F461872

General Info

Members Datasets Scaffolds Average Seq Length
545 261 545 99

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_11698883|Ga0207712_116988831
Length 99
Sequence MVDEDDVLEALSNVIDPELGLDFVELGLVYGVEIDDGGKVDITFTLTTPACPIGPQVTEQMKEFVSEVEGVQKVLPKMVFSPPWSPERMSEDAKFALGY

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
72 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
73 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
151 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
155 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
156 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
157 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
160 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
161 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
162 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
165 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
166 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
167 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
168 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 4.77
Rhizosphere 92.66
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10002441 3300003373 Bacteria 4373
2 JGI25407J50210_10010090 3300003373 Bacteria 2399
3 JGI25407J50210_10131222 3300003373 Bacteria 617
4 Ga0070658_10451413 3300005327 Bacteria 1108
5 Ga0070658_11486536 3300005327 Unclassified 587
6 Ga0070683_100101991 3300005329 Bacteria 2703
7 Ga0068869_100619115 3300005334 Bacteria 916
8 Ga0070680_100062430 3300005336 Bacteria 3051
9 Ga0070680_101001067 3300005336 Bacteria 722
10 Ga0070682_100577982 3300005337 Bacteria 884
11 Ga0070682_101263597 3300005337 Bacteria 626
12 Ga0068868_100365484 3300005338 Bacteria 1239
13 Ga0070660_100421217 3300005339 Bacteria 1106
14 Ga0070689_101909285 3300005340 Unclassified 542
15 Ga0070661_100224286 3300005344 Bacteria 1442
16 Ga0070661_100846330 3300005344 Bacteria 753
17 Ga0070692_10232754 3300005345 Bacteria 1094
18 Ga0070692_10260833 3300005345 Unclassified 1042
19 Ga0070692_10464253 3300005345 Bacteria 813
20 Ga0070669_100702618 3300005353 Unclassified 854
21 Ga0070659_100618902 3300005366 Bacteria 932
22 Ga0070659_101123901 3300005366 Unclassified 693
23 Ga0070659_101195331 3300005366 Unclassified 672
24 Ga0070659_101565781 3300005366 Unclassified 588
25 Ga0070701_10098613 3300005438 Bacteria 1614
26 Ga0070705_101272593 3300005440 Archaea 609
27 Ga0070700_100109114 3300005441 Bacteria 1837
28 Ga0070700_100413316 3300005441 Bacteria 1018
29 Ga0070700_100788411 3300005441 Unclassified 764
30 Ga0070663_100403568 3300005455 Bacteria 1118
31 Ga0070663_100782934 3300005455 Bacteria 817
32 Ga0070662_100803233 3300005457 Unclassified 800
33 Ga0070681_10134554 3300005458 Bacteria 2403
34 Ga0070681_10851049 3300005458 Bacteria 830
35 Ga0070681_11026151 3300005458 Unclassified 745
36 Ga0070681_12039474 3300005458 Bacteria 502
37 Ga0068867_100293670 3300005459 Bacteria 1337
38 Ga0068867_101599412 3300005459 Bacteria 609
39 Ga0070685_10429564 3300005466 Bacteria 921
40 Ga0070685_10968327 3300005466 Bacteria 637
41 Ga0070706_100461562 3300005467 Bacteria 1182
42 Ga0070706_100994217 3300005467 Unclassified 774
43 Ga0070707_101034071 3300005468 Bacteria 787
44 Ga0070679_100178981 3300005530 Bacteria 2093
45 Ga0070684_100043620 3300005535 Bacteria 3874
46 Ga0070684_100179337 3300005535 Bacteria 1925
47 Ga0070684_101192366 3300005535 Bacteria 716
48 Ga0068853_100587738 3300005539 Bacteria 1057
49 Ga0070672_100798806 3300005543 Bacteria 830
50 Ga0070695_101145834 3300005545 Bacteria 638
51 Ga0070696_100333358 3300005546 Bacteria 1171
52 Ga0070693_100193735 3300005547 Bacteria 1316
53 Ga0070693_100360597 3300005547 Bacteria 997
54 Ga0070704_100844182 3300005549 Bacteria 821
55 Ga0070664_100097258 3300005564 Bacteria 2556
56 Ga0070664_100419322 3300005564 Bacteria 1226
57 Ga0070664_100640204 3300005564 Bacteria 988
58 Ga0068854_100866703 3300005578 Bacteria 792
59 Ga0068854_101059417 3300005578 Bacteria 721
60 Ga0068854_102078569 3300005578 Unclassified 524
61 Ga0068856_101560684 3300005614 Unclassified 674
62 Ga0068856_101599155 3300005614 Bacteria 665
63 Ga0070702_100214753 3300005615 Bacteria 1283
64 Ga0068852_101031107 3300005616 Bacteria 842
65 Ga0068859_100223946 3300005617 Bacteria 1969
66 Ga0068864_100313241 3300005618 Bacteria 1472
67 Ga0068864_100944858 3300005618 Bacteria 853
68 Ga0068866_10332313 3300005718 Bacteria 960
69 Ga0068866_10981821 3300005718 Archaea 599
70 Ga0068861_100401058 3300005719 Bacteria 1217
71 Ga0068861_100641398 3300005719 Bacteria 980
72 Ga0068870_10493497 3300005840 Bacteria 815
73 Ga0068870_11106990 3300005840 Unclassified 570
74 Ga0068858_100858563 3300005842 Bacteria 887
75 Ga0068858_101650168 3300005842 Bacteria 633
76 Ga0068858_102251979 3300005842 Bacteria 539
77 Ga0068860_100904378 3300005843 Bacteria 899
78 Ga0081455_10004507 3300005937 Bacteria 15570
79 Ga0081455_10181093 3300005937 Bacteria 1595
80 Ga0081455_10211013 3300005937 Bacteria 1447
81 Ga0081538_10000398 3300005981 Bacteria 49598
82 Ga0081538_10001873 3300005981 Bacteria 21209
83 Ga0081538_10006655 3300005981 Bacteria 10129
84 Ga0081538_10019419 3300005981 Bacteria 5052
85 Ga0081538_10119320 3300005981 Bacteria 1272
86 Ga0081538_10328557 3300005981 Bacteria 556
87 Ga0081540_1099156 3300005983 Bacteria 1259
88 Ga0081539_10015236 3300005985 Bacteria 5603
89 Ga0075364_10294812 3300006051 Bacteria 1104
90 Ga0075432_10072748 3300006058 Bacteria 1237
91 Ga0075432_10172934 3300006058 Bacteria 841
92 Ga0070712_100000008 3300006175 Bacteria 149644
93 Ga0097621_101624028 3300006237 Bacteria 615
94 Ga0097621_102019968 3300006237 Bacteria 551
95 Ga0075428_100013459 3300006844 Bacteria 9104
96 Ga0075428_100240783 3300006844 Bacteria 1952
97 Ga0075428_100318399 3300006844 Bacteria 1672
98 Ga0075428_102215271 3300006844 Bacteria 567
99 Ga0075431_100223420 3300006847 Bacteria 1921
100 Ga0075431_100677823 3300006847 Bacteria 1010
101 Ga0075433_10075636 3300006852 Bacteria 2963
102 Ga0075429_100389828 3300006880 Bacteria 1220
103 Ga0075429_100449080 3300006880 Unclassified 1130
104 Ga0075429_100842775 3300006880 Bacteria 803
105 Ga0075429_101514283 3300006880 Bacteria 584
106 Ga0068865_100110562 3300006881 Bacteria 2027
107 Ga0068865_100390417 3300006881 Bacteria 1137
108 Ga0068865_100763115 3300006881 Bacteria 832
109 Ga0097620_100223925 3300006931 Bacteria 1969
110 Ga0105244_10169008 3300009036 Bacteria 1041
111 Ga0111539_10004797 3300009094 Bacteria 17637
112 Ga0111539_10011390 3300009094 Bacteria 11165
113 Ga0111539_10243695 3300009094 Unclassified 2093
114 Ga0111539_10557021 3300009094 Bacteria 1335
115 Ga0111539_10922834 3300009094 Bacteria 1015
116 Ga0111539_12060695 3300009094 Bacteria 662
117 Ga0111539_12316123 3300009094 Bacteria 623
118 Ga0105245_10318320 3300009098 Bacteria 1532
119 Ga0105245_10323174 3300009098 Bacteria 1521
120 Ga0105245_10342413 3300009098 Bacteria 1479
121 Ga0105245_10848241 3300009098 Bacteria 953
122 Ga0105245_11427127 3300009098 Bacteria 742
123 Ga0105245_13086045 3300009098 Unclassified 516
124 Ga0105245_13143382 3300009098 Bacteria 512
125 Ga0105245_13280968 3300009098 Bacteria 501
126 Ga0114129_10642668 3300009147 Bacteria 1370
127 Ga0114129_10701091 3300009147 Unclassified 1301
128 Ga0114129_10812074 3300009147 Bacteria 1192
129 Ga0114129_10856573 3300009147 Bacteria 1155
130 Ga0114129_12448064 3300009147 Unclassified 625
131 Ga0114129_13497554 3300009147 Bacteria 502
132 Ga0105243_10315449 3300009148 Bacteria 1422
133 Ga0105243_10426903 3300009148 Bacteria 1238
134 Ga0105243_11029811 3300009148 Bacteria 828
135 Ga0105243_11318740 3300009148 Bacteria 740
