | Ga0154015_13700481 | 98 |
| 194 | 3300021384 | Ga0213876_10300243 | Ga0213876_103002432 | 98 |
| 195 | 3300025302 | Ga0207426_1006751 | Ga0207426_10067512 | 98 |
| 196 | 3300025302 | Ga0207426_1115271 | Ga0207426_11152712 | 98 |
| 197 | 3300025908 | Ga0207643_10078414 | Ga0207643_100784144 | 98 |
| 198 | 3300025908 | Ga0207643_10284558 | Ga0207643_102845582 | 98 |
| 199 | 3300025908 | Ga0207643_10288326 | Ga0207643_102883263 | 98 |
| 200 | 3300025909 | Ga0207705_10971064 | Ga0207705_109710642 | 98 |
| 201 | 3300025910 | Ga0207684_11369004 | Ga0207684_113690042 | 98 |
| 202 | 3300025912 | Ga0207707_10598496 | Ga0207707_105984962 | 98 |
| 203 | 3300025912 | Ga0207707_10864486 | Ga0207707_108644861 | 98 |
| 204 | 3300025914 | Ga0207671_10908176 | Ga0207671_109081762 | 98 |
| 205 | 3300025915 | Ga0207693_10000002 | Ga0207693_10000002292 | 98 |
| 206 | 3300025917 | Ga0207660_10944250 | Ga0207660_109442502 | 98 |
| 207 | 3300025917 | Ga0207660_11383802 | Ga0207660_113838021 | 98 |
| 208 | 3300025919 | Ga0207657_10314924 | Ga0207657_103149241 | 98 |
| 209 | 3300025920 | Ga0207649_11062037 | Ga0207649_110620372 | 98 |
| 210 | 3300025921 | Ga0207652_10619879 | Ga0207652_106198792 | 98 |
| 211 | 3300025922 | Ga0207646_11533332 | Ga0207646_115333322 | 98 |
| 212 | 3300025927 | Ga0207687_10791141 | Ga0207687_107911412 | 98 |
| 213 | 3300025927 | Ga0207687_11953875 | Ga0207687_119538751 | 98 |
| 214 | 3300025931 | Ga0207644_10973845 | Ga0207644_109738452 | 98 |
| 215 | 3300025932 | Ga0207690_10327774 | Ga0207690_103277742 | 98 |
| 216 | 3300025932 | Ga0207690_10438586 | Ga0207690_104385861 | 98 |
| 217 | 3300025932 | Ga0207690_11278688 | Ga0207690_112786882 | 98 |
| 218 | 3300025932 | Ga0207690_11679631 | Ga0207690_116796312 | 98 |
| 219 | 3300025933 | Ga0207706_10119870 | Ga0207706_101198702 | 98 |
| 220 | 3300025933 | Ga0207706_10324411 | Ga0207706_103244113 | 98 |
| 221 | 3300025934 | Ga0207686_10876712 | Ga0207686_108767122 | 98 |
| 222 | 3300025935 | Ga0207709_10542891 | Ga0207709_105428912 | 98 |
| 223 | 3300025935 | Ga0207709_11712121 | Ga0207709_117121212 | 98 |
| 224 | 3300025935 | Ga0207709_11754390 | Ga0207709_117543902 | 98 |
| 225 | 3300025936 | Ga0207670_10855915 | Ga0207670_108559152 | 98 |
| 226 | 3300025937 | Ga0207669_11290697 | Ga0207669_112906971 | 98 |
| 227 | 3300025938 | Ga0207704_10495780 | Ga0207704_104957801 | 98 |
| 228 | 3300025940 | Ga0207691_10237856 | Ga0207691_102378562 | 98 |
| 229 | 3300025941 | Ga0207711_10145924 | Ga0207711_101459243 | 98 |
| 230 | 3300025942 | Ga0207689_10516844 | Ga0207689_105168442 | 98 |
| 231 | 3300025942 | Ga0207689_11190719 | Ga0207689_111907191 | 98 |
| 232 | 3300025944 | Ga0207661_10019392 | Ga0207661_100193923 | 98 |
| 233 | 3300025944 | Ga0207661_10554137 | Ga0207661_105541372 | 98 |
| 234 | 3300025944 | Ga0207661_10660439 | Ga0207661_106604391 | 98 |
| 235 | 3300025944 | Ga0207661_10722245 | Ga0207661_107222453 | 98 |
| 236 | 3300025944 | Ga0207661_11607857 | Ga0207661_116078572 | 98 |
| 237 | 3300025944 | Ga0207661_11799654 | Ga0207661_117996541 | 98 |
| 238 | 3300025945 | Ga0207679_10369039 | Ga0207679_103690392 | 98 |
| 239 | 3300025945 | Ga0207679_10663420 | Ga0207679_106634201 | 98 |
| 240 | 3300025960 | Ga0207651_10975064 | Ga0207651_109750642 | 98 |
| 241 | 3300025961 | Ga0207712_11698883 | Ga0207712_116988831 | 98 |
| 242 | 3300025981 | Ga0207640_10435636 | Ga0207640_104356361 | 98 |