136 Ga0105243_12162986 3300009148 Bacteria 593
137 Ga0105243_12458573 3300009148 Bacteria 560
138 Ga0105241_10749323 3300009174 Bacteria 895
139 Ga0105242_10742513 3300009176 Bacteria 965
140 Ga0105242_11022599 3300009176 Bacteria 835
141 Ga0105242_12305732 3300009176 Bacteria 585
142 Ga0105237_10676390 3300009545 Bacteria 1039
143 Ga0105238_10428287 3300009551 Bacteria 1318
144 Ga0105249_10009238 3300009553 Bacteria 8624
145 Ga0105249_11137165 3300009553 Bacteria 851
146 Ga0105249_11225619 3300009553 Bacteria 821
147 Ga0105249_12341909 3300009553 Bacteria 607
148 Ga0099796_10256902 3300010159 Unclassified 727
149 Ga0105239_10224909 3300010375 Bacteria 2105
150 Ga0105239_10225128 3300010375 Bacteria 2104
151 Ga0105239_10771556 3300010375 Bacteria 1101
152 Ga0105239_12269308 3300010375 Unclassified 631
153 Ga0105246_10144257 3300011119 Bacteria 1794
154 Ga0105246_10916375 3300011119 Bacteria 787
155 Ga0105246_12419665 3300011119 Unclassified 515
156 Ga0157322_1027413 3300012490 Bacteria 588
157 Ga0157324_1053699 3300012506 Bacteria 532
158 Ga0157324_1059522 3300012506 Bacteria 519
159 Ga0157342_1011857 3300012507 Unclassified 911
160 Ga0157369_10252067 3300013105 Bacteria 1842
161 Ga0157374_12074564 3300013296 Bacteria 595
162 Ga0157378_10828908 3300013297 Bacteria 952
163 Ga0157378_12867965 3300013297 Unclassified 534
164 Ga0163162_10188173 3300013306 Bacteria 2192
165 Ga0163162_11672593 3300013306 Bacteria 727
166 Ga0163162_12859560 3300013306 Unclassified 556
167 Ga0157372_10510051 3300013307 Bacteria 1402
168 Ga0157372_10555291 3300013307 Bacteria 1339
169 Ga0157372_10574372 3300013307 Unclassified 1314
170 Ga0157372_11252820 3300013307 Bacteria 856
171 Ga0157375_10604807 3300013308 Bacteria 1255
172 Ga0157375_10981788 3300013308 Bacteria 985
173 Ga0157375_11491671 3300013308 Bacteria 798
174 Ga0163163_10381694 3300014325 Bacteria 1467
175 Ga0163163_11646039 3300014325 Bacteria 703
176 Ga0163163_12152006 3300014325 Bacteria 617
177 Ga0157380_10436467 3300014326 Bacteria 1253
178 Ga0157380_10822063 3300014326 Bacteria 948
179 Ga0157380_11256629 3300014326 Bacteria 786
180 Ga0182008_10906796 3300014497 Unclassified 519
181 Ga0157377_10247436 3300014745 Bacteria 1154
182 Ga0157377_11443606 3300014745 Bacteria 544
183 Ga0157377_11498394 3300014745 Bacteria 536
184 Ga0157379_10228934 3300014968 Bacteria 1685
185 Ga0157379_10667586 3300014968 Bacteria 974
186 Ga0157376_10855826 3300014969 Bacteria 925
187 Ga0206355_1007951 3300020076 Bacteria 511
188 Ga0206353_10646032 3300020082 Bacteria 564
189 Ga0154015_1370048 3300020610 Bacteria 545
190 Ga0213876_10300243 3300021384 Bacteria 854
191 Ga0207426_1006751 3300025302 Bacteria 4918
192 Ga0207426_1115271 3300025302 Bacteria 671
193 Ga0207643_10078414 3300025908 Bacteria 1911
194 Ga0207643_10284558 3300025908 Bacteria 1026
195 Ga0207643_10288326 3300025908 Bacteria 1019
196 Ga0207705_10971064 3300025909 Bacteria 657
197 Ga0207684_11369004 3300025910 Bacteria 580
198 Ga0207707_10598496 3300025912 Bacteria 933
199 Ga0207707_10864486 3300025912 Bacteria 750
200 Ga0207671_10908176 3300025914 Bacteria 696
201 Ga0207693_10000002 3300025915 Bacteria 304011
202 Ga0207660_10944250 3300025917 Bacteria 704
203 Ga0207660_11383802 3300025917 Bacteria 570
204 Ga0207657_10314924 3300025919 Bacteria 1238
205 Ga0207649_11062037 3300025920 Bacteria 638
206 Ga0207652_10619879 3300025921 Bacteria 969
207 Ga0207646_11533332 3300025922 Bacteria 576
208 Ga0207687_10791141 3300025927 Bacteria 809
209 Ga0207687_11953875 3300025927 Bacteria 501
210 Ga0207644_10973845 3300025931 Bacteria 712
211 Ga0207690_10327774 3300025932 Bacteria 1205
212 Ga0207690_10438586 3300025932 Bacteria 1048
213 Ga0207690_11278688 3300025932 Unclassified 613
214 Ga0207690_11679631 3300025932 Unclassified 531
215 Ga0207706_10119870 3300025933 Bacteria 2313
216 Ga0207706_10324411 3300025933 Bacteria 1340
217 Ga0207686_10876712 3300025934 Bacteria 723
218 Ga0207709_10542891 3300025935 Bacteria 913
219 Ga0207709_11712121 3300025935 Unclassified 523
220 Ga0207709_11754390 3300025935 Bacteria 516
221 Ga0207670_10855915 3300025936 Bacteria 760
222 Ga0207669_11290697 3300025937 Bacteria 620
223 Ga0207704_10495780 3300025938 Bacteria 983
224 Ga0207691_10237856 3300025940 Bacteria 1575
225 Ga0207711_10145924 3300025941 Bacteria 2132
226 Ga0207689_10516844 3300025942 Bacteria 1001
227 Ga0207689_11190719 3300025942 Bacteria 641
228 Ga0207661_10019392 3300025944 Bacteria 5070
229 Ga0207661_10554137 3300025944 Bacteria 1053
230 Ga0207661_10660439 3300025944 Bacteria 961
231 Ga0207661_10722245 3300025944 Bacteria 917
232 Ga0207661_11607857 3300025944 Unclassified 595
233 Ga0207661_11799654 3300025944 Bacteria 558
234 Ga0207679_10369039 3300025945 Bacteria 1256
235 Ga0207679_10663420 3300025945 Bacteria 944
236 Ga0207651_10975064 3300025960 Bacteria 757
237 Ga0207712_11698883 3300025961 Unclassified 566
238 Ga0207640_10435636 3300025981 Bacteria 1076
239 Ga0207640_11546686 3300025981 Bacteria 597
240 Ga0207677_10286049 3300026023 Bacteria 1355
241 Ga0207677_10370282 3300026023 Bacteria 1206
242 Ga0207677_11826292 3300026023 Unclassified 564
243 Ga0207678_10156817 3300026067 Bacteria 1944
244 Ga0207708_10005757 3300026075 Bacteria 9158
245 Ga0207708_10213861 3300026075 Bacteria 1542
246 Ga0207708_10445448 3300026075 Bacteria 1078
247 Ga0207708_10897565 3300026075 Unclassified 767
248 Ga0207708_10912785 3300026075 Bacteria 760
249 Ga0207702_12418239 3300026078 Bacteria 512
250 Ga0207648_10182808 3300026089 Bacteria 1856
251 Ga0207648_11166538 3300026089 Bacteria 723
252 Ga0207648_11860674 3300026089 Archaea 563
253 Ga0207676_10560236 3300026095 Unclassified 1093
254 Ga0207676_11066075 3300026095 Bacteria 798
255 Ga0207676_11714988 3300026095 Bacteria 626
256 Ga0207675_100386734 3300026118 Bacteria 1377
257 Ga0207683_10434706 3300026121 Bacteria 1209
258 Ga0207683_10796438 3300026121 Bacteria 877
259 Ga0207683_11510442 3300026121 Bacteria 620
260 Ga0207698_10234862 3300026142 Bacteria 1667
261 Ga0207698_10494096 3300026142 Bacteria 1190
262 Ga0207698_10522015 3300026142 Bacteria 1159
263 Ga0207428_10064979 3300027907 Bacteria 2880
264 Ga0207428_10189504 3300027907 Unclassified 1551
265 Ga0207428_10740445 3300027907 Bacteria 701
266 Ga0268264_11031957 3300028381 Bacteria 829
267 Ga0268264_12109318 3300028381 Bacteria 572
268 Ga0307408_100089992 3300031548 Bacteria 2315
269 Ga0307408_100131681 3300031548 Bacteria 1952
270 Ga0307408_101529833 3300031548 Unclassified 632
271 Ga0307408_101738237 3300031548 Bacteria 595
272 Ga0307405_10660239 3300031731 Bacteria 861
273 Ga0307405_11048876 3300031731 Bacteria 698
274 Ga0307413_10488078 3300031824 Bacteria 986
275 Ga0307413_10492876 3300031824 Bacteria 982
276 Ga0307413_10704161 3300031824 Bacteria 839
277 Ga0307413_10774212 3300031824 Bacteria 804
278 Ga0307413_10856736 3300031824 Bacteria 768
279 Ga0307410_10155440 3300031852 Bacteria 1708
280 Ga0307410_10240776 3300031852 Bacteria 1402
281 Ga0307410_10384592 3300031852 Bacteria 1130
282 Ga0307410_11178694 3300031852 Bacteria 667
283 Ga0307410_11788476 3300031852 Bacteria 546
284 Ga0307410_11811216 3300031852 Bacteria 542
285 Ga0307410_12009546 3300031852 Bacteria 516
286 Ga0307406_10119231 3300031901 Bacteria 1831
287 Ga0307406_11100383 3300031901 Bacteria 686
288 Ga0307406_11898455 3300031901 Unclassified 531
289 Ga0307406_12095974 3300031901 Bacteria 507
290 Ga0307407_11116148 3300031903 Bacteria 613
291 Ga0307412_10056363 3300031911 Bacteria 2619
292 Ga0307412_10593706 3300031911 Bacteria 937
293 Ga0307412_11244505 3300031911 Bacteria 668
294 Ga0307409_100155714 3300031995 Bacteria 1991
295 Ga0307409_100259550 3300031995 Bacteria 1594
296 Ga0307409_100311608 3300031995 Bacteria 1469
297 Ga0307409_100366075 3300031995 Bacteria 1365
298 Ga0307409_100409667 3300031995 Bacteria 1297
299 Ga0307409_100660141 3300031995 Bacteria 1041
300 Ga0307416_100273520 3300032002 Bacteria 1660
301 Ga0307416_100311152 3300032002 Bacteria 1572
302 Ga0307416_100331773 3300032002 Bacteria 1529
303 Ga0307416_101450641 3300032002 Bacteria 792
304 Ga0307416_102162223 3300032002 Bacteria 658
305 Ga0307414_10793510 3300032004 Bacteria 863
306 Ga0307414_10926595 3300032004 Bacteria 800
307 Ga0307411_10746876 3300032005 Bacteria 857
308 Ga0307411_11159828 3300032005 Bacteria 699
309 Ga0307415_100005507 3300032126 Bacteria 6729
310 Ga0307415_100236456 3300032126 Bacteria 1475
311 Ga0307415_100238314 3300032126 Unclassified 1470
312 Ga0307415_100445266 3300032126 Bacteria 1118
313 Ga0307415_100783990 3300032126 Bacteria 868
314 Ga0307415_101459164 3300032126 Bacteria 653
315 Ga0307415_101585870 3300032126 Bacteria 628
316 Ga0307415_102046326 3300032126 Bacteria 558
317 Ga0373960_0190451 3300035121 Unclassified 720
318 Ga0373931_0532602 3300035691 Unclassified 761
319 Ga0373947_0151885 3300035725 Bacteria 1492
320 Ga0395899_0256195 3300037312 Bacteria 1199
321 Ga0395900_0421278 3300037418 Unclassified 1296
322 Ga0395900_0492620 3300037418 Unclassified 1177
323 Ga0395900_1299081 3300037418 Unclassified 642
324 Ga0395900_1667910 3300037418 Bacteria 548
325 Ga0395898_0558228 3300037466 Bacteria 1087
326 Ga0395898_1799683 3300037466 Bacteria 534
327 Ga0395905_0301576 3300037471 Bacteria 1490
328 Ga0395905_0458368 3300037471 Unclassified 1173
329 Ga0395901_0313264 3300038443 Bacteria 1625
330 Ga0395901_0650830 3300038443 Bacteria 1057
331 Ga0395901_1056933 3300038443 Bacteria 784
332 Ga0451787_323018 3300041441 Bacteria 592
333 Ga0451789_1082744 3300041443 Bacteria 725
334 Ga0451789_1158005 3300041443 Unclassified 538
335 Ga0451791_1407336 3300041451 Bacteria 765
336 Ga0451793_1630748 3300041452 Unclassified 561
337 Ga0451797_1079570 3300041453 Bacteria 1432
338 Ga0451795_0597290 3300041456 Unclassified 687
339 Ga0451795_0683988 3300041456 Bacteria 901
340 Ga0451800_0192531 3300041459 Unclassified 816
341 Ga0451800_0294588 3300041459 Bacteria 734
342 Ga0451804_0797679 3300041463 Bacteria 790
343 Ga0451807_1967488 3300041486 Bacteria 537
344 Ga0451833_1428254 3300041491 Bacteria 515
345 Ga0451845_0767674 3300041501 Bacteria 607
346 Ga0451847_0314040 3300041503 Bacteria 912
347 Ga0451843_0136082 3300041509 Unclassified 914
348 Ga0439448_0177693 3300042005 Bacteria 743
349 Ga0439450_102253 3300042008 Bacteria 728
350 Ga0450888_019593 3300042126 Bacteria 854
351 Ga0439444_0092503 3300042437 Bacteria 676
352 Ga0439459_0123402 3300042438 Bacteria 655
353 Ga0439464_0193869 3300042439 Bacteria 646
354 Ga0439464_0285829 3300042439 Bacteria 537
355 Ga0466972_0305581 3300044658 Bacteria 743
356 Ga0466972_0613129 3300044658 Bacteria 515
357 Ga0466965_0286716 3300044683 Bacteria 890
358 Ga0466965_0288620 3300044683 Bacteria 888
359 Ga0466965_0500261 3300044683 Bacteria 681
360 Ga0466965_0519218 3300044683 Bacteria 670
361 Ga0466961_0418749 3300044693 Bacteria 812
362 Ga0466963_0017791 3300044694 Bacteria 4434
363 Ga0466963_0070694 3300044694 Bacteria 2348
364 Ga0466963_0281990 3300044694 Bacteria 1168
365 Ga0466963_0574795 3300044694 Unclassified 796
366 Ga0466964_0212425 3300044706 Bacteria 935
367 Ga0466964_0365269 3300044706 Unclassified 745
368 Ga0466971_0073776 3300044719 Bacteria 1551
369 Ga0466971_0092959 3300044719 Bacteria 1382
370 Ga0466957_0090422 3300044842 Bacteria 1917
371 Ga0466957_0365781 3300044842 Bacteria 981
372 Ga0466957_0715777 3300044842 Bacteria 707
373 Ga0466957_0864262 3300044842 Bacteria 645
374 Ga0466957_1012944 3300044842 Bacteria 597
375 Ga0466960_0027385 3300044901 Bacteria 2599
376 Ga0466960_0199677 3300044901 Bacteria 1092
377 Ga0466960_0270615 3300044901 Bacteria 949
378 Ga0466960_0509568 3300044901 Bacteria 706
379 Ga0466958_0459711 3300045836 Unclassified 824
380 Ga0466967_0015338 3300045976 Bacteria 6001
381 Ga0466967_0035695 3300045976 Bacteria 4235
382 Ga0466967_0044190 3300045976 Bacteria 3862
383 Ga0466967_0067025 3300045976 Bacteria 3201
384 Ga0466967_0123510 3300045976 Bacteria 2395
385 Ga0466967_0125747 3300045976 Bacteria 2375
386 Ga0466967_0152209 3300045976 Bacteria 2163
387 Ga0466967_0178197 3300045976 Bacteria 2003
388 Ga0466967_0225720 3300045976 Bacteria 1782
389 Ga0466967_0332484 3300045976 Bacteria 1467
390 Ga0466967_0536400 3300045976 Bacteria 1151
391 Ga0466967_0580628 3300045976 Bacteria 1105
392 Ga0466967_0874352 3300045976 Unclassified 893
393 Ga0466967_0949841 3300045976 Bacteria 855
394 Ga0466967_1031703 3300045976 Bacteria 819
395 Ga0466967_1094199 3300045976 Bacteria 794
396 Ga0466967_1459042 3300045976 Bacteria 681
397 Ga0495629_1015956 3300046459 Bacteria 539
398 Ga0495638_0492627 3300046460 Bacteria 619
399 Ga0495582_0259934 3300046473 Bacteria 996
400 Ga0495664_0190226 3300046477 Bacteria 1244
401 Ga0495664_0483766 3300046477 Bacteria 740
402 Ga0495584_0493716 3300046491 Bacteria 623
403 Ga0495596_0054736 3300046500 Bacteria 1560
404 Ga0495596_0261474 3300046500 Unclassified 672
405 Ga0495618_0475359 3300046514 Bacteria 756
406 Ga0495620_0222617 3300046515 Bacteria 722
407 Ga0495644_0040291 3300046523 Unclassified 1761
408 Ga0495644_0190413 3300046523 Unclassified 790
409 Ga0495644_0313624 3300046523 Bacteria 615
410 Ga0495663_0070414 3300046525 Unclassified 1113
411 Ga0495663_0321424 3300046525 Bacteria 560
412 Ga0495663_0387447 3300046525 Bacteria 513
413 Ga0495652_0516793 3300046529 Bacteria 826
414 Ga0495586_0420656 3300046535 Bacteria 769
415 Ga0495587_0838132 3300046536 Bacteria 501
416 Ga0495609_0198630 3300046538 Bacteria 839
417 Ga0495667_0291207 3300046559 Bacteria 1035
418 Ga0495656_0246822 3300046615 Bacteria 901
419 Ga0495656_0428681 3300046615 Bacteria 695
420 Ga0495611_0405155 3300046648 Bacteria 623
421 Ga0495661_0599909 3300046665 Bacteria 518
422 Ga0495658_1099620 3300046683 Bacteria 507
423 Ga0495613_1059135 3300046689 Bacteria 519
424 Ga0495589_0455344 3300046794 Bacteria 585
425 Ga0495604_0948881 3300047317 Bacteria 535
426 Ga0495680_0306092 3300047322 Bacteria 1115
427 Ga0496101_1120558 3300048904 Unclassified 618
428 Ga0496102_0194993 3300048905 Bacteria 1909
429 Ga0496102_1156394 3300048905 Bacteria 693
430 Ga0496102_1386986 3300048905 Bacteria 622
431 Ga0496103_0883193 3300048906 Unclassified 561
432 Ga0496109_1011052 3300048912 Bacteria 769
433 Ga0496110_0081063 3300048913 Bacteria 2893
434 Ga0496110_0140211 3300048913 Bacteria 2186
435 Ga0496110_0780777 3300048913 Bacteria 859
436 Ga0496111_0269833 3300048914 Bacteria 1262
437 Ga0496112_0019897 3300048915 Bacteria 6352
438 Ga0496112_0628569 3300048915 Bacteria 1004
439 Ga0496113_0238226 3300048916 Bacteria 1452
440 Ga0496114_0234232 3300048917 Unclassified 1614
441 Ga0496117_0305738 3300048920 Bacteria 840
442 Ga0496121_0001852 3300048924 Bacteria 34009
443 Ga0496121_0159888 3300048924 Bacteria 1649
444 Ga0496123_0270192 3300048926 Bacteria 828
445 Ga0496126_0454244 3300048929 Bacteria 1031
446 Ga0501291_080724 3300049514 Bacteria 647
447 Ga0501031_0006574 3300049568 Bacteria 7585
448 Ga0501031_0116167 3300049568 Bacteria 1748
449 Ga0501031_0360305 3300049568 Unclassified 941
450 Ga0501032_0004579 3300049569 Bacteria 10405
451 Ga0501033_0040455 3300049570 Bacteria 3479
452 Ga0501034_0609513 3300049571 Bacteria 996
453 Ga0501034_0678880 3300049571 Bacteria 930
454 Ga0501036_0007948 3300049572 Bacteria 8680
455 Ga0501036_0527475 3300049572 Unclassified 982
456 Ga0501037_0031528 3300049573 Bacteria 3913
457 Ga0501038_0023733 3300049574 Bacteria 5480