| 243 | 3300025981 | Ga0207640_11546686 | Ga0207640_115466862 | 98 |
| 244 | 3300026023 | Ga0207677_10286049 | Ga0207677_102860493 | 98 |
| 245 | 3300026023 | Ga0207677_10370282 | Ga0207677_103702822 | 98 |
| 246 | 3300026023 | Ga0207677_11826292 | Ga0207677_118262921 | 98 |
| 247 | 3300026067 | Ga0207678_10156817 | Ga0207678_101568172 | 98 |
| 248 | 3300026075 | Ga0207708_10005757 | Ga0207708_100057579 | 98 |
| 249 | 3300026075 | Ga0207708_10213861 | Ga0207708_102138613 | 98 |
| 250 | 3300026075 | Ga0207708_10445448 | Ga0207708_104454482 | 98 |
| 251 | 3300026075 | Ga0207708_10897565 | Ga0207708_108975652 | 98 |
| 252 | 3300026075 | Ga0207708_10912785 | Ga0207708_109127852 | 98 |
| 253 | 3300026078 | Ga0207702_12418239 | Ga0207702_124182391 | 98 |
| 254 | 3300026089 | Ga0207648_10182808 | Ga0207648_101828082 | 98 |
| 255 | 3300026089 | Ga0207648_11166538 | Ga0207648_111665382 | 98 |
| 256 | 3300026089 | Ga0207648_11860674 | Ga0207648_118606741 | 98 |
| 257 | 3300026095 | Ga0207676_10560236 | Ga0207676_105602363 | 98 |
| 258 | 3300026095 | Ga0207676_11066075 | Ga0207676_110660751 | 98 |
| 259 | 3300026095 | Ga0207676_11714988 | Ga0207676_117149882 | 98 |
| 260 | 3300026118 | Ga0207675_100386734 | Ga0207675_1003867343 | 98 |
| 261 | 3300026121 | Ga0207683_10434706 | Ga0207683_104347061 | 98 |
| 262 | 3300026121 | Ga0207683_10796438 | Ga0207683_107964382 | 98 |
| 263 | 3300026121 | Ga0207683_11510442 | Ga0207683_115104421 | 98 |
| 264 | 3300026142 | Ga0207698_10234862 | Ga0207698_102348622 | 98 |
| 265 | 3300026142 | Ga0207698_10494096 | Ga0207698_104940962 | 98 |
| 266 | 3300026142 | Ga0207698_10522015 | Ga0207698_105220151 | 98 |
| 267 | 3300027907 | Ga0207428_10064979 | Ga0207428_100649792 | 98 |
| 268 | 3300027907 | Ga0207428_10189504 | Ga0207428_101895043 | 98 |
| 269 | 3300027907 | Ga0207428_10740445 | Ga0207428_107404451 | 98 |
| 270 | 3300028381 | Ga0268264_11031957 | Ga0268264_110319572 | 98 |
| 271 | 3300028381 | Ga0268264_12109318 | Ga0268264_121093182 | 98 |
| 272 | 3300031548 | Ga0307408_100089992 | Ga0307408_1000899923 | 98 |
| 273 | 3300031548 | Ga0307408_100131681 | Ga0307408_1001316812 | 98 |
| 274 | 3300031548 | Ga0307408_101529833 | Ga0307408_1015298332 | 98 |
| 275 | 3300031548 | Ga0307408_101738237 | Ga0307408_1017382372 | 98 |
| 276 | 3300031731 | Ga0307405_10660239 | Ga0307405_106602391 | 98 |
| 277 | 3300031731 | Ga0307405_11048876 | Ga0307405_110488761 | 98 |
| 278 | 3300031824 | Ga0307413_10488078 | Ga0307413_104880782 | 98 |
| 279 | 3300031824 | Ga0307413_10492876 | Ga0307413_104928762 | 98 |
| 280 | 3300031824 | Ga0307413_10704161 | Ga0307413_107041612 | 98 |
| 281 | 3300031824 | Ga0307413_10774212 | Ga0307413_107742122 | 98 |
| 282 | 3300031824 | Ga0307413_10856736 | Ga0307413_108567362 | 98 |
| 283 | 3300031852 | Ga0307410_10155440 | Ga0307410_101554403 | 98 |
| 284 | 3300031852 | Ga0307410_10240776 | Ga0307410_102407762 | 98 |
| 285 | 3300031852 | Ga0307410_10384592 | Ga0307410_103845922 | 98 |
| 286 | 3300031852 | Ga0307410_11178694 | Ga0307410_111786942 | 98 |
| 287 | 3300031852 | Ga0307410_11788476 | Ga0307410_117884761 | 98 |
| 288 | 3300031852 | Ga0307410_11811216 | Ga0307410_118112162 | 98 |
| 289 | 3300031852 | Ga0307410_12009546 | Ga0307410_120095462 | 98 |
| 290 | 3300031901 | Ga0307406_10119231 | Ga0307406_101192312 | 98 |
| 291 | 3300031901 | Ga0307406_11100383 | Ga0307406_111003831 | 98 |
| 292 | 3300031901 | Ga0307406_11898455 | Ga0307406_118984552 | 98 |
| 293 | 3300031901 | Ga0307406_12095974 | Ga0307406_120959742 | 98 |
| 294 | 3300031903 | Ga0307407_11116148 | Ga0307407_111161481 | 98 |
| 295 | 3300031911 | Ga0307412_10056363 | Ga0307412_100563634 | 98 |
| 296 | 3300031911 | Ga0307412_10593706 | Ga0307412_105937062 | 98 |
| 297 | 3300031911 | Ga0307412_11244505 | Ga0307412_112445052 | 98 |
| 298 | 3300031995 | Ga0307409_100155714 | Ga0307409_1001557142 | 98 |
| 299 | 3300031995 | Ga0307409_100259550 | Ga0307409_1002595503 | 98 |
| 300 | 3300031995 | Ga0307409_100311608 | Ga0307409_1003116082 | 98 |
| 301 | 3300031995 | Ga0307409_100366075 | Ga0307409_1003660752 | 98 |
| 302 | 3300031995 | Ga0307409_100409667 | Ga0307409_1004096672 | 98 |
| 303 | 3300031995 | Ga0307409_100660141 | Ga0307409_1006601412 | 98 |
| 304 | 3300032002 | Ga0307416_100273520 | Ga0307416_1002735203 | 98 |
| 305 | 3300032002 | Ga0307416_100311152 | Ga0307416_1003111524 | 98 |
| 306 | 3300032002 | Ga0307416_100331773 | Ga0307416_1003317732 | 98 |
| 307 | 3300032002 | Ga0307416_101450641 | Ga0307416_1014506412 | 98 |
| 308 | 3300032002 | Ga0307416_102162223 | Ga0307416_1021622231 | 98 |
| 309 | 3300032004 | Ga0307414_10793510 | Ga0307414_107935102 | 98 |
| 310 | 3300032004 | Ga0307414_10926595 | Ga0307414_109265951 | 98 |
| 311 | 3300032005 | Ga0307411_10746876 | Ga0307411_107468762 | 98 |
| 312 | 3300032005 | Ga0307411_11159828 | Ga0307411_111598282 | 98 |
| 313 | 3300032126 | Ga0307415_100005507 | Ga0307415_1000055074 | 98 |
| 314 | 3300032126 | Ga0307415_100236456 | Ga0307415_1002364562 | 98 |
| 315 | 3300032126 | Ga0307415_100238314 | Ga0307415_1002383143 | 98 |
| 316 | 3300032126 | Ga0307415_100445266 | Ga0307415_1004452662 | 98 |
| 317 | 3300032126 | Ga0307415_100783990 | Ga0307415_1007839902 | 98 |
| 318 | 3300032126 | Ga0307415_101459164 | Ga0307415_1014591641 | 98 |
| 319 | 3300032126 | Ga0307415_101585870 | Ga0307415_1015858701 | 98 |
| 320 | 3300032126 | Ga0307415_102046326 | Ga0307415_1020463262 | 98 |
| 321 | 3300035121 | Ga0373960_0190451 | Ga0373960_0190451_55_357 | 98 |
| 322 | 3300035691 | Ga0373931_0532602 | Ga0373931_0532602_203_505 | 98 |
| 323 | 3300035725 | Ga0373947_0151885 | Ga0373947_0151885_754_1059 | 98 |
| 324 | 3300037312 | Ga0395899_0256195 | Ga0395899_0256195_433_729 | 98 |
| 325 | 3300037418 | Ga0395900_0421278 | Ga0395900_0421278_503_805 | 98 |
| 326 | 3300037418 | Ga0395900_0492620 | Ga0395900_0492620_289_591 | 98 |
| 327 | 3300037418 | Ga0395900_1299081 | Ga0395900_1299081_333_629 | 98 |
| 328 | 3300037418 | Ga0395900_1667910 | Ga0395900_1667910_185_487 | 98 |
| 329 | 3300037466 | Ga0395898_0558228 | Ga0395898_0558228_103_405 | 98 |
| 330 | 3300037466 | Ga0395898_1799683 | Ga0395898_1799683_76_378 | 98 |
| 331 | 3300037471 | Ga0395905_0301576 | Ga0395905_0301576_1050_1352 | 98 |
| 332 | 3300037471 | Ga0395905_0458368 | Ga0395905_0458368_116_418 | 98 |
| 333 | 3300038443 | Ga0395901_0650830 | Ga0395901_0650830_688_990 | 98 |
| 334 | 3300038443 | Ga0395901_1056933 | Ga0395901_1056933_216_518 | 98 |
| 335 | 3300041441 | Ga0451787_323018 | Ga0451787_323018_165_467 | 98 |
| 336 | 3300041443 | Ga0451789_1082744 | Ga0451789_1082744_389_685 | 98 |
| 337 | 3300041443 | Ga0451789_1158005 | Ga0451789_1158005_16_330 | 98 |
| 338 | 3300041451 | Ga0451791_1407336 | Ga0451791_1407336_313_615 | 98 |
| 339 | 3300041452 | Ga0451793_1630748 | Ga0451793_1630748_202_498 | 98 |
| 340 | 3300041453 | Ga0451797_1079570 | Ga0451797_1079570_246_548 | 98 |