458 Ga0501038_0080995 3300049574 Bacteria 2736
459 Ga0501039_0014446 3300049575 Bacteria 6046
460 Ga0501039_0096452 3300049575 Bacteria 2305
461 Ga0501039_0148573 3300049575 Bacteria 1842
462 Ga0501040_0138989 3300049576 Bacteria 1710
463 Ga0501040_1348335 3300049576 Unclassified 518
464 Ga0501041_0888280 3300049577 Unclassified 572
465 Ga0501041_0893918 3300049577 Bacteria 570
466 Ga0501042_0008431 3300049578 Bacteria 6805
467 Ga0501042_0066927 3300049578 Bacteria 2568
468 Ga0501042_0482086 3300049578 Unclassified 900
469 Ga0501042_1431987 3300049578 Unclassified 504
470 Ga0501043_0029483 3300049579 Bacteria 4311
471 Ga0501046_0004826 3300049580 Bacteria 12153
472 Ga0501046_0419561 3300049580 Bacteria 965
473 Ga0501047_0068981 3300049581 Bacteria 3405
474 Ga0501048_0045758 3300049582 Bacteria 3125
475 Ga0501048_0051780 3300049582 Bacteria 2921
476 Ga0501048_0360572 3300049582 Bacteria 1037
477 Ga0501048_1128209 3300049582 Unclassified 564
478 Ga0501067_0009483 3300049583 Bacteria 5392
479 Ga0501067_0774289 3300049583 Bacteria 540
480 Ga0501068_0292112 3300049584 Bacteria 1042
481 Ga0501069_0155231 3300049585 Bacteria 1316
482 Ga0501069_0172902 3300049585 Bacteria 1247
483 Ga0501069_0552142 3300049585 Bacteria 689
484 Ga0501070_0023847 3300049586 Bacteria 5127
485 Ga0501070_0169118 3300049586 Bacteria 1801
486 Ga0501070_1277338 3300049586 Bacteria 561
487 Ga0501072_0023897 3300049588 Bacteria 4750
488 Ga0501072_0202904 3300049588 Bacteria 1581
489 Ga0501072_0540157 3300049588 Unclassified 921
490 Ga0501073_0017616 3300049589 Bacteria 5172
491 Ga0501073_0965249 3300049589 Bacteria 587
492 Ga0501074_0611682 3300049590 Bacteria 770
493 Ga0501074_1034400 3300049590 Bacteria 577
494 Ga0501075_0022229 3300049591 Bacteria 4631
495 Ga0501075_0139403 3300049591 Bacteria 1848
496 Ga0501076_0042705 3300049592 Bacteria 3570
497 Ga0501076_0475613 3300049592 Unclassified 1029
498 Ga0501209_263459 3300049656 Bacteria 540
499 Ga0501079_0106256 3300049741 Bacteria 2178
500 Ga0501079_0186378 3300049741 Bacteria 1620
501 Ga0501079_0524354 3300049741 Unclassified 931
502 Ga0501080_0043279 3300049742 Bacteria 4193
503 Ga0501080_0951691 3300049742 Bacteria 747
504 Ga0501081_0323958 3300049743 Bacteria 1133
505 Ga0501083_0011905 3300049744 Bacteria 6095
506 Ga0501035_0124763 3300049822 Bacteria 2248
507 Ga0501044_0368404 3300049823 Bacteria 1353
508 Ga0501045_0045939 3300049824 Bacteria 3180
509 Ga0501045_0080039 3300049824 Bacteria 2409
510 Ga0501045_0547389 3300049824 Bacteria 858
511 Ga0501045_0993405 3300049824 Bacteria 615
512 nmdc:mga05p37_1053182_c1 3300050507 Bacteria 858
513 nmdc:mga05p37_1852931_c1 3300050507 Unclassified 579
514 nmdc:mga05p37_215907_c1 3300050507 Bacteria 2317
515 nmdc:mga05p37_256299_c1 3300050507 Bacteria 2096
516 nmdc:mga05p37_419620_c1 3300050507 Bacteria 1557
517 nmdc:mga05p37_898326_c1 3300050507 Bacteria 955
518 nmdc:mga09592_1125443_c1 3300050508 Unclassified 652
519 nmdc:mga09592_855489_c1 3300050508 Bacteria 767
520 nmdc:mga09592_953084_c1 3300050508 Bacteria 719
521 nmdc:mga0qj67_1278624_c1 3300050509 Bacteria 569
522 nmdc:mga0qj67_144203_c1 3300050509 Bacteria 1931
523 nmdc:mga0qj67_368992_c1 3300050509 Unclassified 1159
524 nmdc:mga0qj67_382527_c1 3300050509 Bacteria 1136
525 nmdc:mga06r32_228166_c1 3300050510 Bacteria 1850
526 nmdc:mga08y16_1693309_c1 3300050511 Bacteria 588
527 nmdc:mga08y16_222939_c1 3300050511 Unclassified 1951
528 nmdc:mga08y16_48355_c1 3300050511 Bacteria 4452
529 nmdc:mga08y16_755028_c1 3300050511 Bacteria 968
530 nmdc:mga08y16_876595_c1 3300050511 Bacteria 885
531 nmdc:mga08y16_92959_c1 3300050511 Bacteria 3143
532 Ga0495655_0234754 3300053083 Unclassified 612
533 Ga0495655_0280057 3300053083 Bacteria 568
534 Ga0495595_0455381 3300053084 Bacteria 650
535 Ga0500616_0035021 3300053153 Bacteria 2731
536 Ga0501084_0116789 3300054114 Bacteria 2243
537 Ga0587073_0231129 3300059492 Bacteria 570
538 Ga0587111_0236668 3300060346 Bacteria 534
539 Ga0501082_0032873 3300060353 Bacteria 4474
540 Ga0501082_0174053 3300060353 Bacteria 1871
541 Ga0466962_0111310 3300061719 Bacteria 1318
542 Ga0530510_0098203 3300061734 Bacteria 2141
543 Ga0530510_0317209 3300061734 Bacteria 1168
544 Ga0530510_0475274 3300061734 Unclassified 946
545 Ga0530510_1273710 3300061734 Bacteria 564

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005985 Ga0081539_10015236 Ga0081539_100152364 96
2 3300009176 Ga0105242_12305732 Ga0105242_123057322 96
3 3300041501 Ga0451845_0767674 Ga0451845_0767674_152_448 96
4 3300046473 Ga0495582_0259934 Ga0495582_0259934_317_613 96
5 3300046536 Ga0495587_0838132 Ga0495587_0838132_150_446 96
6 3300038443 Ga0395901_0313264 Ga0395901_0313264_116_418 97
7 3300003373 JGI25407J50210_10002441 JGI25407J50210_100024414 98
8 3300003373 JGI25407J50210_10010090 JGI25407J50210_100100902 98
9 3300003373 JGI25407J50210_10131222 JGI25407J50210_101312221 98
10 3300005327 Ga0070658_10451413 Ga0070658_104514132 98
11 3300005327 Ga0070658_11486536 Ga0070658_114865361 98
12 3300005329 Ga0070683_100101991 Ga0070683_1001019912 98
13 3300005334 Ga0068869_100619115 Ga0068869_1006191152 98
14 3300005336 Ga0070680_100062430 Ga0070680_1000624302 98
15 3300005336 Ga0070680_101001067 Ga0070680_1010010672 98
16 3300005337 Ga0070682_100577982 Ga0070682_1005779822 98
17 3300005337 Ga0070682_101263597 Ga0070682_1012635971 98
18 3300005338 Ga0068868_100365484 Ga0068868_1003654842 98
19 3300005339 Ga0070660_100421217 Ga0070660_1004212172 98
20 3300005340 Ga0070689_101909285 Ga0070689_1019092852 98
21 3300005344 Ga0070661_100224286 Ga0070661_1002242864 98
22 3300005344 Ga0070661_100846330 Ga0070661_1008463302 98
23 3300005345 Ga0070692_10232754 Ga0070692_102327543 98
24 3300005345 Ga0070692_10260833 Ga0070692_102608332 98
25 3300005345 Ga0070692_10464253 Ga0070692_104642532 98
26 3300005353 Ga0070669_100702618 Ga0070669_1007026182 98
27 3300005366 Ga0070659_100618902 Ga0070659_1006189022 98
28 3300005366 Ga0070659_101123901 Ga0070659_1011239012 98
29 3300005366 Ga0070659_101195331 Ga0070659_1011953312 98
30 3300005366 Ga0070659_101565781 Ga0070659_1015657811 98
31 3300005438 Ga0070701_10098613 Ga0070701_100986134 98
32 3300005440 Ga0070705_101272593 Ga0070705_1012725932 98
33 3300005441 Ga0070700_100109114 Ga0070700_1001091142 98
34 3300005441 Ga0070700_100413316 Ga0070700_1004133162 98
35 3300005441 Ga0070700_100788411 Ga0070700_1007884112 98
36 3300005455 Ga0070663_100403568 Ga0070663_1004035682 98
37 3300005455 Ga0070663_100782934 Ga0070663_1007829342 98
38 3300005457 Ga0070662_100803233 Ga0070662_1008032332 98
39 3300005458 Ga0070681_10134554 Ga0070681_101345542 98
40 3300005458 Ga0070681_10851049 Ga0070681_108510491 98
41 3300005458 Ga0070681_11026151 Ga0070681_110261512 98
42 3300005458 Ga0070681_12039474 Ga0070681_120394741 98
43 3300005459 Ga0068867_100293670 Ga0068867_1002936702 98
44 3300005459 Ga0068867_101599412 Ga0068867_1015994122 98
45 3300005466 Ga0070685_10429564 Ga0070685_104295641 98
46 3300005466 Ga0070685_10968327 Ga0070685_109683272 98
47 3300005467 Ga0070706_100461562 Ga0070706_1004615622 98
48 3300005467 Ga0070706_100994217 Ga0070706_1009942172 98
49 3300005468 Ga0070707_101034071 Ga0070707_1010340712 98
50 3300005530 Ga0070679_100178981 Ga0070679_1001789812 98
51 3300005535 Ga0070684_100043620 Ga0070684_1000436203 98
52 3300005535 Ga0070684_100179337 Ga0070684_1001793373 98
53 3300005535 Ga0070684_101192366 Ga0070684_1011923661 98
54 3300005539 Ga0068853_100587738 Ga0068853_1005877382 98
55 3300005543 Ga0070672_100798806 Ga0070672_1007988062 98
56 3300005545 Ga0070695_101145834 Ga0070695_1011458341 98
57 3300005546 Ga0070696_100333358 Ga0070696_1003333582 98
58 3300005547 Ga0070693_100193735 Ga0070693_1001937351 98