| 341 | 3300041456 | Ga0451795_0597290 | Ga0451795_0597290_245_541 | 98 |
| 342 | 3300041456 | Ga0451795_0683988 | Ga0451795_0683988_506_802 | 98 |
| 343 | 3300041459 | Ga0451800_0192531 | Ga0451800_0192531_319_615 | 98 |
| 344 | 3300041459 | Ga0451800_0294588 | Ga0451800_0294588_68_493 | 98 |
| 345 | 3300041463 | Ga0451804_0797679 | Ga0451804_0797679_283_585 | 98 |
| 346 | 3300041486 | Ga0451807_1967488 | Ga0451807_1967488_95_391 | 98 |
| 347 | 3300041491 | Ga0451833_1428254 | Ga0451833_1428254_85_381 | 98 |
| 348 | 3300041503 | Ga0451847_0314040 | Ga0451847_0314040_239_544 | 98 |
| 349 | 3300041509 | Ga0451843_0136082 | Ga0451843_0136082_492_794 | 98 |
| 350 | 3300042005 | Ga0439448_0177693 | Ga0439448_0177693_255_557 | 98 |
| 351 | 3300042008 | Ga0439450_102253 | Ga0439450_102253_342_644 | 98 |
| 352 | 3300042126 | Ga0450888_019593 | Ga0450888_019593_387_689 | 98 |
| 353 | 3300042437 | Ga0439444_0092503 | Ga0439444_0092503_204_506 | 98 |
| 354 | 3300042438 | Ga0439459_0123402 | Ga0439459_0123402_124_426 | 98 |
| 355 | 3300042439 | Ga0439464_0193869 | Ga0439464_0193869_182_484 | 98 |
| 356 | 3300042439 | Ga0439464_0285829 | Ga0439464_0285829_97_393 | 98 |
| 357 | 3300044658 | Ga0466972_0305581 | Ga0466972_0305581_426_722 | 98 |
| 358 | 3300044658 | Ga0466972_0613129 | Ga0466972_0613129_85_390 | 98 |
| 359 | 3300044683 | Ga0466965_0286716 | Ga0466965_0286716_15_317 | 98 |
| 360 | 3300044683 | Ga0466965_0288620 | Ga0466965_0288620_414_710 | 98 |
| 361 | 3300044683 | Ga0466965_0500261 | Ga0466965_0500261_274_570 | 98 |
| 362 | 3300044683 | Ga0466965_0519218 | Ga0466965_0519218_197_493 | 98 |
| 363 | 3300044693 | Ga0466961_0418749 | Ga0466961_0418749_283_579 | 98 |
| 364 | 3300044694 | Ga0466963_0017791 | Ga0466963_0017791_3434_3730 | 98 |
| 365 | 3300044694 | Ga0466963_0070694 | Ga0466963_0070694_649_945 | 98 |
| 366 | 3300044694 | Ga0466963_0281990 | Ga0466963_0281990_138_443 | 98 |
| 367 | 3300044694 | Ga0466963_0574795 | Ga0466963_0574795_176_472 | 98 |
| 368 | 3300044706 | Ga0466964_0212425 | Ga0466964_0212425_146_442 | 98 |
| 369 | 3300044706 | Ga0466964_0365269 | Ga0466964_0365269_37_333 | 98 |
| 370 | 3300044719 | Ga0466971_0073776 | Ga0466971_0073776_903_1205 | 98 |
| 371 | 3300044719 | Ga0466971_0092959 | Ga0466971_0092959_957_1253 | 98 |
| 372 | 3300044842 | Ga0466957_0090422 | Ga0466957_0090422_350_646 | 98 |
| 373 | 3300044842 | Ga0466957_0365781 | Ga0466957_0365781_471_767 | 98 |
| 374 | 3300044842 | Ga0466957_0715777 | Ga0466957_0715777_294_590 | 98 |
| 375 | 3300044842 | Ga0466957_0864262 | Ga0466957_0864262_139_435 | 98 |
| 376 | 3300044842 | Ga0466957_1012944 | Ga0466957_1012944_224_529 | 98 |
| 377 | 3300044901 | Ga0466960_0027385 | Ga0466960_0027385_827_1123 | 98 |
| 378 | 3300044901 | Ga0466960_0199677 | Ga0466960_0199677_120_416 | 98 |
| 379 | 3300044901 | Ga0466960_0270615 | Ga0466960_0270615_628_924 | 98 |
| 380 | 3300044901 | Ga0466960_0509568 | Ga0466960_0509568_222_518 | 98 |
| 381 | 3300045836 | Ga0466958_0459711 | Ga0466958_0459711_311_607 | 98 |
| 382 | 3300045976 | Ga0466967_0015338 | Ga0466967_0015338_4601_4897 | 98 |
| 383 | 3300045976 | Ga0466967_0035695 | Ga0466967_0035695_2899_3195 | 98 |
| 384 | 3300045976 | Ga0466967_0044190 | Ga0466967_0044190_114_410 | 98 |
| 385 | 3300045976 | Ga0466967_0067025 | Ga0466967_0067025_988_1284 | 98 |
| 386 | 3300045976 | Ga0466967_0123510 | Ga0466967_0123510_1873_2169 | 98 |