59 3300005547 Ga0070693_100360597 Ga0070693_1003605972 98
60 3300005549 Ga0070704_100844182 Ga0070704_1008441822 98
61 3300005564 Ga0070664_100097258 Ga0070664_1000972584 98
62 3300005564 Ga0070664_100419322 Ga0070664_1004193222 98
63 3300005564 Ga0070664_100640204 Ga0070664_1006402041 98
64 3300005578 Ga0068854_100866703 Ga0068854_1008667032 98
65 3300005578 Ga0068854_101059417 Ga0068854_1010594172 98
66 3300005578 Ga0068854_102078569 Ga0068854_1020785692 98
67 3300005614 Ga0068856_101560684 Ga0068856_1015606842 98
68 3300005614 Ga0068856_101599155 Ga0068856_1015991552 98
69 3300005615 Ga0070702_100214753 Ga0070702_1002147532 98
70 3300005616 Ga0068852_101031107 Ga0068852_1010311072 98
71 3300005617 Ga0068859_100223946 Ga0068859_1002239465 98
72 3300005618 Ga0068864_100313241 Ga0068864_1003132413 98
73 3300005618 Ga0068864_100944858 Ga0068864_1009448582 98
74 3300005718 Ga0068866_10332313 Ga0068866_103323132 98
75 3300005718 Ga0068866_10981821 Ga0068866_109818212 98
76 3300005719 Ga0068861_100401058 Ga0068861_1004010582 98
77 3300005719 Ga0068861_100641398 Ga0068861_1006413981 98
78 3300005840 Ga0068870_10493497 Ga0068870_104934972 98
79 3300005840 Ga0068870_11106990 Ga0068870_111069902 98
80 3300005842 Ga0068858_100858563 Ga0068858_1008585632 98
81 3300005842 Ga0068858_101650168 Ga0068858_1016501682 98
82 3300005842 Ga0068858_102251979 Ga0068858_1022519792 98
83 3300005843 Ga0068860_100904378 Ga0068860_1009043782 98
84 3300005937 Ga0081455_10004507 Ga0081455_1000450712 98
85 3300005937 Ga0081455_10181093 Ga0081455_101810933 98
86 3300005937 Ga0081455_10211013 Ga0081455_102110133 98
87 3300005981 Ga0081538_10000398 Ga0081538_1000039816 98
88 3300005981 Ga0081538_10001873 Ga0081538_1000187310 98
89 3300005981 Ga0081538_10006655 Ga0081538_100066552 98
90 3300005981 Ga0081538_10019419 Ga0081538_100194196 98
91 3300005981 Ga0081538_10119320 Ga0081538_101193203 98
92 3300005981 Ga0081538_10328557 Ga0081538_103285572 98
93 3300005983 Ga0081540_1099156 Ga0081540_10991564 98
94 3300006051 Ga0075364_10294812 Ga0075364_102948122 98
95 3300006058 Ga0075432_10072748 Ga0075432_100727481 98
96 3300006058 Ga0075432_10172934 Ga0075432_101729342 98
97 3300006175 Ga0070712_100000008 Ga0070712_10000000849 98
98 3300006237 Ga0097621_101624028 Ga0097621_1016240281 98
99 3300006237 Ga0097621_102019968 Ga0097621_1020199682 98
100 3300006844 Ga0075428_100013459 Ga0075428_1000134598 98
101 3300006844 Ga0075428_100240783 Ga0075428_1002407833 98
102 3300006844 Ga0075428_100318399 Ga0075428_1003183992 98
103 3300006844 Ga0075428_102215271 Ga0075428_1022152712 98
104 3300006847 Ga0075431_100223420 Ga0075431_1002234202 98
105 3300006847 Ga0075431_100677823 Ga0075431_1006778231 98
106 3300006852 Ga0075433_10075636 Ga0075433_100756365 98
107 3300006880 Ga0075429_100389828 Ga0075429_1003898282 98
108 3300006880 Ga0075429_100449080 Ga0075429_1004490802 98
109 3300006880 Ga0075429_100842775 Ga0075429_1008427752 98
110 3300006880 Ga0075429_101514283 Ga0075429_1015142832 98
111 3300006881 Ga0068865_100110562 Ga0068865_1001105622 98
112 3300006881 Ga0068865_100390417 Ga0068865_1003904172 98
113 3300006881 Ga0068865_100763115 Ga0068865_1007631152 98
114 3300006931 Ga0097620_100223925 Ga0097620_1002239255 98
115 3300009036 Ga0105244_10169008 Ga0105244_101690082 98
116 3300009094 Ga0111539_10004797 Ga0111539_1000479715 98
117 3300009094 Ga0111539_10011390 Ga0111539_1001139010 98
118 3300009094 Ga0111539_10243695 Ga0111539_102436954 98
119 3300009094 Ga0111539_10557021 Ga0111539_105570213 98
120 3300009094 Ga0111539_10922834 Ga0111539_109228342 98
121 3300009094 Ga0111539_12060695 Ga0111539_120606952 98
122 3300009094 Ga0111539_12316123 Ga0111539_123161232 98
123 3300009098 Ga0105245_10318320 Ga0105245_103183203 98
124 3300009098 Ga0105245_10323174 Ga0105245_103231742 98
125 3300009098 Ga0105245_10342413 Ga0105245_103424134 98
126 3300009098 Ga0105245_10848241 Ga0105245_108482412 98
127 3300009098 Ga0105245_11427127 Ga0105245_114271271 98
128 3300009098 Ga0105245_13086045 Ga0105245_130860452 98
129 3300009098 Ga0105245_13143382 Ga0105245_131433821 98
130 3300009098 Ga0105245_13280968 Ga0105245_132809681 98
131 3300009147 Ga0114129_10642668 Ga0114129_106426682 98
132 3300009147 Ga0114129_10701091 Ga0114129_107010913 98
133 3300009147 Ga0114129_10812074 Ga0114129_108120743 98
134 3300009147 Ga0114129_10856573 Ga0114129_108565732 98
135 3300009147 Ga0114129_12448064 Ga0114129_124480642 98
136 3300009147 Ga0114129_13497554 Ga0114129_134975541 98
137 3300009148 Ga0105243_10315449 Ga0105243_103154492 98
138 3300009148 Ga0105243_10426903 Ga0105243_104269033 98
139 3300009148 Ga0105243_11029811 Ga0105243_110298112 98
140 3300009148 Ga0105243_11318740 Ga0105243_113187401 98
141 3300009148 Ga0105243_12162986 Ga0105243_121629861 98
142 3300009148 Ga0105243_12458573 Ga0105243_124585731 98
143 3300009174 Ga0105241_10749323 Ga0105241_107493233 98
144 3300009176 Ga0105242_10742513 Ga0105242_107425132 98
145 3300009176 Ga0105242_11022599 Ga0105242_110225992 98
146 3300009545 Ga0105237_10676390 Ga0105237_106763902 98
147 3300009551 Ga0105238_10428287 Ga0105238_104282872 98
148 3300009553 Ga0105249_10009238 Ga0105249_100092389 98
149 3300009553 Ga0105249_11137165 Ga0105249_111371652 98
150 3300009553 Ga0105249_11225619 Ga0105249_112256192 98
151 3300009553 Ga0105249_12341909 Ga0105249_123419091 98
152 3300010159 Ga0099796_10256902 Ga0099796_102569021 98
153 3300010375 Ga0105239_10224909 Ga0105239_102249094 98
154 3300010375 Ga0105239_10225128 Ga0105239_102251282 98
155 3300010375 Ga0105239_10771556 Ga0105239_107715563 98
156 3300010375 Ga0105239_12269308 Ga0105239_122693082 98
157 3300011119 Ga0105246_10144257 Ga0105246_101442572 98
158 3300011119 Ga0105246_10916375 Ga0105246_109163752 98
159 3300011119 Ga0105246_12419665 Ga0105246_124196652 98
160 3300012490 Ga0157322_1027413 Ga0157322_10274132 98
161 3300012506 Ga0157324_1053699 Ga0157324_10536991 98
162 3300012506 Ga0157324_1059522 Ga0157324_10595222 98
163 3300012507 Ga0157342_1011857 Ga0157342_10118572 98
164 3300013105 Ga0157369_10252067 Ga0157369_102520673 98
165 3300013296 Ga0157374_12074564 Ga0157374_120745641 98
166 3300013297 Ga0157378_10828908 Ga0157378_108289081 98
167 3300013297 Ga0157378_12867965 Ga0157378_128679651 98
168 3300013306 Ga0163162_10188173 Ga0163162_101881732 98
169 3300013306 Ga0163162_11672593 Ga0163162_116725932 98
170 3300013306 Ga0163162_12859560 Ga0163162_128595602 98
171 3300013307 Ga0157372_10510051 Ga0157372_105100512 98
172 3300013307 Ga0157372_10555291 Ga0157372_105552911 98
173 3300013307 Ga0157372_10574372 Ga0157372_105743722 98
174 3300013307 Ga0157372_11252820 Ga0157372_112528202 98
175 3300013308 Ga0157375_10604807 Ga0157375_106048072 98
176 3300013308 Ga0157375_10981788 Ga0157375_109817882 98
177 3300013308 Ga0157375_11491671 Ga0157375_114916711 98
178 3300014325 Ga0163163_10381694 Ga0163163_103816942 98
179 3300014325 Ga0163163_11646039 Ga0163163_116460391 98
180 3300014325 Ga0163163_12152006 Ga0163163_121520062 98
181 3300014326 Ga0157380_10436467 Ga0157380_104364672 98
182 3300014326 Ga0157380_10822063 Ga0157380_108220633 98
183 3300014326 Ga0157380_11256629 Ga0157380_112566292 98
184 3300014497 Ga0182008_10906796 Ga0182008_109067961 98
185 3300014745 Ga0157377_10247436 Ga0157377_102474362 98
186 3300014745 Ga0157377_11443606 Ga0157377_114436062 98
187 3300014745 Ga0157377_11498394 Ga0157377_114983942 98
188 3300014968 Ga0157379_10228934 Ga0157379_102289343 98
189 3300014968 Ga0157379_10667586 Ga0157379_106675862 98
190 3300014969 Ga0157376_10855826 Ga0157376_108558262 98
191 3300020076 Ga0206355_1007951 Ga0206355_10079512 98
192 3300020082 Ga0206353_10646032 Ga0206353_106460322 98
193 3300020610 Ga0154015_1370048 Ga0154015_13700481 98
194 3300021384 Ga0213876_10300243 Ga0213876_103002432 98
195 3300025302 Ga0207426_1006751 Ga0207426_10067512 98
196 3300025302 Ga0207426_1115271 Ga0207426_11152712 98
197 3300025908 Ga0207643_10078414 Ga0207643_100784144 98
198 3300025908 Ga0207643_10284558 Ga0207643_102845582 98
199 3300025908 Ga0207643_10288326 Ga0207643_102883263 98
200 3300025909 Ga0207705_10971064 Ga0207705_109710642 98
201 3300025910 Ga0207684_11369004 Ga0207684_113690042 98
202 3300025912 Ga0207707_10598496 Ga0207707_105984962 98
203 3300025912 Ga0207707_10864486 Ga0207707_108644861 98
204 3300025914 Ga0207671_10908176 Ga0207671_109081762 98
205 3300025915 Ga0207693_10000002 Ga0207693_10000002292 98
206 3300025917 Ga0207660_10944250 Ga0207660_109442502 98
207 3300025917 Ga0207660_11383802 Ga0207660_113838021 98
208 3300025919 Ga0207657_10314924 Ga0207657_103149241 98
209 3300025920 Ga0207649_11062037 Ga0207649_110620372 98
210 3300025921 Ga0207652_10619879 Ga0207652_106198792 98
211 3300025922 Ga0207646_11533332 Ga0207646_115333322 98
212 3300025927 Ga0207687_10791141 Ga0207687_107911412 98
213 3300025927 Ga0207687_11953875 Ga0207687_119538751 98
214 3300025931 Ga0207644_10973845 Ga0207644_109738452 98
215 3300025932 Ga0207690_10327774 Ga0207690_103277742 98
216 3300025932 Ga0207690_10438586 Ga0207690_104385861 98
217 3300025932 Ga0207690_11278688 Ga0207690_112786882 98
218 3300025932 Ga0207690_11679631 Ga0207690_116796312 98
219 3300025933 Ga0207706_10119870 Ga0207706_101198702 98
220 3300025933 Ga0207706_10324411 Ga0207706_103244113 98
221 3300025934 Ga0207686_10876712 Ga0207686_108767122 98
222 3300025935 Ga0207709_10542891 Ga0207709_105428912 98
223 3300025935 Ga0207709_11712121 Ga0207709_117121212 98
224 3300025935 Ga0207709_11754390 Ga0207709_117543902 98
225 3300025936 Ga0207670_10855915 Ga0207670_108559152 98
226 3300025937 Ga0207669_11290697 Ga0207669_112906971 98
227 3300025938 Ga0207704_10495780 Ga0207704_104957801 98
228 3300025940 Ga0207691_10237856 Ga0207691_102378562 98
229 3300025941 Ga0207711_10145924 Ga0207711_101459243 98
230 3300025942 Ga0207689_10516844 Ga0207689_105168442 98
231 3300025942 Ga0207689_11190719 Ga0207689_111907191 98
232 3300025944 Ga0207661_10019392 Ga0207661_100193923 98
233 3300025944 Ga0207661_10554137 Ga0207661_105541372 98
234 3300025944 Ga0207661_10660439 Ga0207661_106604391 98
235 3300025944 Ga0207661_10722245 Ga0207661_107222453 98
236 3300025944 Ga0207661_11607857 Ga0207661_116078572 98
237 3300025944 Ga0207661_11799654 Ga0207661_117996541 98
238 3300025945 Ga0207679_10369039 Ga0207679_103690392 98
239 3300025945 Ga0207679_10663420 Ga0207679_106634201 98
240 3300025960 Ga0207651_10975064 Ga0207651_109750642 98
241 3300025961 Ga0207712_11698883 Ga0207712_116988831 98
242 3300025981 Ga0207640_10435636 Ga0207640_104356361 98
243 3300025981 Ga0207640_11546686 Ga0207640_115466862 98
244 3300026023 Ga0207677_10286049 Ga0207677_102860493 98
245 3300026023 Ga0207677_10370282 Ga0207677_103702822 98
246 3300026023 Ga0207677_11826292 Ga0207677_118262921 98
247 3300026067 Ga0207678_10156817 Ga0207678_101568172 98
248 3300026075 Ga0207708_10005757 Ga0207708_100057579 98
249 3300026075 Ga0207708_10213861 Ga0207708_102138613 98
250 3300026075 Ga0207708_10445448 Ga0207708_104454482 98
251 3300026075 Ga0207708_10897565 Ga0207708_108975652 98
252 3300026075 Ga0207708_10912785 Ga0207708_109127852 98
253 3300026078 Ga0207702_12418239 Ga0207702_124182391 98
254 3300026089 Ga0207648_10182808 Ga0207648_101828082 98
255 3300026089 Ga0207648_11166538 Ga0207648_111665382 98
256 3300026089 Ga0207648_11860674 Ga0207648_118606741 98
257 3300026095 Ga0207676_10560236 Ga0207676_105602363 98
258 3300026095 Ga0207676_11066075 Ga0207676_110660751 98
259 3300026095 Ga0207676_11714988 Ga0207676_117149882 98
260 3300026118 Ga0207675_100386734 Ga0207675_1003867343 98
261 3300026121 Ga0207683_10434706 Ga0207683_104347061 98
262 3300026121 Ga0207683_10796438 Ga0207683_107964382 98
263 3300026121 Ga0207683_11510442 Ga0207683_115104421 98
264 3300026142 Ga0207698_10234862 Ga0207698_102348622 98
265 3300026142 Ga0207698_10494096 Ga0207698_104940962 98
266 3300026142 Ga0207698_10522015 Ga0207698_105220151 98
267 3300027907 Ga0207428_10064979 Ga0207428_100649792 98
268 3300027907 Ga0207428_10189504 Ga0207428_101895043 98
269 3300027907 Ga0207428_10740445 Ga0207428_107404451 98
270 3300028381 Ga0268264_11031957 Ga0268264_110319572 98
271 3300028381 Ga0268264_12109318 Ga0268264_121093182 98
272 3300031548 Ga0307408_100089992 Ga0307408_1000899923 98
273 3300031548 Ga0307408_100131681 Ga0307408_1001316812 98
274 3300031548 Ga0307408_101529833 Ga0307408_1015298332 98
275 3300031548 Ga0307408_101738237 Ga0307408_1017382372 98
276 3300031731 Ga0307405_10660239 Ga0307405_106602391 98
277 3300031731 Ga0307405_11048876 Ga0307405_110488761 98
278 3300031824 Ga0307413_10488078 Ga0307413_104880782 98
279 3300031824 Ga0307413_10492876 Ga0307413_104928762 98
280 3300031824 Ga0307413_10704161 Ga0307413_107041612 98
281 3300031824 Ga0307413_10774212 Ga0307413_107742122 98
282 3300031824 Ga0307413_10856736 Ga0307413_108567362 98
283 3300031852 Ga0307410_10155440 Ga0307410_101554403 98
284 3300031852 Ga0307410_10240776 Ga0307410_102407762 98
285 3300031852 Ga0307410_10384592 Ga0307410_103845922 98
286 3300031852 Ga0307410_11178694 Ga0307410_111786942 98
287 3300031852 Ga0307410_11788476 Ga0307410_117884761 98
288 3300031852 Ga0307410_11811216 Ga0307410_118112162 98
289 3300031852 Ga0307410_12009546 Ga0307410_120095462 98
290 3300031901 Ga0307406_10119231 Ga0307406_101192312 98
291 3300031901 Ga0307406_11100383 Ga0307406_111003831 98
292 3300031901 Ga0307406_11898455 Ga0307406_118984552 98
293 3300031901 Ga0307406_12095974 Ga0307406_120959742 98
294 3300031903 Ga0307407_11116148 Ga0307407_111161481 98
295 3300031911 Ga0307412_10056363 Ga0307412_100563634 98
296 3300031911 Ga0307412_10593706 Ga0307412_105937062 98
297 3300031911 Ga0307412_11244505 Ga0307412_112445052 98
298 3300031995 Ga0307409_100155714 Ga0307409_1001557142 98
299 3300031995 Ga0307409_100259550 Ga0307409_1002595503 98
300 3300031995 Ga0307409_100311608 Ga0307409_1003116082 98
301 3300031995 Ga0307409_100366075 Ga0307409_1003660752 98
302 3300031995 Ga0307409_100409667 Ga0307409_1004096672 98
303 3300031995 Ga0307409_100660141 Ga0307409_1006601412 98
304 3300032002 Ga0307416_100273520 Ga0307416_1002735203 98
305 3300032002 Ga0307416_100311152 Ga0307416_1003111524 98
306 3300032002 Ga0307416_100331773 Ga0307416_1003317732 98
307 3300032002 Ga0307416_101450641 Ga0307416_1014506412 98
308 3300032002 Ga0307416_102162223 Ga0307416_1021622231 98
309 3300032004 Ga0307414_10793510 Ga0307414_107935102 98
310 3300032004 Ga0307414_10926595 Ga0307414_109265951 98
311 3300032005 Ga0307411_10746876 Ga0307411_107468762 98
312 3300032005 Ga0307411_11159828 Ga0307411_111598282 98
313 3300032126 Ga0307415_100005507 Ga0307415_1000055074 98
314 3300032126 Ga0307415_100236456 Ga0307415_1002364562 98
315 3300032126 Ga0307415_100238314 Ga0307415_1002383143 98
316 3300032126 Ga0307415_100445266 Ga0307415_1004452662 98
317 3300032126 Ga0307415_100783990 Ga0307415_1007839902 98
318 3300032126 Ga0307415_101459164 Ga0307415_1014591641 98
319 3300032126 Ga0307415_101585870 Ga0307415_1015858701 98
320 3300032126 Ga0307415_102046326 Ga0307415_1020463262 98
321 3300035121 Ga0373960_0190451 Ga0373960_0190451_55_357 98
322 3300035691 Ga0373931_0532602 Ga0373931_0532602_203_505 98
323 3300035725 Ga0373947_0151885 Ga0373947_0151885_754_1059 98
324 3300037312 Ga0395899_0256195 Ga0395899_0256195_433_729 98