| 387 | 3300045976 | Ga0466967_0125747 | Ga0466967_0125747_443_739 | 98 |
| 388 | 3300045976 | Ga0466967_0152209 | Ga0466967_0152209_1277_1573 | 98 |
| 389 | 3300045976 | Ga0466967_0178197 | Ga0466967_0178197_666_962 | 98 |
| 390 | 3300045976 | Ga0466967_0225720 | Ga0466967_0225720_617_913 | 98 |
| 391 | 3300045976 | Ga0466967_0332484 | Ga0466967_0332484_1150_1446 | 98 |
| 392 | 3300045976 | Ga0466967_0536400 | Ga0466967_0536400_82_378 | 98 |
| 393 | 3300045976 | Ga0466967_0580628 | Ga0466967_0580628_222_527 | 98 |
| 394 | 3300045976 | Ga0466967_0874352 | Ga0466967_0874352_433_729 | 98 |
| 395 | 3300045976 | Ga0466967_0949841 | Ga0466967_0949841_481_777 | 98 |
| 396 | 3300045976 | Ga0466967_1031703 | Ga0466967_1031703_50_346 | 98 |
| 397 | 3300045976 | Ga0466967_1094199 | Ga0466967_1094199_481_777 | 98 |
| 398 | 3300045976 | Ga0466967_1459042 | Ga0466967_1459042_314_610 | 98 |
| 399 | 3300046459 | Ga0495629_1015956 | Ga0495629_1015956_227_529 | 98 |
| 400 | 3300046460 | Ga0495638_0492627 | Ga0495638_0492627_209_523 | 98 |
| 401 | 3300046477 | Ga0495664_0190226 | Ga0495664_0190226_211_513 | 98 |
| 402 | 3300046477 | Ga0495664_0483766 | Ga0495664_0483766_116_412 | 98 |
| 403 | 3300046491 | Ga0495584_0493716 | Ga0495584_0493716_167_469 | 98 |
| 404 | 3300046500 | Ga0495596_0054736 | Ga0495596_0054736_727_1023 | 98 |
| 405 | 3300046500 | Ga0495596_0261474 | Ga0495596_0261474_17_313 | 98 |
| 406 | 3300046514 | Ga0495618_0475359 | Ga0495618_0475359_298_600 | 98 |
| 407 | 3300046515 | Ga0495620_0222617 | Ga0495620_0222617_231_533 | 98 |
| 408 | 3300046523 | Ga0495644_0040291 | Ga0495644_0040291_568_870 | 98 |
| 409 | 3300046523 | Ga0495644_0190413 | Ga0495644_0190413_174_476 | 98 |
| 410 | 3300046523 | Ga0495644_0313624 | Ga0495644_0313624_197_499 | 98 |
| 411 | 3300046525 | Ga0495663_0070414 | Ga0495663_0070414_382_684 | 98 |
| 412 | 3300046525 | Ga0495663_0321424 | Ga0495663_0321424_159_455 | 98 |
| 413 | 3300046525 | Ga0495663_0387447 | Ga0495663_0387447_34_330 | 98 |
| 414 | 3300046529 | Ga0495652_0516793 | Ga0495652_0516793_204_506 | 98 |
| 415 | 3300046535 | Ga0495586_0420656 | Ga0495586_0420656_299_601 | 98 |
| 416 | 3300046538 | Ga0495609_0198630 | Ga0495609_0198630_491_793 | 98 |
| 417 | 3300046559 | Ga0495667_0291207 | Ga0495667_0291207_238_540 | 98 |
| 418 | 3300046615 | Ga0495656_0246822 | Ga0495656_0246822_258_560 | 98 |
| 419 | 3300046615 | Ga0495656_0428681 | Ga0495656_0428681_262_558 | 98 |
| 420 | 3300046648 | Ga0495611_0405155 | Ga0495611_0405155_196_498 | 98 |
| 421 | 3300046665 | Ga0495661_0599909 | Ga0495661_0599909_178_480 | 98 |
| 422 | 3300046683 | Ga0495658_1099620 | Ga0495658_1099620_88_390 | 98 |
| 423 | 3300046689 | Ga0495613_1059135 | Ga0495613_1059135_61_363 | 98 |
| 424 | 3300046794 | Ga0495589_0455344 | Ga0495589_0455344_152_454 | 98 |
| 425 | 3300047317 | Ga0495604_0948881 | Ga0495604_0948881_36_338 | 98 |
| 426 | 3300047322 | Ga0495680_0306092 | Ga0495680_0306092_188_490 | 98 |
| 427 | 3300048904 | Ga0496101_1120558 | Ga0496101_1120558_51_356 | 98 |
| 428 | 3300048905 | Ga0496102_0194993 | Ga0496102_0194993_292_597 | 98 |
| 429 | 3300048905 | Ga0496102_1156394 | Ga0496102_1156394_316_618 | 98 |
| 430 | 3300048905 | Ga0496102_1386986 | Ga0496102_1386986_135_431 | 98 |
| 431 | 3300048906 | Ga0496103_0883193 | Ga0496103_0883193_56_352 | 98 |
| 432 | 3300048912 | Ga0496109_1011052 | Ga0496109_1011052_40_336 | 98 |
| 433 | 3300048913 | Ga0496110_0081063 | Ga0496110_0081063_2576_2872 | 98 |