325 3300037418 Ga0395900_0421278 Ga0395900_0421278_503_805 98
326 3300037418 Ga0395900_0492620 Ga0395900_0492620_289_591 98
327 3300037418 Ga0395900_1299081 Ga0395900_1299081_333_629 98
328 3300037418 Ga0395900_1667910 Ga0395900_1667910_185_487 98
329 3300037466 Ga0395898_0558228 Ga0395898_0558228_103_405 98
330 3300037466 Ga0395898_1799683 Ga0395898_1799683_76_378 98
331 3300037471 Ga0395905_0301576 Ga0395905_0301576_1050_1352 98
332 3300037471 Ga0395905_0458368 Ga0395905_0458368_116_418 98
333 3300038443 Ga0395901_0650830 Ga0395901_0650830_688_990 98
334 3300038443 Ga0395901_1056933 Ga0395901_1056933_216_518 98
335 3300041441 Ga0451787_323018 Ga0451787_323018_165_467 98
336 3300041443 Ga0451789_1082744 Ga0451789_1082744_389_685 98
337 3300041443 Ga0451789_1158005 Ga0451789_1158005_16_330 98
338 3300041451 Ga0451791_1407336 Ga0451791_1407336_313_615 98
339 3300041452 Ga0451793_1630748 Ga0451793_1630748_202_498 98
340 3300041453 Ga0451797_1079570 Ga0451797_1079570_246_548 98
341 3300041456 Ga0451795_0597290 Ga0451795_0597290_245_541 98
342 3300041456 Ga0451795_0683988 Ga0451795_0683988_506_802 98
343 3300041459 Ga0451800_0192531 Ga0451800_0192531_319_615 98
344 3300041459 Ga0451800_0294588 Ga0451800_0294588_68_493 98
345 3300041463 Ga0451804_0797679 Ga0451804_0797679_283_585 98
346 3300041486 Ga0451807_1967488 Ga0451807_1967488_95_391 98
347 3300041491 Ga0451833_1428254 Ga0451833_1428254_85_381 98
348 3300041503 Ga0451847_0314040 Ga0451847_0314040_239_544 98
349 3300041509 Ga0451843_0136082 Ga0451843_0136082_492_794 98
350 3300042005 Ga0439448_0177693 Ga0439448_0177693_255_557 98
351 3300042008 Ga0439450_102253 Ga0439450_102253_342_644 98
352 3300042126 Ga0450888_019593 Ga0450888_019593_387_689 98
353 3300042437 Ga0439444_0092503 Ga0439444_0092503_204_506 98
354 3300042438 Ga0439459_0123402 Ga0439459_0123402_124_426 98
355 3300042439 Ga0439464_0193869 Ga0439464_0193869_182_484 98
356 3300042439 Ga0439464_0285829 Ga0439464_0285829_97_393 98
357 3300044658 Ga0466972_0305581 Ga0466972_0305581_426_722 98
358 3300044658 Ga0466972_0613129 Ga0466972_0613129_85_390 98
359 3300044683 Ga0466965_0286716 Ga0466965_0286716_15_317 98
360 3300044683 Ga0466965_0288620 Ga0466965_0288620_414_710 98
361 3300044683 Ga0466965_0500261 Ga0466965_0500261_274_570 98
362 3300044683 Ga0466965_0519218 Ga0466965_0519218_197_493 98
363 3300044693 Ga0466961_0418749 Ga0466961_0418749_283_579 98
364 3300044694 Ga0466963_0017791 Ga0466963_0017791_3434_3730 98
365 3300044694 Ga0466963_0070694 Ga0466963_0070694_649_945 98
366 3300044694 Ga0466963_0281990 Ga0466963_0281990_138_443 98
367 3300044694 Ga0466963_0574795 Ga0466963_0574795_176_472 98
368 3300044706 Ga0466964_0212425 Ga0466964_0212425_146_442 98
369 3300044706 Ga0466964_0365269 Ga0466964_0365269_37_333 98
370 3300044719 Ga0466971_0073776 Ga0466971_0073776_903_1205 98
371 3300044719 Ga0466971_0092959 Ga0466971_0092959_957_1253 98
372 3300044842 Ga0466957_0090422 Ga0466957_0090422_350_646 98
373 3300044842 Ga0466957_0365781 Ga0466957_0365781_471_767 98
374 3300044842 Ga0466957_0715777 Ga0466957_0715777_294_590 98
375 3300044842 Ga0466957_0864262 Ga0466957_0864262_139_435 98
376 3300044842 Ga0466957_1012944 Ga0466957_1012944_224_529 98
377 3300044901 Ga0466960_0027385 Ga0466960_0027385_827_1123 98
378 3300044901 Ga0466960_0199677 Ga0466960_0199677_120_416 98
379 3300044901 Ga0466960_0270615 Ga0466960_0270615_628_924 98
380 3300044901 Ga0466960_0509568 Ga0466960_0509568_222_518 98
381 3300045836 Ga0466958_0459711 Ga0466958_0459711_311_607 98
382 3300045976 Ga0466967_0015338 Ga0466967_0015338_4601_4897 98
383 3300045976 Ga0466967_0035695 Ga0466967_0035695_2899_3195 98
384 3300045976 Ga0466967_0044190 Ga0466967_0044190_114_410 98
385 3300045976 Ga0466967_0067025 Ga0466967_0067025_988_1284 98
386 3300045976 Ga0466967_0123510 Ga0466967_0123510_1873_2169 98
387 3300045976 Ga0466967_0125747 Ga0466967_0125747_443_739 98
388 3300045976 Ga0466967_0152209 Ga0466967_0152209_1277_1573 98
389 3300045976 Ga0466967_0178197 Ga0466967_0178197_666_962 98
390 3300045976 Ga0466967_0225720 Ga0466967_0225720_617_913 98
391 3300045976 Ga0466967_0332484 Ga0466967_0332484_1150_1446 98
392 3300045976 Ga0466967_0536400 Ga0466967_0536400_82_378 98
393 3300045976 Ga0466967_0580628 Ga0466967_0580628_222_527 98
394 3300045976 Ga0466967_0874352 Ga0466967_0874352_433_729 98
395 3300045976 Ga0466967_0949841 Ga0466967_0949841_481_777 98
396 3300045976 Ga0466967_1031703 Ga0466967_1031703_50_346 98
397 3300045976 Ga0466967_1094199 Ga0466967_1094199_481_777 98
398 3300045976 Ga0466967_1459042 Ga0466967_1459042_314_610 98
399 3300046459 Ga0495629_1015956 Ga0495629_1015956_227_529 98
400 3300046460 Ga0495638_0492627 Ga0495638_0492627_209_523 98
401 3300046477 Ga0495664_0190226 Ga0495664_0190226_211_513 98
402 3300046477 Ga0495664_0483766 Ga0495664_0483766_116_412 98
403 3300046491 Ga0495584_0493716 Ga0495584_0493716_167_469 98
404 3300046500 Ga0495596_0054736 Ga0495596_0054736_727_1023 98
405 3300046500 Ga0495596_0261474 Ga0495596_0261474_17_313 98
406 3300046514 Ga0495618_0475359 Ga0495618_0475359_298_600 98
407 3300046515 Ga0495620_0222617 Ga0495620_0222617_231_533 98
408 3300046523 Ga0495644_0040291 Ga0495644_0040291_568_870 98
409 3300046523 Ga0495644_0190413 Ga0495644_0190413_174_476 98
410 3300046523 Ga0495644_0313624 Ga0495644_0313624_197_499 98
411 3300046525 Ga0495663_0070414 Ga0495663_0070414_382_684 98
412 3300046525 Ga0495663_0321424 Ga0495663_0321424_159_455 98
413 3300046525 Ga0495663_0387447 Ga0495663_0387447_34_330 98
414 3300046529 Ga0495652_0516793 Ga0495652_0516793_204_506 98
415 3300046535 Ga0495586_0420656 Ga0495586_0420656_299_601 98
416 3300046538 Ga0495609_0198630 Ga0495609_0198630_491_793 98
417 3300046559 Ga0495667_0291207 Ga0495667_0291207_238_540 98
418 3300046615 Ga0495656_0246822 Ga0495656_0246822_258_560 98
419 3300046615 Ga0495656_0428681 Ga0495656_0428681_262_558 98
420 3300046648 Ga0495611_0405155 Ga0495611_0405155_196_498 98
421 3300046665 Ga0495661_0599909 Ga0495661_0599909_178_480 98
422 3300046683 Ga0495658_1099620 Ga0495658_1099620_88_390 98
423 3300046689 Ga0495613_1059135 Ga0495613_1059135_61_363 98
424 3300046794 Ga0495589_0455344 Ga0495589_0455344_152_454 98
425 3300047317 Ga0495604_0948881 Ga0495604_0948881_36_338 98
426 3300047322 Ga0495680_0306092 Ga0495680_0306092_188_490 98
427 3300048904 Ga0496101_1120558 Ga0496101_1120558_51_356 98
428 3300048905 Ga0496102_0194993 Ga0496102_0194993_292_597 98
429 3300048905 Ga0496102_1156394 Ga0496102_1156394_316_618 98
430 3300048905 Ga0496102_1386986 Ga0496102_1386986_135_431 98
431 3300048906 Ga0496103_0883193 Ga0496103_0883193_56_352 98
432 3300048912 Ga0496109_1011052 Ga0496109_1011052_40_336 98
433 3300048913 Ga0496110_0081063 Ga0496110_0081063_2576_2872 98
434 3300048913 Ga0496110_0140211 Ga0496110_0140211_1537_1833 98
435 3300048913 Ga0496110_0780777 Ga0496110_0780777_150_446 98
436 3300048914 Ga0496111_0269833 Ga0496111_0269833_444_740 98
437 3300048915 Ga0496112_0019897 Ga0496112_0019897_3908_4204 98
438 3300048915 Ga0496112_0628569 Ga0496112_0628569_363_659 98
439 3300048916 Ga0496113_0238226 Ga0496113_0238226_234_530 98
440 3300048917 Ga0496114_0234232 Ga0496114_0234232_1113_1409 98
441 3300048920 Ga0496117_0305738 Ga0496117_0305738_282_578 98
442 3300048924 Ga0496121_0001852 Ga0496121_0001852_24308_24604 98
443 3300048924 Ga0496121_0159888 Ga0496121_0159888_1179_1475 98
444 3300048926 Ga0496123_0270192 Ga0496123_0270192_427_723 98
445 3300048929 Ga0496126_0454244 Ga0496126_0454244_718_1014 98
446 3300049514 Ga0501291_080724 Ga0501291_080724_141_443 98
447 3300049568 Ga0501031_0006574 Ga0501031_0006574_1771_2067 98
448 3300049568 Ga0501031_0116167 Ga0501031_0116167_1172_1474 98