| 434 | 3300048913 | Ga0496110_0140211 | Ga0496110_0140211_1537_1833 | 98 |
| 435 | 3300048913 | Ga0496110_0780777 | Ga0496110_0780777_150_446 | 98 |
| 436 | 3300048914 | Ga0496111_0269833 | Ga0496111_0269833_444_740 | 98 |
| 437 | 3300048915 | Ga0496112_0019897 | Ga0496112_0019897_3908_4204 | 98 |
| 438 | 3300048915 | Ga0496112_0628569 | Ga0496112_0628569_363_659 | 98 |
| 439 | 3300048916 | Ga0496113_0238226 | Ga0496113_0238226_234_530 | 98 |
| 440 | 3300048917 | Ga0496114_0234232 | Ga0496114_0234232_1113_1409 | 98 |
| 441 | 3300048920 | Ga0496117_0305738 | Ga0496117_0305738_282_578 | 98 |
| 442 | 3300048924 | Ga0496121_0001852 | Ga0496121_0001852_24308_24604 | 98 |
| 443 | 3300048924 | Ga0496121_0159888 | Ga0496121_0159888_1179_1475 | 98 |
| 444 | 3300048926 | Ga0496123_0270192 | Ga0496123_0270192_427_723 | 98 |
| 445 | 3300048929 | Ga0496126_0454244 | Ga0496126_0454244_718_1014 | 98 |
| 446 | 3300049514 | Ga0501291_080724 | Ga0501291_080724_141_443 | 98 |
| 447 | 3300049568 | Ga0501031_0006574 | Ga0501031_0006574_1771_2067 | 98 |
| 448 | 3300049568 | Ga0501031_0116167 | Ga0501031_0116167_1172_1474 | 98 |
| 449 | 3300049568 | Ga0501031_0360305 | Ga0501031_0360305_616_912 | 98 |
| 450 | 3300049569 | Ga0501032_0004579 | Ga0501032_0004579_3431_3727 | 98 |
| 451 | 3300049570 | Ga0501033_0040455 | Ga0501033_0040455_2765_3061 | 98 |
| 452 | 3300049571 | Ga0501034_0609513 | Ga0501034_0609513_265_561 | 98 |
| 453 | 3300049571 | Ga0501034_0678880 | Ga0501034_0678880_454_756 | 98 |
| 454 | 3300049572 | Ga0501036_0007948 | Ga0501036_0007948_5974_6270 | 98 |
| 455 | 3300049572 | Ga0501036_0527475 | Ga0501036_0527475_486_782 | 98 |
| 456 | 3300049573 | Ga0501037_0031528 | Ga0501037_0031528_308_604 | 98 |
| 457 | 3300049574 | Ga0501038_0023733 | Ga0501038_0023733_3505_3801 | 98 |
| 458 | 3300049574 | Ga0501038_0080995 | Ga0501038_0080995_155_457 | 98 |
| 459 | 3300049575 | Ga0501039_0014446 | Ga0501039_0014446_1546_1842 | 98 |
| 460 | 3300049575 | Ga0501039_0096452 | Ga0501039_0096452_150_446 | 98 |
| 461 | 3300049575 | Ga0501039_0148573 | Ga0501039_0148573_743_1045 | 98 |
| 462 | 3300049576 | Ga0501040_0138989 | Ga0501040_0138989_347_649 | 98 |
| 463 | 3300049576 | Ga0501040_1348335 | Ga0501040_1348335_38_334 | 98 |
| 464 | 3300049577 | Ga0501041_0888280 | Ga0501041_0888280_55_351 | 98 |
| 465 | 3300049577 | Ga0501041_0893918 | Ga0501041_0893918_55_357 | 98 |
| 466 | 3300049578 | Ga0501042_0008431 | Ga0501042_0008431_6320_6616 | 98 |
| 467 | 3300049578 | Ga0501042_0066927 | Ga0501042_0066927_156_458 | 98 |
| 468 | 3300049578 | Ga0501042_0482086 | Ga0501042_0482086_366_662 | 98 |
| 469 | 3300049578 | Ga0501042_1431987 | Ga0501042_1431987_159_455 | 98 |
| 470 | 3300049579 | Ga0501043_0029483 | Ga0501043_0029483_3437_3733 | 98 |
| 471 | 3300049580 | Ga0501046_0004826 | Ga0501046_0004826_8349_8645 | 98 |
| 472 | 3300049580 | Ga0501046_0419561 | Ga0501046_0419561_332_628 | 98 |
| 473 | 3300049581 | Ga0501047_0068981 | Ga0501047_0068981_1474_1770 | 98 |
| 474 | 3300049582 | Ga0501048_0045758 | Ga0501048_0045758_1358_1660 | 98 |
| 475 | 3300049582 | Ga0501048_0051780 | Ga0501048_0051780_1937_2233 | 98 |
| 476 | 3300049582 | Ga0501048_0360572 | Ga0501048_0360572_404_700 | 98 |
| 477 | 3300049582 | Ga0501048_1128209 | Ga0501048_1128209_80_382 | 98 |
| 478 | 3300049583 | Ga0501067_0009483 | Ga0501067_0009483_294_590 | 98 |