449 3300049568 Ga0501031_0360305 Ga0501031_0360305_616_912 98
450 3300049569 Ga0501032_0004579 Ga0501032_0004579_3431_3727 98
451 3300049570 Ga0501033_0040455 Ga0501033_0040455_2765_3061 98
452 3300049571 Ga0501034_0609513 Ga0501034_0609513_265_561 98
453 3300049571 Ga0501034_0678880 Ga0501034_0678880_454_756 98
454 3300049572 Ga0501036_0007948 Ga0501036_0007948_5974_6270 98
455 3300049572 Ga0501036_0527475 Ga0501036_0527475_486_782 98
456 3300049573 Ga0501037_0031528 Ga0501037_0031528_308_604 98
457 3300049574 Ga0501038_0023733 Ga0501038_0023733_3505_3801 98
458 3300049574 Ga0501038_0080995 Ga0501038_0080995_155_457 98
459 3300049575 Ga0501039_0014446 Ga0501039_0014446_1546_1842 98
460 3300049575 Ga0501039_0096452 Ga0501039_0096452_150_446 98
461 3300049575 Ga0501039_0148573 Ga0501039_0148573_743_1045 98
462 3300049576 Ga0501040_0138989 Ga0501040_0138989_347_649 98
463 3300049576 Ga0501040_1348335 Ga0501040_1348335_38_334 98
464 3300049577 Ga0501041_0888280 Ga0501041_0888280_55_351 98
465 3300049577 Ga0501041_0893918 Ga0501041_0893918_55_357 98
466 3300049578 Ga0501042_0008431 Ga0501042_0008431_6320_6616 98
467 3300049578 Ga0501042_0066927 Ga0501042_0066927_156_458 98
468 3300049578 Ga0501042_0482086 Ga0501042_0482086_366_662 98
469 3300049578 Ga0501042_1431987 Ga0501042_1431987_159_455 98
470 3300049579 Ga0501043_0029483 Ga0501043_0029483_3437_3733 98
471 3300049580 Ga0501046_0004826 Ga0501046_0004826_8349_8645 98
472 3300049580 Ga0501046_0419561 Ga0501046_0419561_332_628 98
473 3300049581 Ga0501047_0068981 Ga0501047_0068981_1474_1770 98
474 3300049582 Ga0501048_0045758 Ga0501048_0045758_1358_1660 98
475 3300049582 Ga0501048_0051780 Ga0501048_0051780_1937_2233 98
476 3300049582 Ga0501048_0360572 Ga0501048_0360572_404_700 98
477 3300049582 Ga0501048_1128209 Ga0501048_1128209_80_382 98
478 3300049583 Ga0501067_0009483 Ga0501067_0009483_294_590 98
479 3300049583 Ga0501067_0774289 Ga0501067_0774289_48_350 98
480 3300049584 Ga0501068_0292112 Ga0501068_0292112_308_604 98
481 3300049585 Ga0501069_0155231 Ga0501069_0155231_636_932 98
482 3300049585 Ga0501069_0172902 Ga0501069_0172902_686_988 98
483 3300049585 Ga0501069_0552142 Ga0501069_0552142_42_344 98
484 3300049586 Ga0501070_0023847 Ga0501070_0023847_2636_2932 98
485 3300049586 Ga0501070_0169118 Ga0501070_0169118_867_1163 98
486 3300049586 Ga0501070_1277338 Ga0501070_1277338_60_362 98
487 3300049588 Ga0501072_0023897 Ga0501072_0023897_4187_4483 98
488 3300049588 Ga0501072_0202904 Ga0501072_0202904_1153_1455 98
489 3300049588 Ga0501072_0540157 Ga0501072_0540157_586_882 98
490 3300049589 Ga0501073_0017616 Ga0501073_0017616_2703_2999 98
491 3300049589 Ga0501073_0965249 Ga0501073_0965249_196_495 98
492 3300049590 Ga0501074_0611682 Ga0501074_0611682_46_342 98
493 3300049590 Ga0501074_1034400 Ga0501074_1034400_76_378 98
494 3300049591 Ga0501075_0022229 Ga0501075_0022229_2155_2457 98
495 3300049591 Ga0501075_0139403 Ga0501075_0139403_1350_1646 98
496 3300049592 Ga0501076_0042705 Ga0501076_0042705_153_455 98
497 3300049592 Ga0501076_0475613 Ga0501076_0475613_464_760 98
498 3300049656 Ga0501209_263459 Ga0501209_263459_11_307 98
499 3300049741 Ga0501079_0106256 Ga0501079_0106256_252_554 98
500 3300049741 Ga0501079_0186378 Ga0501079_0186378_1094_1390 98
501 3300049741 Ga0501079_0524354 Ga0501079_0524354_217_513 98
502 3300049742 Ga0501080_0043279 Ga0501080_0043279_3642_3938 98
503 3300049742 Ga0501080_0951691 Ga0501080_0951691_410_712 98
504 3300049743 Ga0501081_0323958 Ga0501081_0323958_767_1063 98
505 3300049744 Ga0501083_0011905 Ga0501083_0011905_3839_4135 98
506 3300049822 Ga0501035_0124763 Ga0501035_0124763_1422_1718 98
507 3300049823 Ga0501044_0368404 Ga0501044_0368404_793_1089 98
508 3300049824 Ga0501045_0045939 Ga0501045_0045939_278_574 98
509 3300049824 Ga0501045_0080039 Ga0501045_0080039_1948_2244 98
510 3300049824 Ga0501045_0547389 Ga0501045_0547389_524_826 98
511 3300049824 Ga0501045_0993405 Ga0501045_0993405_64_360 98
512 3300050507 nmdc:mga05p37_1053182_c1 nmdc:mga05p37_1053182_c1_107_403 98
513 3300050507 nmdc:mga05p37_1852931_c1 nmdc:mga05p37_1852931_c1_109_411 98
514 3300050507 nmdc:mga05p37_215907_c1 nmdc:mga05p37_215907_c1_1079_1381 98
515 3300050507 nmdc:mga05p37_256299_c1 nmdc:mga05p37_256299_c1_1655_1957 98
516 3300050507 nmdc:mga05p37_419620_c1 nmdc:mga05p37_419620_c1_432_731 98
517 3300050507 nmdc:mga05p37_898326_c1 nmdc:mga05p37_898326_c1_607_903 98
518 3300050508 nmdc:mga09592_1125443_c1 nmdc:mga09592_1125443_c1_125_427 98
519 3300050508 nmdc:mga09592_855489_c1 nmdc:mga09592_855489_c1_27_329 98
520 3300050508 nmdc:mga09592_953084_c1 nmdc:mga09592_953084_c1_56_352 98
521 3300050509 nmdc:mga0qj67_1278624_c1 nmdc:mga0qj67_1278624_c1_55_354 98
522 3300050509 nmdc:mga0qj67_144203_c1 nmdc:mga0qj67_144203_c1_373_675 98
523 3300050509 nmdc:mga0qj67_368992_c1 nmdc:mga0qj67_368992_c1_614_916 98
524 3300050509 nmdc:mga0qj67_382527_c1 nmdc:mga0qj67_382527_c1_677_973 98
525 3300050510 nmdc:mga06r32_228166_c1 nmdc:mga06r32_228166_c1_770_1066 98
526 3300050511 nmdc:mga08y16_1693309_c1 nmdc:mga08y16_1693309_c1_250_546 98
527 3300050511 nmdc:mga08y16_222939_c1 nmdc:mga08y16_222939_c1_1529_1831 98
528 3300050511 nmdc:mga08y16_48355_c1 nmdc:mga08y16_48355_c1_816_1112 98
529 3300050511 nmdc:mga08y16_755028_c1 nmdc:mga08y16_755028_c1_32_328 98
530 3300050511 nmdc:mga08y16_876595_c1 nmdc:mga08y16_876595_c1_20_316 98
531 3300050511 nmdc:mga08y16_92959_c1 nmdc:mga08y16_92959_c1_1021_1323 98
532 3300053083 Ga0495655_0234754 Ga0495655_0234754_190_486 98
533 3300053083 Ga0495655_0280057 Ga0495655_0280057_100_396 98
534 3300053084 Ga0495595_0455381 Ga0495595_0455381_62_364 98
535 3300053153 Ga0500616_0035021 Ga0500616_0035021_288_584 98
536 3300054114 Ga0501084_0116789 Ga0501084_0116789_1685_1981 98
537 3300059492 Ga0587073_0231129 Ga0587073_0231129_96_392 98
538 3300060346 Ga0587111_0236668 Ga0587111_0236668_107_403 98
539 3300060353 Ga0501082_0032873 Ga0501082_0032873_3578_3880 98
540 3300060353 Ga0501082_0174053 Ga0501082_0174053_137_433 98
541 3300061719 Ga0466962_0111310 Ga0466962_0111310_532_834 98
542 3300061734 Ga0530510_0098203 Ga0530510_0098203_850_1152 98
543 3300061734 Ga0530510_0317209 Ga0530510_0317209_154_450 98
544 3300061734 Ga0530510_0475274 Ga0530510_0475274_573_869 98
545 3300061734 Ga0530510_1273710 Ga0530510_1273710_55_351 98

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

4

75

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.947 5 97
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.9148 1 98
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.9087 2 91
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.8917 5 97
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.8902 2 91
ID Description Score Start End Superfamily
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9742 14 97 3.30.300.130
af_Q0JJS8_71_163_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9245 2 78 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9207 14 97 3.30.300.130
3cq2B00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9135 1 98 3.30.300.130
af_O53157_4_110_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.905 4 98 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A7W0H2Z3-F1-model_v4 Metal-sulfur cluster assembly factor 1.003 1 98
AF-A0A2H6B7N3-F1-model_v4 Iron-sulfur cluster carrier protein 1.002 2 98
AF-A0A6J7EI00-F1-model_v4 Unannotated protein 0.9988 1 98
AF-A0A1H6FS06-F1-model_v4 Metal-sulfur cluster biosynthetic enzyme 0.9946 2 98
AF-A0A7Y5N2I1-F1-model_v4 DUF59 domain-containing protein 0.9939 1 97

Feature Viewer

pLDDT pTM Quality
93.08 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map