| 479 | 3300049583 | Ga0501067_0774289 | Ga0501067_0774289_48_350 | 98 |
| 480 | 3300049584 | Ga0501068_0292112 | Ga0501068_0292112_308_604 | 98 |
| 481 | 3300049585 | Ga0501069_0155231 | Ga0501069_0155231_636_932 | 98 |
| 482 | 3300049585 | Ga0501069_0172902 | Ga0501069_0172902_686_988 | 98 |
| 483 | 3300049585 | Ga0501069_0552142 | Ga0501069_0552142_42_344 | 98 |
| 484 | 3300049586 | Ga0501070_0023847 | Ga0501070_0023847_2636_2932 | 98 |
| 485 | 3300049586 | Ga0501070_0169118 | Ga0501070_0169118_867_1163 | 98 |
| 486 | 3300049586 | Ga0501070_1277338 | Ga0501070_1277338_60_362 | 98 |
| 487 | 3300049588 | Ga0501072_0023897 | Ga0501072_0023897_4187_4483 | 98 |
| 488 | 3300049588 | Ga0501072_0202904 | Ga0501072_0202904_1153_1455 | 98 |
| 489 | 3300049588 | Ga0501072_0540157 | Ga0501072_0540157_586_882 | 98 |
| 490 | 3300049589 | Ga0501073_0017616 | Ga0501073_0017616_2703_2999 | 98 |
| 491 | 3300049589 | Ga0501073_0965249 | Ga0501073_0965249_196_495 | 98 |
| 492 | 3300049590 | Ga0501074_0611682 | Ga0501074_0611682_46_342 | 98 |
| 493 | 3300049590 | Ga0501074_1034400 | Ga0501074_1034400_76_378 | 98 |
| 494 | 3300049591 | Ga0501075_0022229 | Ga0501075_0022229_2155_2457 | 98 |
| 495 | 3300049591 | Ga0501075_0139403 | Ga0501075_0139403_1350_1646 | 98 |
| 496 | 3300049592 | Ga0501076_0042705 | Ga0501076_0042705_153_455 | 98 |
| 497 | 3300049592 | Ga0501076_0475613 | Ga0501076_0475613_464_760 | 98 |
| 498 | 3300049656 | Ga0501209_263459 | Ga0501209_263459_11_307 | 98 |
| 499 | 3300049741 | Ga0501079_0106256 | Ga0501079_0106256_252_554 | 98 |
| 500 | 3300049741 | Ga0501079_0186378 | Ga0501079_0186378_1094_1390 | 98 |
| 501 | 3300049741 | Ga0501079_0524354 | Ga0501079_0524354_217_513 | 98 |
| 502 | 3300049742 | Ga0501080_0043279 | Ga0501080_0043279_3642_3938 | 98 |
| 503 | 3300049742 | Ga0501080_0951691 | Ga0501080_0951691_410_712 | 98 |
| 504 | 3300049743 | Ga0501081_0323958 | Ga0501081_0323958_767_1063 | 98 |
| 505 | 3300049744 | Ga0501083_0011905 | Ga0501083_0011905_3839_4135 | 98 |
| 506 | 3300049822 | Ga0501035_0124763 | Ga0501035_0124763_1422_1718 | 98 |
| 507 | 3300049823 | Ga0501044_0368404 | Ga0501044_0368404_793_1089 | 98 |
| 508 | 3300049824 | Ga0501045_0045939 | Ga0501045_0045939_278_574 | 98 |
| 509 | 3300049824 | Ga0501045_0080039 | Ga0501045_0080039_1948_2244 | 98 |
| 510 | 3300049824 | Ga0501045_0547389 | Ga0501045_0547389_524_826 | 98 |
| 511 | 3300049824 | Ga0501045_0993405 | Ga0501045_0993405_64_360 | 98 |
| 512 | 3300050507 | nmdc:mga05p37_1053182_c1 | nmdc:mga05p37_1053182_c1_107_403 | 98 |
| 513 | 3300050507 | nmdc:mga05p37_1852931_c1 | nmdc:mga05p37_1852931_c1_109_411 | 98 |
| 514 | 3300050507 | nmdc:mga05p37_215907_c1 | nmdc:mga05p37_215907_c1_1079_1381 | 98 |
| 515 | 3300050507 | nmdc:mga05p37_256299_c1 | nmdc:mga05p37_256299_c1_1655_1957 | 98 |
| 516 | 3300050507 | nmdc:mga05p37_419620_c1 | nmdc:mga05p37_419620_c1_432_731 | 98 |
| 517 | 3300050507 | nmdc:mga05p37_898326_c1 | nmdc:mga05p37_898326_c1_607_903 | 98 |
| 518 | 3300050508 | nmdc:mga09592_1125443_c1 | nmdc:mga09592_1125443_c1_125_427 | 98 |
| 519 | 3300050508 | nmdc:mga09592_855489_c1 | nmdc:mga09592_855489_c1_27_329 | 98 |
| 520 | 3300050508 | nmdc:mga09592_953084_c1 | nmdc:mga09592_953084_c1_56_352 | 98 |
| 521 | 3300050509 | nmdc:mga0qj67_1278624_c1 | nmdc:mga0qj67_1278624_c1_55_354 | 98 |
| 522 | 3300050509 | nmdc:mga0qj67_144203_c1 | nmdc:mga0qj67_144203_c1_373_675 | 98 |
| 523 | 3300050509 | nmdc:mga0qj67_368992_c1 | nmdc:mga0qj67_368992_c1_614_916 | 98 |
| 524 | 3300050509 | nmdc:mga0qj67_382527_c1 | nmdc:mga0qj67_382527_c1_677_973 | 98 |
| 525 | 3300050510 | nmdc:mga06r32_228166_c1 | nmdc:mga06r32_228166_c1_770_1066 | 98 |
| 526 | 3300050511 | nmdc:mga08y16_1693309_c1 | nmdc:mga08y16_1693309_c1_250_546 | 98 |
| 527 | 3300050511 | nmdc:mga08y16_222939_c1 | nmdc:mga08y16_222939_c1_1529_1831 | 98 |
| 528 | 3300050511 | nmdc:mga08y16_48355_c1 | nmdc:mga08y16_48355_c1_816_1112 | 98 |
| 529 | 3300050511 | nmdc:mga08y16_755028_c1 | nmdc:mga08y16_755028_c1_32_328 | 98 |
| 530 | 3300050511 | nmdc:mga08y16_876595_c1 | nmdc:mga08y16_876595_c1_20_316 | 98 |
| 531 | 3300050511 | nmdc:mga08y16_92959_c1 | nmdc:mga08y16_92959_c1_1021_1323 | 98 |
| 532 | 3300053083 | Ga0495655_0234754 | Ga0495655_0234754_190_486 | 98 |
| 533 | 3300053083 | Ga0495655_0280057 | Ga0495655_0280057_100_396 | 98 |
| 534 | 3300053084 | Ga0495595_0455381 | Ga0495595_0455381_62_364 | 98 |
| 535 | 3300053153 | Ga0500616_0035021 | Ga0500616_0035021_288_584 | 98 |
| 536 | 3300054114 | Ga0501084_0116789 | Ga0501084_0116789_1685_1981 | 98 |
| 537 | 3300059492 | Ga0587073_0231129 | Ga0587073_0231129_96_392 | 98 |
| 538 | 3300060346 | Ga0587111_0236668 | Ga0587111_0236668_107_403 | 98 |
| 539 | 3300060353 | Ga0501082_0032873 | Ga0501082_0032873_3578_3880 | 98 |
| 540 | 3300060353 | Ga0501082_0174053 | Ga0501082_0174053_137_433 | 98 |
| 541 | 3300061719 | Ga0466962_0111310 | Ga0466962_0111310_532_834 | 98 |
| 542 | 3300061734 | Ga0530510_0098203 | Ga0530510_0098203_850_1152 | 98 |
| 543 | 3300061734 | Ga0530510_0317209 | Ga0530510_0317209_154_450 | 98 |
| 544 | 3300061734 | Ga0530510_0475274 | Ga0530510_0475274_573_869 | 98 |
| 545 | 3300061734 | Ga0530510_1273710 | Ga0530510_1273710_55_351 | 98 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lno-assembly1.cif.gz_A | crystal structure of domain of unknown function duf59 from bacillus anthracis | 0.947 | 5 | 97 |
| 3cq2-assembly1.cif.gz_B | structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 | 0.9148 | 1 | 98 |
| 2cu6-assembly1.cif.gz_A | crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 | 0.9087 | 2 | 91 |
| 3lno-assembly1.cif.gz_A | crystal structure of domain of unknown function duf59 from bacillus anthracis | 0.8917 | 5 | 97 |
| 2cu6-assembly1.cif.gz_A | crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 | 0.8902 | 2 | 91 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZT0_1_88_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9742 | 14 | 97 | 3.30.300.130 |
| af_Q0JJS8_71_163_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9245 | 2 | 78 | 3.30.300.130 |
| af_Q2FZT0_1_88_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9207 | 14 | 97 | 3.30.300.130 |
| 3cq2B00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9135 | 1 | 98 | 3.30.300.130 |
| af_O53157_4_110_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.905 | 4 | 98 | 3.30.300.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0H2Z3-F1-model_v4 | Metal-sulfur cluster assembly factor | 1.003 | 1 | 98 |
|
| AF-A0A2H6B7N3-F1-model_v4 | Iron-sulfur cluster carrier protein | 1.002 | 2 | 98 |
|
| AF-A0A6J7EI00-F1-model_v4 | Unannotated protein | 0.9988 | 1 | 98 |
|
| AF-A0A1H6FS06-F1-model_v4 | Metal-sulfur cluster biosynthetic enzyme | 0.9946 | 2 | 98 |
|
| AF-A0A7Y5N2I1-F1-model_v4 | DUF59 domain-containing protein | 0.9939 | 1 | 97 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar