F461920

General Info

Members Datasets Scaffolds Average Seq Length
545 250 1090 248

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0359951|Ga0501045_0359951_113_970
Length 285
Sequence MKRFRPSSTASTWARIERSARRADFRQPIAHARIFAMSGHSKWHSIKHKKAAIDAKRGKAFTQIIKEITVAARSGGGDPNFNPRLRLAVDKAKAENMPKDNIERAIKKGTGELEGFNLEEVNYEGYGPGGVAVFMQATTDNRNRTVGEVRHLFAKYGGNLGESGSVGWMFDKKGYIVIERKNASEETLLEIVLEAGGEDVKEDGSNWEIYTAPEAFQAVRDALKSKGIAIAAEEVGMIPQTSVKLEGKQAQQMLKLMEALEEHDDVTHVWANFDIEEKEIEAAIS

Samples

Sample ID Description Type Environment
1 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
173 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
174 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
177 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
247 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
248 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
249 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
250 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.18
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0.18
Rhizoplane 0.37
Rhizosphere 98.53
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501045_0359951 3300049824 Bacteria 1083
2 Ga0055524_1000302 3300003775 Bacteria 47410
3 Ga0065714_10208562 3300005288 Bacteria 873
4 Ga0065704_10112734 3300005289 Bacteria 1928
5 Ga0065704_10119522 3300005289 Bacteria 1773
6 Ga0065704_10137363 3300005289 Unclassified 1556
7 Ga0065712_10162156 3300005290 Bacteria 1295
8 Ga0065715_10151376 3300005293 Bacteria 1725
9 Ga0065715_10190051 3300005293 Bacteria 1421
10 Ga0065707_10001479 3300005295 Bacteria 9195
11 Ga0065707_10307627 3300005295 Bacteria 987
12 Ga0070676_10103756 3300005328 Bacteria 1761
13 Ga0070683_100042467 3300005329 Bacteria 4186
14 Ga0070690_100309756 3300005330 Bacteria 1135
15 Ga0070670_100005693 3300005331 Bacteria 10524
16 Ga0070670_100126508 3300005331 Bacteria 2206
17 Ga0070670_100365220 3300005331 Bacteria 1270
18 Ga0068869_100070110 3300005334 Bacteria 2593
19 Ga0070680_100123763 3300005336 Bacteria 2160
20 Ga0070680_100144026 3300005336 Bacteria 1999
21 Ga0070680_100540020 3300005336 Bacteria 999
22 Ga0070660_100010099 3300005339 Bacteria 6661
23 Ga0070689_100004883 3300005340 Bacteria 9101
24 Ga0070687_100170020 3300005343 Bacteria 1296
25 Ga0070687_100186966 3300005343 Bacteria 1245
26 Ga0070692_10001349 3300005345 Bacteria 8852
27 Ga0070692_10036489 3300005345 Bacteria 2495
28 Ga0070669_100002591 3300005353 Bacteria 13067
29 Ga0070669_100070667 3300005353 Bacteria 2581
30 Ga0070675_100000239 3300005354 Bacteria 35505
31 Ga0070675_100000675 3300005354 Bacteria 23691
32 Ga0070675_100001024 3300005354 Bacteria 20115
33 Ga0070675_100002487 3300005354 Bacteria 13793
34 Ga0070675_100050508 3300005354 Bacteria 3414
35 Ga0070675_100083543 3300005354 Unclassified 2666
36 Ga0070675_100383897 3300005354 Bacteria 1251
37 Ga0070671_100005201 3300005355 Bacteria 10367
38 Ga0070674_100412587 3300005356 Bacteria 1106
39 Ga0070673_100011449 3300005364 Bacteria 6052
40 Ga0070673_100064027 3300005364 Bacteria 2928
41 Ga0070688_100009725 3300005365 Bacteria 5277
42 Ga0070688_100066611 3300005365 Bacteria 2292
43 Ga0070688_100090717 3300005365 Bacteria 1996
44 Ga0070659_100270201 3300005366 Bacteria 1412
45 Ga0070667_100001499 3300005367 Bacteria 20904
46 Ga0070703_10000223 3300005406 Bacteria 27460
47 Ga0070703_10045385 3300005406 Bacteria 1386
48 Ga0070709_10000019 3300005434 Bacteria 142246
49 Ga0070713_100026018 3300005436 Bacteria 4587
50 Ga0070701_10043244 3300005438 Bacteria 2303
51 Ga0070701_10052380 3300005438 Bacteria 2120
52 Ga0070711_100000071 3300005439 Bacteria 58870
53 Ga0070705_100000036 3300005440 Bacteria 67281
54 Ga0070705_100000288 3300005440 Bacteria 30044
55 Ga0070705_100024644 3300005440 Bacteria 3251
56 Ga0070705_100032846 3300005440 Bacteria 2887
57 Ga0070705_100056266 3300005440 Bacteria 2316
58 Ga0070705_100118788 3300005440 Bacteria 1703
59 Ga0070705_100191409 3300005440 Bacteria 1394
60 Ga0070705_100210623 3300005440 Bacteria 1339
61 Ga0070705_100292108 3300005440 Unclassified 1164
62 Ga0070700_100010664 3300005441 Bacteria 5075
63 Ga0070700_100207695 3300005441 Bacteria 1380
64 Ga0070700_100549644 3300005441 Bacteria 897
65 Ga0070694_100003725 3300005444 Bacteria 9092
66 Ga0070694_100014189 3300005444 Bacteria 4985
67 Ga0070694_100021729 3300005444 Bacteria 4105
68 Ga0070694_100032377 3300005444 Bacteria 3434
69 Ga0070694_100056767 3300005444 Bacteria 2660
70 Ga0070694_100069869 3300005444 Bacteria 2416
71 Ga0070694_100153039 3300005444 Bacteria 1686
72 Ga0070678_100317790 3300005456 Bacteria 1329
73 Ga0070662_100047672 3300005457 Bacteria 3083
74 Ga0070662_100055980 3300005457 Bacteria 2863
75 Ga0070681_10005093 3300005458 Bacteria 12679
76 Ga0068867_100378251 3300005459 Bacteria 1189
77 Ga0070685_10144478 3300005466 Bacteria 1501
78 Ga0070685_10269351 3300005466 Bacteria 1136
79 Ga0070685_10301659 3300005466 Bacteria 1080
80 Ga0070685_10385744 3300005466 Bacteria 966
81 Ga0070706_100000042 3300005467 Bacteria 147128
82 Ga0070707_100037700 3300005468 Bacteria 4615
83 Ga0070707_100918298 3300005468 Unclassified 840
84 Ga0070698_100002474 3300005471 Bacteria 20388
85 Ga0070698_100711485 3300005471 Bacteria 947
86 Ga0070699_100000088 3300005518 Bacteria 88268
87 Ga0070699_100000558 3300005518 Bacteria 35133
88 Ga0070699_100234096 3300005518 Bacteria 1638
89 Ga0070699_100281551 3300005518 Bacteria 1489
90 Ga0070697_100001756 3300005536 Bacteria 16543
91 Ga0070697_100075097 3300005536 Bacteria 2778
92 Ga0070697_100219681 3300005536 Bacteria 1619
93 Ga0068853_100637197 3300005539 Bacteria 1014
94 Ga0070672_100014662 3300005543 Bacteria 5560
95 Ga0070672_100112438 3300005543 Bacteria 2221
96 Ga0070672_100135677 3300005543 Bacteria 2026
97 Ga0070686_100025311 3300005544 Bacteria 3570
98 Ga0070686_100118897 3300005544 Bacteria 1812
99 Ga0070695_100005834 3300005545 Bacteria 7262
100 Ga0070695_100033314 3300005545 Bacteria 3223
101 Ga0070695_100041504 3300005545 Bacteria 2917
102 Ga0070695_100176308 3300005545 Bacteria 1511
103 Ga0070696_100000160 3300005546 Bacteria 37837
104 Ga0070696_100001518 3300005546 Bacteria 15229
105 Ga0070696_100001520 3300005546 Bacteria 15227
106 Ga0070696_100020973 3300005546 Bacteria 4429
107 Ga0070696_100029392 3300005546 Bacteria 3756
108 Ga0070696_100072673 3300005546 Bacteria 2423
109 Ga0070696_100555592 3300005546 Bacteria 920
110 Ga0070693_100001018 3300005547 Bacteria 12489
111 Ga0070704_100000802 3300005549 Bacteria 15581
112 Ga0070704_100001323 3300005549 Bacteria 13119
113 Ga0070704_100064726 3300005549 Bacteria 2629
114 Ga0070704_100067263 3300005549 Bacteria 2587
115 Ga0070704_100078752 3300005549 Bacteria 2419
116 Ga0070704_100092536 3300005549 Bacteria 2257
117 Ga0070704_100137481 3300005549 Bacteria 1903
118 Ga0070664_100075546 3300005564 Bacteria 2894
119 Ga0070664_100637990 3300005564 Bacteria 989
120 Ga0070664_100836629 3300005564 Bacteria 861
121 Ga0068857_100096665 3300005577 Bacteria 2647
122 Ga0068857_100233117 3300005577 Bacteria 1684
123 Ga0068857_100312785 3300005577 Bacteria 1449
124 Ga0068857_100479428 3300005577 Bacteria 1165
125 Ga0068854_100061695 3300005578 Bacteria 2716
126 Ga0070702_100022961 3300005615 Bacteria 3308
127 Ga0068859_100001859 3300005617 Bacteria 21461
128 Ga0068859_100004314 3300005617 Bacteria 14503
129 Ga0068859_100020763 3300005617 Bacteria 6592
130 Ga0068859_100072849 3300005617 Bacteria 3472
131 Ga0068859_100451546 3300005617 Bacteria 1382
132 Ga0068859_100481890 3300005617 Bacteria 1336
133 Ga0068859_100703660 3300005617 Bacteria 1101
134 Ga0068864_100097318 3300005618 Bacteria 2605
135 Ga0068864_100284096 3300005618 Bacteria 1545
136 Ga0068864_100415310 3300005618 Bacteria 1281
137 Ga0068861_100001024 3300005719 Bacteria 17105
138 Ga0068870_10002841 3300005840 Bacteria 7291
139 Ga0068863_100003032 3300005841 Bacteria 16605
140 Ga0068863_100016991 3300005841 Bacteria 6978
141 Ga0068863_100473616 3300005841 Bacteria 1231
142 Ga0068858_100114672 3300005842 Bacteria 2518
143 Ga0068858_100226740 3300005842 Bacteria 1771
144 Ga0068858_100379717 3300005842 Bacteria 1356
145 Ga0068858_100793656 3300005842 Bacteria 924
146 Ga0068860_100014506 3300005843 Bacteria 7712
147 Ga0068860_100015659 3300005843 Bacteria 7403
148 Ga0068860_100078115 3300005843 Unclassified 3148
149 Ga0068860_100340937 3300005843 Bacteria 1474
150 Ga0068862_100002475 3300005844 Bacteria 16354
151 Ga0081539_10000790 3300005985 Bacteria 61618
152 Ga0081539_10026575 3300005985 Bacteria 3689
153 Ga0070712_100039347 3300006175 Bacteria 3236
154 Ga0097621_100092378 3300006237 Bacteria 2534
155 Ga0097621_100228491 3300006237 Bacteria 1624
156 Ga0097621_100421593 3300006237 Bacteria 1198
157 Ga0097621_100427729 3300006237 Bacteria 1189
158 Ga0068871_100061983 3300006358 Bacteria 3056
159 Ga0075428_100002473 3300006844 Bacteria 20060
160 Ga0075428_100007293 3300006844 Bacteria 12246
161 Ga0075428_100014799 3300006844 Bacteria 8669
162 Ga0075428_100037261 3300006844 Bacteria 5355
163 Ga0075430_100050504 3300006846 Bacteria 3507
164 Ga0075430_100353618 3300006846 Bacteria 1213
165 Ga0075431_100003641 3300006847 Bacteria 14938
166 Ga0075431_100032234 3300006847 Bacteria 5400
167 Ga0075431_100495299 3300006847 Bacteria 1214
168 Ga0075433_10022639 3300006852 Bacteria 5277
169 Ga0075433_10103328 3300006852 Bacteria 2524
170 Ga0075433_10105300 3300006852 Unclassified 2499
171 Ga0075433_10574059 3300006852 Bacteria 991
172 Ga0075434_100000919 3300006871 Bacteria 23605
173 Ga0075434_100017203 3300006871 Bacteria 6961
174 Ga0075434_100062148 3300006871 Bacteria 3717
175 Ga0075434_100102722 3300006871 Bacteria 2866
176 Ga0075434_100461230 3300006871 Bacteria 1292
177 Ga0075429_100003923 3300006880 Bacteria 12713
178 Ga0075429_100827350 3300006880 Bacteria 811
179 Ga0075436_100000483 3300006914 Bacteria 25759
180 Ga0075436_100025340 3300006914 Bacteria 4081
181 Ga0097620_100001859 3300006931 Bacteria 21461
182 Ga0097620_100004314 3300006931 Bacteria 14503
183 Ga0097620_100020763 3300006931 Bacteria 6592
184 Ga0097620_100072859 3300006931 Bacteria 3472
185 Ga0097620_100451555 3300006931 Bacteria 1382
186 Ga0097620_100481911 3300006931 Bacteria 1336
187 Ga0097620_100703559 3300006931 Bacteria 1101
188 Ga0075435_100065838 3300007076 Bacteria 2946
189 Ga0075435_100122427 3300007076 Bacteria 2171
190 Ga0105251_10127115 3300009011 Bacteria 1157
191 Ga0105240_10005852 3300009093 Bacteria 18231
192 Ga0105240_10099572 3300009093 Bacteria 3538
193 Ga0111539_10002588 3300009094 Bacteria 23957
194 Ga0111539_10024703 3300009094 Bacteria 7370
195 Ga0111539_10032749 3300009094 Bacteria 6312
196 Ga0111539_10047335 3300009094 Bacteria 5139
197 Ga0111539_10095648 3300009094 Bacteria 3489
198 Ga0111539_10174585 3300009094 Bacteria 2510
199 Ga0105247_10114987 3300009101 Bacteria 1736
200 Ga0114129_10001096 3300009147 Bacteria 35569
201 Ga0114129_10001790 3300009147 Bacteria 29271
202 Ga0114129_10003742 3300009147 Bacteria 21453
203 Ga0114129_10012572 3300009147 Bacteria 12055
204 Ga0114129_10103084 3300009147 Bacteria 3945
205 Ga0114129_10130755 3300009147 Bacteria 3448
206 Ga0114129_10210393 3300009147 Bacteria 2629
207 Ga0114129_10245658 3300009147 Bacteria 2404
208 Ga0114129_10329954 3300009147 Bacteria 2026
209 Ga0114129_10439988 3300009147 Bacteria 1712
210 Ga0105243_10027395 3300009148 Bacteria 4366
211 Ga0105243_10031314 3300009148 Bacteria 4101
212 Ga0105243_10250283 3300009148 Bacteria 1581
213 Ga0105243_10306046 3300009148 Bacteria 1442
214 Ga0105242_10287045 3300009176 Bacteria 1497
215 Ga0105248_10000355 3300009177 Bacteria 53533
216 Ga0105248_10011176 3300009177 Bacteria 9902
217 Ga0105248_10016732 3300009177 Bacteria 8075
218 Ga0105248_10080722 3300009177 Bacteria 3656
219 Ga0105237_10085586 3300009545 Bacteria 3142
220 Ga0105237_10186996 3300009545 Bacteria 2071
221 Ga0105238_10146768 3300009551 Bacteria 2335
222 Ga0105249_10016780 3300009553 Bacteria 6498
223 Ga0105249_10095660 3300009553 Bacteria 2785
224 Ga0105249_10123254 3300009553 Bacteria 2465
225 Ga0105249_10488688 3300009553 Bacteria 1275
226 Ga0105239_10173167 3300010375 Bacteria 2414
227 Ga0105246_10585913 3300011119 Bacteria 961
228 Ga0157378_10067437 3300013297 Bacteria 3207
229 Ga0163162_10283910 3300013306 Bacteria 1787
230 Ga0163162_10990363 3300013306 Bacteria 950
231 Ga0157375_10005573 3300013308 Bacteria 10954
232 Ga0157375_11394055 3300013308 Bacteria 825
233 Ga0163163_10000023 3300014325 Bacteria 185843
234 Ga0163163_10043557 3300014325 Bacteria 4400
235 Ga0157380_10014504 3300014326 Bacteria 5766
236 Ga0157380_10100559 3300014326 Unclassified 2407
237 Ga0157380_10731013 3300014326 Bacteria 999
238 Ga0157377_10034627 3300014745 Bacteria 2763
239 Ga0157377_10158651 3300014745 Bacteria 1405
240 Ga0157379_10000517 3300014968 Bacteria 31255
241 Ga0157376_10151751 3300014969 Bacteria 2090
242 Ga0157376_10156607 3300014969 Unclassified 2061
243 Ga0157376_10374250 3300014969 Bacteria 1370
244 Ga0157376_10409052 3300014969 Bacteria 1314
245 Ga0163161_10035588 3300017792 Bacteria 3564
246 Ga0163161_10182247 3300017792 Bacteria 1611
247 Ga0206356_10282298 3300020070 Bacteria 881
248 Ga0207666_1003846 3300025271 Bacteria 1859
249 Ga0207697_10053047 3300025315 Bacteria 1679
250 Ga0207653_10000235 3300025885 Bacteria 36762
251 Ga0207653_10059414 3300025885 Bacteria 1287
252 Ga0207710_10120736 3300025900 Bacteria 1251
253 Ga0207688_10206141 3300025901 Bacteria 1180
254 Ga0207680_10265629 3300025903 Bacteria 1189
255 Ga0207699_10000005 3300025906 Bacteria 534560
256 Ga0207643_10035802 3300025908 Bacteria 2784
257 Ga0207684_10000061 3300025910 Bacteria 203286
258 Ga0207684_10109979 3300025910 Bacteria 2359
259 Ga0207684_10118177 3300025910 Bacteria 2272
260 Ga0207684_10482389 3300025910 Bacteria 1063
261 Ga0207707_10022422 3300025912 Bacteria 5520
262 Ga0207695_10032437 3300025913 Bacteria 5715
263 Ga0207695_10035428 3300025913 Bacteria 5411
264 Ga0207693_10109696 3300025915 Bacteria 2164
265 Ga0207663_10000051 3300025916 Bacteria 63011
266 Ga0207660_10302818 3300025917 Bacteria 1273
267 Ga0207662_10056781 3300025918 Unclassified 2339
268 Ga0207662_10273837 3300025918 Bacteria 1115
269 Ga0207662_10336210 3300025918 Bacteria 1011
270 Ga0207662_10504131 3300025918 Bacteria 834
271 Ga0207646_10101750 3300025922 Bacteria 2576
272 Ga0207646_10173306 3300025922 Bacteria 1948
273 Ga0207681_10000705 3300025923 Bacteria 21963
274 Ga0207681_10044057 3300025923 Bacteria 2989
275 Ga0207681_10150739 3300025923 Bacteria 1742
276 Ga0207681_10239972 3300025923 Bacteria 1410
277 Ga0207681_10256772 3300025923 Unclassified 1367
278 Ga0207650_10017612 3300025925 Bacteria 5003
279 Ga0207650_10248869 3300025925 Bacteria 1438
280 Ga0207650_10433596 3300025925 Bacteria 1092
281 Ga0207650_10577510 3300025925 Bacteria 944
282 Ga0207659_10001290 3300025926 Bacteria 14972
283 Ga0207659_10001420 3300025926 Bacteria 14274
284 Ga0207659_10001687 3300025926 Bacteria 13104
285 Ga0207659_10057832 3300025926 Unclassified 2782
286 Ga0207659_10169798 3300025926 Bacteria 1720
287 Ga0207659_10496652 3300025926 Bacteria 1032
288 Ga0207644_10397545 3300025931 Bacteria 1126
289 Ga0207690_10062065 3300025932 Bacteria 2543
290 Ga0207706_10039316 3300025933 Bacteria 4193
291 Ga0207670_10018458 3300025936 Bacteria 4240
292 Ga0207691_10007064 3300025940 Bacteria 10834
293 Ga0207691_10058264 3300025940 Bacteria 3513
294 Ga0207691_10072170 3300025940 Bacteria 3114
295 Ga0207691_10478990 3300025940 Bacteria 1058
296 Ga0207711_10006411 3300025941 Bacteria 9915
297 Ga0207711_10096517 3300025941 Bacteria 2609
298 Ga0207689_10092280 3300025942 Bacteria 2487
299 Ga0207689_10175941 3300025942 Bacteria 1765
300 Ga0207661_10361402 3300025944 Bacteria 1311
301 Ga0207679_10033416 3300025945 Bacteria 3619
302 Ga0207679_10104857 3300025945 Bacteria 2219
303 Ga0207679_10107508 3300025945 Bacteria 2195
304 Ga0207679_10760151 3300025945 Bacteria 882
305 Ga0207651_10022771 3300025960 Bacteria 3839
306 Ga0207651_10216523 3300025960 Bacteria 1545
307 Ga0207651_10381816 3300025960 Bacteria 1194
308 Ga0207712_10066974 3300025961 Bacteria 2569
309 Ga0207712_10236608 3300025961 Bacteria 1469
310 Ga0207640_10014196 3300025981 Bacteria 4579
311 Ga0207640_10326307 3300025981 Bacteria 1224
312 Ga0207658_10034675 3300025986 Bacteria 3608
313 Ga0207703_10043145 3300026035 Bacteria 3618
314 Ga0207703_10165231 3300026035 Bacteria 1941
315 Ga0207708_10112634 3300026075 Bacteria 2113
316 Ga0207708_10514461 3300026075 Bacteria 1005
317 Ga0207641_10003549 3300026088 Bacteria 13792
318 Ga0207641_10132801 3300026088 Bacteria 2237
319 Ga0207641_10573872 3300026088 Bacteria 1102
320 Ga0207648_10003537 3300026089 Bacteria 16338
321 Ga0207676_10072022 3300026095 Bacteria 2776
322 Ga0207676_10074116 3300026095 Bacteria 2741
323 Ga0207676_10124903 3300026095 Bacteria 2177
324 Ga0207674_10028476 3300026116 Bacteria 5897
325 Ga0207674_10103950 3300026116 Bacteria 2819
326 Ga0207674_10790231 3300026116 Bacteria 916
327 Ga0207675_100002780 3300026118 Bacteria 17190
328 Ga0207675_100016366 3300026118 Bacteria 6923
329 Ga0207675_100200104 3300026118 Bacteria 1918
330 Ga0207683_10170588 3300026121 Bacteria 1970
331 Ga0207428_10005347 3300027907 Bacteria 11972
332 Ga0207428_10020023 3300027907 Bacteria 5697
333 Ga0207428_10076799 3300027907 Bacteria 2615
334 Ga0207428_10093232 3300027907 Bacteria 2336
335 Ga0207428_10102620 3300027907 Unclassified 2209
336 Ga0207428_10549252 3300027907 Bacteria 836
337 Ga0268265_10000714 3300028380 Bacteria 32686
338 Ga0268264_10001966 3300028381 Bacteria 18469
339 Ga0268264_10009945 3300028381 Bacteria 7875
340 Ga0268264_10077760 3300028381 Unclassified 2827
341 Ga0268264_10102874 3300028381 Bacteria 2486
342 Ga0265331_10039781 3300031250 Bacteria 2291
343 Ga0265327_10209083 3300031251 Bacteria 881
344 Ga0265313_10019358 3300031595 Bacteria 3790
345 Ga0265314_10067460 3300031711 Bacteria 2410
346 Ga0316578_10098934 3300031728 Bacteria 1748
347 Ga0316578_10175392 3300031728 Unclassified 1292
348 Ga0307405_10007210 3300031731 Bacteria 5538
349 Ga0307405_10046672 3300031731 Bacteria 2663
350 Ga0307405_10069489 3300031731 Unclassified 2258
351 Ga0307405_10071706 3300031731 Bacteria 2230
352 Ga0316577_10116362 3300031733 Bacteria 1501
353 Ga0316577_10162157 3300031733 Bacteria 1261
354 Ga0316577_10262783 3300031733 Bacteria 976
355 Ga0307413_10002032 3300031824 Bacteria 8053
356 Ga0307413_10059094 3300031824 Bacteria 2354
357 Ga0307410_10004776 3300031852 Bacteria 7070
358 Ga0307410_10178860 3300031852 Bacteria 1604
359 Ga0307406_10008064 3300031901 Bacteria 5866
360 Ga0307406_10008262 3300031901 Bacteria 5802
361 Ga0307406_10012021 3300031901 Bacteria 4924
362 Ga0307406_10083915 3300031901 Bacteria 2126
363 Ga0307407_10005775 3300031903 Bacteria 5412
364 Ga0307407_10010616 3300031903 Bacteria 4352
365 Ga0307407_10059019 3300031903 Bacteria 2232
366 Ga0307412_10018616 3300031911 Bacteria 4184
367 Ga0307412_10028414 3300031911 Bacteria 3498
368 Ga0307412_10176888 3300031911 Bacteria 1601
369 Ga0307409_100016000 3300031995 Unclassified 4947
370 Ga0307409_100033255 3300031995 Bacteria 3750
371 Ga0307409_100033673 3300031995 Bacteria 3731
372 Ga0307409_100344736 3300031995 Bacteria 1403
373 Ga0307416_100033527 3300032002 Bacteria 3894
374 Ga0307416_100076722 3300032002 Bacteria 2802
375 Ga0307416_100310236 3300032002 Bacteria 1574
376 Ga0307416_100583767 3300032002 Bacteria 1195
377 Ga0307414_10047854 3300032004 Bacteria 2946
378 Ga0307411_10034010 3300032005 Bacteria 3167
379 Ga0307411_10041999 3300032005 Bacteria 2914
380 Ga0307411_10202339 3300032005 Bacteria 1526
381 Ga0307415_100012541 3300032126 Bacteria 4905
382 Ga0307415_100247326 3300032126 Bacteria 1447
383 Ga0316583_10040018 3300032133 Bacteria 1660
384 Ga0316583_10047810 3300032133 Bacteria 1508
385 Ga0316583_10049658 3300032133 Bacteria 1477
386 Ga0373940_0020405 3300035088 Bacteria 1684
387 Ga0373952_0038376 3300035092 Bacteria 1097
388 Ga0373936_0107600 3300035113 Bacteria 1181
389 Ga0373939_0181600 3300035114 Bacteria 785
390 Ga0373945_0044179 3300035116 Bacteria 1619
391 Ga0373945_0061022 3300035116 Bacteria 1408
392 Ga0373943_0016323 3300035170 Bacteria 3385
393 Ga0373947_0018355 3300035725 Bacteria 4026
394 Ga0373947_0171153 3300035725 Bacteria 1409
395 Ga0373937_0019700 3300036401 Bacteria 6042
396 Ga0373937_0291140 3300036401 Bacteria 1543
397 Ga0316582_0080180 3300036647 Bacteria 2130
398 Ga0316582_0266535 3300036647 Bacteria 1175
399 Ga0316584_0006871 3300036712 Bacteria 7733
400 Ga0316584_0024723 3300036712 Bacteria 4399
401 Ga0373925_0013930 3300037068 Bacteria 5821
402 Ga0373925_0136676 3300037068 Bacteria 1916
403 Ga0395905_0145155 3300037471 Bacteria 2233
404 Ga0395905_0188973 3300037471 Bacteria 1933
405 Ga0400483_286307 3300039062 Bacteria 4703
406 Ga0400489_90685 3300039093 Bacteria 1584
407 Ga0451807_0137355 3300041486 Bacteria 1225
408 Ga0439446_0051611 3300042156 Bacteria 1229
409 Ga0439458_0028596 3300042157 Bacteria 1320
410 Ga0450918_000954 3300042531 Bacteria 6042
411 Ga0451577_0004406 3300042876 Bacteria 14882
412 Ga0451577_0005948 3300042876 Bacteria 12302
413 Ga0451577_0092441 3300042876 Bacteria 2701
414 Ga0453684_0000354 3300044712 Bacteria 190599
415 Ga0453684_0000441 3300044712 Bacteria 169068
416 Ga0453684_0363228 3300044712 Bacteria 1629
417 Ga0451576_0007133 3300045051 Bacteria 13485
418 Ga0451576_0013998 3300045051 Bacteria 8945
419 Ga0451576_0017863 3300045051 Bacteria 7792
420 Ga0451576_0023122 3300045051 Bacteria 6734
421 Ga0451576_0055845 3300045051 Bacteria 4130
422 Ga0451576_0268525 3300045051 Bacteria 1783
423 Ga0451576_0360059 3300045051 Bacteria 1523
424 Ga0451576_0773076 3300045051 Bacteria 1009
425 Ga0495603_0010906 3300046455 Bacteria 5513
426 Ga0495629_0000002 3300046459 Bacteria 686975
427 Ga0495629_0009367 3300046459 Bacteria 7162
428 Ga0495580_0039588 3300046472 Bacteria 3373
429 Ga0495580_0242721 3300046472 Bacteria 1235
430 Ga0495639_0001606 3300046475 Bacteria 10062
431 Ga0495584_0031423 3300046491 Bacteria 2687
432 Ga0495594_0027482 3300046499 Bacteria 3066
433 Ga0495618_0007761 3300046514 Bacteria 6492
434 Ga0495644_0047878 3300046523 Bacteria 1605
435 Ga0495663_0005606 3300046525 Bacteria 3477
436 Ga0495666_0000363 3300046526 Bacteria 19992
437 Ga0495642_0013615 3300046528 Bacteria 3150
438 Ga0495640_0129133 3300046533 Bacteria 1637
439 Ga0495640_0416753 3300046533 Bacteria 823
440 Ga0495586_0000300 3300046535 Bacteria 31407
441 Ga0495586_0214681 3300046535 Bacteria 1092
442 Ga0495598_0020498 3300046537 Bacteria 1746
443 Ga0495609_0029630 3300046538 Bacteria 2492
444 Ga0495621_0033932 3300046539 Bacteria 1761
445 Ga0495621_0089364 3300046539 Bacteria 1160
446 Ga0495645_0087860 3300046543 Bacteria 2224
447 Ga0495622_0023042 3300046557 Bacteria 2902
448 Ga0495656_0164170 3300046615 Bacteria 1081
449 Ga0495635_0000960 3300046663 Bacteria 19029
450 Ga0495659_0007090 3300046664 Bacteria 3546
451 Ga0495659_0007662 3300046664 Bacteria 3422
452 Ga0495659_0041931 3300046664 Bacteria 1636
453 Ga0495599_0177300 3300046678 Bacteria 1314
454 Ga0495658_0049335 3300046683 Bacteria 2377
455 Ga0495658_0049656 3300046683 Bacteria 2370
456 Ga0495669_0025398 3300046684 Bacteria 2584
457 Ga0495669_0040750 3300046684 Bacteria 2061
458 Ga0495613_0110874 3300046689 Bacteria 1977
459 Ga0495600_0014772 3300046809 Bacteria 4924
460 Ga0495581_0031930 3300047315 Bacteria 3051
461 Ga0495581_0032038 3300047315 Bacteria 3044
462 Ga0495636_0005248 3300047318 Bacteria 5086
463 Ga0495636_0070696 3300047318 Bacteria 1489
464 Ga0495676_0002152 3300047321 Bacteria 17431
465 Ga0495676_0005978 3300047321 Bacteria 11182
466 Ga0495680_0017238 3300047322 Bacteria 6175
467 Ga0495677_0045300 3300047445 Bacteria 1613
468 Ga0495685_051367 3300047447 Bacteria 1398
469 Ga0495684_0043036 3300047471 Bacteria 3457
470 Ga0495686_0080704 3300047472 Bacteria 1988
471 Ga0496112_0105430 3300048915 Bacteria 2789
472 Ga0501031_0196139 3300049568 Bacteria 1318
473 Ga0501036_0250919 3300049572 Unclassified 1483
474 Ga0501038_0122109 3300049574 Unclassified 2147
475 Ga0501042_0014760 3300049578 Bacteria 5334
476 Ga0501046_0066040 3300049580 Unclassified 2821
477 Ga0501048_0085307 3300049582 Unclassified 2227
478 Ga0501067_0041572 3300049583 Bacteria 2553
479 Ga0501068_0078182 3300049584 Bacteria 2027
480 Ga0501072_0018264 3300049588 Bacteria 5396
481 Ga0501072_0262103 3300049588 Bacteria 1376
482 Ga0501072_0651514 3300049588 Bacteria 829
483 Ga0501075_0112173 3300049591 Unclassified 2073
484 Ga0501076_0033001 3300049592 Bacteria 4042
485 Ga0501239_015023 3300049672 Bacteria 901
486 Ga0501081_0450688 3300049743 Bacteria 956
487 Ga0501045_0128103 3300049824 Unclassified 1886
488 nmdc:mga05p37_1018144_c1 3300050507 Bacteria 878
489 nmdc:mga05p37_135829_c1 3300050507 Bacteria 3016
490 nmdc:mga05p37_1433_c1 3300050507 Bacteria 27689
491 nmdc:mga05p37_181281_c1 3300050507 Bacteria 2562
492 nmdc:mga05p37_287040_c1 3300050507 Bacteria 1960
493 nmdc:mga05p37_2888_c1 3300050507 Bacteria 19926
494 nmdc:mga05p37_3825_c1 3300050507 Bacteria 17603
495 nmdc:mga05p37_39052_c1 3300050507 Bacteria 5824
496 nmdc:mga05p37_40576_c1 3300050507 Bacteria 5716
497 nmdc:mga05p37_76956_c1 3300050507 Bacteria 4107
498 nmdc:mga05p37_90897_c1 3300050507 Bacteria 3762
499 nmdc:mga05p37_92481_c1 3300050507 Bacteria 3727
500 nmdc:mga09592_1848_c1 3300050508 Bacteria 17028
501 nmdc:mga09592_203864_c1 3300050508 Bacteria 1713
502 nmdc:mga0qj67_20350_c1 3300050509 Bacteria 5078
503 nmdc:mga0qj67_36800_c1 3300050509 Bacteria 3831
504 nmdc:mga06r32_15525_c1 3300050510 Bacteria 6916
505 nmdc:mga06r32_222695_c1 3300050510 Bacteria 1875
506 nmdc:mga06r32_569652_c1 3300050510 Bacteria 1105
507 nmdc:mga08y16_24168_c1 3300050511 Bacteria 6415
508 nmdc:mga08y16_29258_c1 3300050511 Bacteria 5805
509 nmdc:mga08y16_31876_c1 3300050511 Bacteria 5542
510 nmdc:mga08y16_35593_c1 3300050511 Bacteria 5228
511 nmdc:mga08y16_86973_c1 3300050511 Bacteria 3257
512 nmdc:mga08y16_978150_c1 3300050511 Bacteria 828
513 nmdc:mga0n895_107801_c1 3300050512 Bacteria 2799
514 nmdc:mga0n895_108871_c1 3300050512 Bacteria 2786
515 nmdc:mga0n895_1110_c1 3300050512 Bacteria 19640
516 nmdc:mga0n895_123651_c1 3300050512 Bacteria 2610
517 nmdc:mga0n895_15420_c1 3300050512 Bacteria 6967
518 nmdc:mga0n895_175954_c1 3300050512 Bacteria 2171
519 nmdc:mga0n895_32770_c1 3300050512 Bacteria 4988
520 nmdc:mga0n895_420889_c1 3300050512 Bacteria 1350
521 nmdc:mga0n895_570576_c1 3300050512 Bacteria 1136
522 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
523 nmdc:mga08x19_69507_c1 3300050514 Unclassified 2294
524 nmdc:mga0a205_201817_c1 3300050515 Bacteria 1879
525 nmdc:mga0a205_2103_c1 3300050515 Bacteria 17454
526 nmdc:mga0a205_279592_c1 3300050515 Bacteria 1545
527 nmdc:mga0a205_331434_c1 3300050515 Bacteria 1392
528 nmdc:mga0a205_409923_c1 3300050515 Bacteria 1218
529 nmdc:mga0a205_59430_c1 3300050515 Bacteria 3692
530 nmdc:mga0a205_94195_c1 3300050515 Unclassified 2523
531 Ga0495595_0155103 3300053084 Bacteria 1128
532 Ga0495619_0051228 3300053085 Bacteria 2728
533 Ga0500595_005343 3300053119 Bacteria 5618
534 Ga0501084_0048971 3300054114 Bacteria 3537
535 Ga0590071_000184 3300059421 Bacteria 18178
536 Ga0590074_000189 3300059423 Bacteria 7784
537 Ga0590075_001239 3300059424 Bacteria 6430
538 Ga0590077_000704 3300059426 Bacteria 8838
539 Ga0501082_0191557 3300060353 Unclassified 1779
540 Ga0530510_0120545 3300061734 Bacteria 1925
541 Ga0530510_0126632 3300061734 Bacteria 1878
542 2644243614 2643221644 Bacteria 6865017
543 2715498888 2713897090 Bacteria 3353799
544 2899261212 2899259804 Bacteria 3320927
545 2929298636 2929297113 Bacteria 3141306
546 Ga0501045_0359951
547 Ga0055524_1000302
548 Ga0065714_10208562
549 Ga0065704_10112734
550 Ga0065704_10119522
551 Ga0065704_10137363
552 Ga0065712_10162156
553 Ga0065715_10151376
554 Ga0065715_10190051
555 Ga0065707_10001479
556 Ga0065707_10307627
557 Ga0070676_10103756
558 Ga0070683_100042467
559 Ga0070690_100309756
560 Ga0070670_100005693
561 Ga0070670_100126508
562 Ga0070670_100365220
563 Ga0068869_100070110
564 Ga0070680_100123763
565 Ga0070680_100144026
566 Ga0070680_100540020
567 Ga0070660_100010099
568 Ga0070689_100004883
569 Ga0070687_100170020
570 Ga0070687_100186966
571 Ga0070692_10001349
572 Ga0070692_10036489
573 Ga0070669_100002591
574 Ga0070669_100070667
575 Ga0070675_100000239
576 Ga0070675_100000675
577 Ga0070675_100001024
578 Ga0070675_100002487
579 Ga0070675_100050508
580 Ga0070675_100083543
581 Ga0070675_100383897
582 Ga0070671_100005201
583 Ga0070674_100412587
584 Ga0070673_100011449
585 Ga0070673_100064027
586 Ga0070688_100009725
587 Ga0070688_100066611
588 Ga0070688_100090717
589 Ga0070659_100270201
590 Ga0070667_100001499
591 Ga0070703_10000223
592 Ga0070703_10045385
593 Ga0070709_10000019
594 Ga0070713_100026018
595 Ga0070701_10043244
596 Ga0070701_10052380
597 Ga0070711_100000071
598 Ga0070705_100000036
599 Ga0070705_100000288
600 Ga0070705_100024644
601 Ga0070705_100032846
602 Ga0070705_100056266
603 Ga0070705_100118788
604 Ga0070705_100191409
605 Ga0070705_100210623
606 Ga0070705_100292108
607 Ga0070700_100010664
608 Ga0070700_100207695
609 Ga0070700_100549644
610 Ga0070694_100003725
611 Ga0070694_100014189
612 Ga0070694_100021729
613 Ga0070694_100032377
614 Ga0070694_100056767
615 Ga0070694_100069869
616 Ga0070694_100153039
617 Ga0070678_100317790
618 Ga0070662_100047672
619 Ga0070662_100055980
620 Ga0070681_10005093
621 Ga0068867_100378251
622 Ga0070685_10144478
623 Ga0070685_10269351
624 Ga0070685_10301659
625 Ga0070685_10385744
626 Ga0070706_100000042
627 Ga0070707_100037700
628 Ga0070707_100918298
629 Ga0070698_100002474
630 Ga0070698_100711485
631 Ga0070699_100000088
632 Ga0070699_100000558
633 Ga0070699_100234096
634 Ga0070699_100281551
635 Ga0070697_100001756
636 Ga0070697_100075097
637 Ga0070697_100219681
638 Ga0068853_100637197
639 Ga0070672_100014662
640 Ga0070672_100112438
641 Ga0070672_100135677
642 Ga0070686_100025311
643 Ga0070686_100118897
644 Ga0070695_100005834
645 Ga0070695_100033314
646 Ga0070695_100041504
647 Ga0070695_100176308
648 Ga0070696_100000160
649 Ga0070696_100001518
650 Ga0070696_100001520
651 Ga0070696_100020973
652 Ga0070696_100029392
653 Ga0070696_100072673
654 Ga0070696_100555592
655 Ga0070693_100001018
656 Ga0070704_100000802
657 Ga0070704_100001323
658 Ga0070704_100064726
659 Ga0070704_100067263
660 Ga0070704_100078752
661 Ga0070704_100092536
662 Ga0070704_100137481
663 Ga0070664_100075546
664 Ga0070664_100637990
665 Ga0070664_100836629
666 Ga0068857_100096665
667 Ga0068857_100233117
668 Ga0068857_100312785
669 Ga0068857_100479428
670 Ga0068854_100061695
671 Ga0070702_100022961
672 Ga0068859_100001859
673 Ga0068859_100004314
674 Ga0068859_100020763
675 Ga0068859_100072849
676 Ga0068859_100451546
677 Ga0068859_100481890
678 Ga0068859_100703660
679 Ga0068864_100097318
680 Ga0068864_100284096
681 Ga0068864_100415310
682 Ga0068861_100001024
683 Ga0068870_10002841
684 Ga0068863_100003032
685 Ga0068863_100016991
686 Ga0068863_100473616
687 Ga0068858_100114672
688 Ga0068858_100226740
689 Ga0068858_100379717
690 Ga0068858_100793656
691 Ga0068860_100014506
692 Ga0068860_100015659
693 Ga0068860_100078115
694 Ga0068860_100340937
695 Ga0068862_100002475
696 Ga0081539_10000790
697 Ga0081539_10026575
698 Ga0070712_100039347
699 Ga0097621_100092378
700 Ga0097621_100228491
701 Ga0097621_100421593
702 Ga0097621_100427729
703 Ga0068871_100061983
704 Ga0075428_100002473
705 Ga0075428_100007293
706 Ga0075428_100014799
707 Ga0075428_100037261
708 Ga0075430_100050504
709 Ga0075430_100353618
710 Ga0075431_100003641
711 Ga0075431_100032234
712 Ga0075431_100495299
713 Ga0075433_10022639
714 Ga0075433_10103328
715 Ga0075433_10105300
716 Ga0075433_10574059
717 Ga0075434_100000919
718 Ga0075434_100017203
719 Ga0075434_100062148
720 Ga0075434_100102722
721 Ga0075434_100461230
722 Ga0075429_100003923
723 Ga0075429_100827350
724 Ga0075436_100000483
725 Ga0075436_100025340
726 Ga0097620_100001859
727 Ga0097620_100004314
728 Ga0097620_100020763
729 Ga0097620_100072859
730 Ga0097620_100451555
731 Ga0097620_100481911
732 Ga0097620_100703559
733 Ga0075435_100065838
734 Ga0075435_100122427
735 Ga0105251_10127115
736 Ga0105240_10005852
737 Ga0105240_10099572
738 Ga0111539_10002588
739 Ga0111539_10024703
740 Ga0111539_10032749
741 Ga0111539_10047335
742 Ga0111539_10095648
743 Ga0111539_10174585
744 Ga0105247_10114987
745 Ga0114129_10001096
746 Ga0114129_10001790
747 Ga0114129_10003742
748 Ga0114129_10012572
749 Ga0114129_10103084
750 Ga0114129_10130755
751 Ga0114129_10210393
752 Ga0114129_10245658
753 Ga0114129_10329954
754 Ga0114129_10439988
755 Ga0105243_10027395
756 Ga0105243_10031314
757 Ga0105243_10250283
758 Ga0105243_10306046
759 Ga0105242_10287045
760 Ga0105248_10000355
761 Ga0105248_10011176
762 Ga0105248_10016732
763 Ga0105248_10080722
764 Ga0105237_10085586
765 Ga0105237_10186996
766 Ga0105238_10146768
767 Ga0105249_10016780
768 Ga0105249_10095660
769 Ga0105249_10123254
770 Ga0105249_10488688
771 Ga0105239_10173167
772 Ga0105246_10585913
773 Ga0157378_10067437
774 Ga0163162_10283910
775 Ga0163162_10990363
776 Ga0157375_10005573
777 Ga0157375_11394055
778 Ga0163163_10000023
779 Ga0163163_10043557
780 Ga0157380_10014504
781 Ga0157380_10100559
782 Ga0157380_10731013
783 Ga0157377_10034627
784 Ga0157377_10158651
785 Ga0157379_10000517
786 Ga0157376_10151751
787 Ga0157376_10156607
788 Ga0157376_10374250
789 Ga0157376_10409052
790 Ga0163161_10035588
791 Ga0163161_10182247
792 Ga0206356_10282298
793 Ga0207666_1003846
794 Ga0207697_10053047
795 Ga0207653_10000235
796 Ga0207653_10059414
797 Ga0207710_10120736
798 Ga0207688_10206141
799 Ga0207680_10265629
800 Ga0207699_10000005
801 Ga0207643_10035802
802 Ga0207684_10000061
803 Ga0207684_10109979
804 Ga0207684_10118177
805 Ga0207684_10482389
806 Ga0207707_10022422
807 Ga0207695_10032437
808 Ga0207695_10035428
809 Ga0207693_10109696
810 Ga0207663_10000051
811 Ga0207660_10302818
812 Ga0207662_10056781
813 Ga0207662_10273837
814 Ga0207662_10336210
815 Ga0207662_10504131
816 Ga0207646_10101750
817 Ga0207646_10173306
818 Ga0207681_10000705
819 Ga0207681_10044057
820 Ga0207681_10150739
821 Ga0207681_10239972
822 Ga0207681_10256772
823 Ga0207650_10017612
824 Ga0207650_10248869
825 Ga0207650_10433596
826 Ga0207650_10577510
827 Ga0207659_10001290
828 Ga0207659_10001420
829 Ga0207659_10001687
830 Ga0207659_10057832
831 Ga0207659_10169798
832 Ga0207659_10496652
833 Ga0207644_10397545
834 Ga0207690_10062065
835 Ga0207706_10039316
836 Ga0207670_10018458
837 Ga0207691_10007064
838 Ga0207691_10058264
839 Ga0207691_10072170
840 Ga0207691_10478990
841 Ga0207711_10006411
842 Ga0207711_10096517
843 Ga0207689_10092280
844 Ga0207689_10175941
845 Ga0207661_10361402
846 Ga0207679_10033416
847 Ga0207679_10104857
848 Ga0207679_10107508
849 Ga0207679_10760151
850 Ga0207651_10022771
851 Ga0207651_10216523
852 Ga0207651_10381816
853 Ga0207712_10066974
854 Ga0207712_10236608
855 Ga0207640_10014196
856 Ga0207640_10326307
857 Ga0207658_10034675
858 Ga0207703_10043145
859 Ga0207703_10165231
860 Ga0207708_10112634
861 Ga0207708_10514461
862 Ga0207641_10003549
863 Ga0207641_10132801
864 Ga0207641_10573872
865 Ga0207648_10003537
866 Ga0207676_10072022
867 Ga0207676_10074116
868 Ga0207676_10124903
869 Ga0207674_10028476
870 Ga0207674_10103950
871 Ga0207674_10790231
872 Ga0207675_100002780
873 Ga0207675_100016366
874 Ga0207675_100200104
875 Ga0207683_10170588
876 Ga0207428_10005347
877 Ga0207428_10020023
878 Ga0207428_10076799
879 Ga0207428_10093232
880 Ga0207428_10102620
881 Ga0207428_10549252
882 Ga0268265_10000714
883 Ga0268264_10001966
884 Ga0268264_10009945
885 Ga0268264_10077760
886 Ga0268264_10102874
887 Ga0265331_10039781
888 Ga0265327_10209083
889 Ga0265313_10019358
890 Ga0265314_10067460
891 Ga0316578_10098934
892 Ga0316578_10175392
893 Ga0307405_10007210
894 Ga0307405_10046672
895 Ga0307405_10069489
896 Ga0307405_10071706
897 Ga0316577_10116362
898 Ga0316577_10162157
899 Ga0316577_10262783
900 Ga0307413_10002032
901 Ga0307413_10059094
902 Ga0307410_10004776
903 Ga0307410_10178860
904 Ga0307406_10008064
905 Ga0307406_10008262
906 Ga0307406_10012021
907 Ga0307406_10083915
908 Ga0307407_10005775
909 Ga0307407_10010616
910 Ga0307407_10059019
911 Ga0307412_10018616
912 Ga0307412_10028414
913 Ga0307412_10176888
914 Ga0307409_100016000
915 Ga0307409_100033255
916 Ga0307409_100033673
917 Ga0307409_100344736
918 Ga0307416_100033527
919 Ga0307416_100076722
920 Ga0307416_100310236
921 Ga0307416_100583767
922 Ga0307414_10047854
923 Ga0307411_10034010
924 Ga0307411_10041999
925 Ga0307411_10202339
926 Ga0307415_100012541
927 Ga0307415_100247326
928 Ga0316583_10040018
929 Ga0316583_10047810
930 Ga0316583_10049658
931 Ga0373940_0020405
932 Ga0373952_0038376
933 Ga0373936_0107600
934 Ga0373939_0181600
935 Ga0373945_0044179
936 Ga0373945_0061022
937 Ga0373943_0016323
938 Ga0373947_0018355
939 Ga0373947_0171153
940 Ga0373937_0019700
941 Ga0373937_0291140
942 Ga0316582_0080180
943 Ga0316582_0266535
944 Ga0316584_0006871
945 Ga0316584_0024723
946 Ga0373925_0013930
947 Ga0373925_0136676
948 Ga0395905_0145155
949 Ga0395905_0188973
950 Ga0400483_286307
951 Ga0400489_90685
952 Ga0451807_0137355
953 Ga0439446_0051611
954 Ga0439458_0028596
955 Ga0450918_000954
956 Ga0451577_0004406
957 Ga0451577_0005948
958 Ga0451577_0092441
959 Ga0453684_0000354
960 Ga0453684_0000441
961 Ga0453684_0363228
962 Ga0451576_0007133
963 Ga0451576_0013998
964 Ga0451576_0017863
965 Ga0451576_0023122
966 Ga0451576_0055845
967 Ga0451576_0268525
968 Ga0451576_0360059
969 Ga0451576_0773076
970 Ga0495603_0010906
971 Ga0495629_0000002
972 Ga0495629_0009367
973 Ga0495580_0039588
974 Ga0495580_0242721
975 Ga0495639_0001606
976 Ga0495584_0031423
977 Ga0495594_0027482
978 Ga0495618_0007761
979 Ga0495644_0047878
980 Ga0495663_0005606
981 Ga0495666_0000363
982 Ga0495642_0013615
983 Ga0495640_0129133
984 Ga0495640_0416753
985 Ga0495586_0000300
986 Ga0495586_0214681
987 Ga0495598_0020498
988 Ga0495609_0029630
989 Ga0495621_0033932
990 Ga0495621_0089364
991 Ga0495645_0087860
992 Ga0495622_0023042
993 Ga0495656_0164170
994 Ga0495635_0000960
995 Ga0495659_0007090
996 Ga0495659_0007662
997 Ga0495659_0041931
998 Ga0495599_0177300
999 Ga0495658_0049335
1000 Ga0495658_0049656
1001 Ga0495669_0025398
1002 Ga0495669_0040750
1003 Ga0495613_0110874
1004 Ga0495600_0014772
1005 Ga0495581_0031930
1006 Ga0495581_0032038
1007 Ga0495636_0005248
1008 Ga0495636_0070696
1009 Ga0495676_0002152
1010 Ga0495676_0005978
1011 Ga0495680_0017238
1012 Ga0495677_0045300
1013 Ga0495685_051367
1014 Ga0495684_0043036
1015 Ga0495686_0080704
1016 Ga0496112_0105430
1017 Ga0501031_0196139
1018 Ga0501036_0250919
1019 Ga0501038_0122109
1020 Ga0501042_0014760
1021 Ga0501046_0066040
1022 Ga0501048_0085307
1023 Ga0501067_0041572
1024 Ga0501068_0078182
1025 Ga0501072_0018264
1026 Ga0501072_0262103
1027 Ga0501072_0651514
1028 Ga0501075_0112173
1029 Ga0501076_0033001
1030 Ga0501239_015023
1031 Ga0501081_0450688
1032 Ga0501045_0128103
1033 nmdc:mga05p37_1018144_c1
1034 nmdc:mga05p37_135829_c1
1035 nmdc:mga05p37_1433_c1
1036 nmdc:mga05p37_181281_c1
1037 nmdc:mga05p37_287040_c1
1038 nmdc:mga05p37_2888_c1
1039 nmdc:mga05p37_3825_c1
1040 nmdc:mga05p37_39052_c1
1041 nmdc:mga05p37_40576_c1
1042 nmdc:mga05p37_76956_c1
1043 nmdc:mga05p37_90897_c1
1044 nmdc:mga05p37_92481_c1
1045 nmdc:mga09592_1848_c1
1046 nmdc:mga09592_203864_c1
1047 nmdc:mga0qj67_20350_c1
1048 nmdc:mga0qj67_36800_c1
1049 nmdc:mga06r32_15525_c1
1050 nmdc:mga06r32_222695_c1
1051 nmdc:mga06r32_569652_c1
1052 nmdc:mga08y16_24168_c1
1053 nmdc:mga08y16_29258_c1
1054 nmdc:mga08y16_31876_c1
1055 nmdc:mga08y16_35593_c1
1056 nmdc:mga08y16_86973_c1
1057 nmdc:mga08y16_978150_c1
1058 nmdc:mga0n895_107801_c1
1059 nmdc:mga0n895_108871_c1
1060 nmdc:mga0n895_1110_c1
1061 nmdc:mga0n895_123651_c1
1062 nmdc:mga0n895_15420_c1
1063 nmdc:mga0n895_175954_c1
1064 nmdc:mga0n895_32770_c1
1065 nmdc:mga0n895_420889_c1
1066 nmdc:mga0n895_570576_c1
1067 nmdc:mga08x19_2_c1
1068 nmdc:mga08x19_69507_c1
1069 nmdc:mga0a205_201817_c1
1070 nmdc:mga0a205_2103_c1
1071 nmdc:mga0a205_279592_c1
1072 nmdc:mga0a205_331434_c1
1073 nmdc:mga0a205_409923_c1
1074 nmdc:mga0a205_59430_c1
1075 nmdc:mga0a205_94195_c1
1076 Ga0495595_0155103
1077 Ga0495619_0051228
1078 Ga0500595_005343
1079 Ga0501084_0048971
1080 Ga0590071_000184
1081 Ga0590074_000189
1082 Ga0590075_001239
1083 Ga0590077_000704
1084 Ga0501082_0191557
1085 Ga0530510_0120545
1086 Ga0530510_0126632
1087 2644243614
1088 2715498888
1089 2899261212
1090 2929298636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

41

112

0.98

PF01709

Transcrip_reg

TACO1/YebC second and third domain

118

273

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8693 18 240
4f3q-assembly1.cif.gz_A structure of a yebc family protein (cbu_1566) from coxiella burnetii 0.8615 6 240
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8557 3 240
4f3q-assembly1.cif.gz_A structure of a yebc family protein (cbu_1566) from coxiella burnetii 0.8448 6 240
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.828 3 240
ID Description Score Start End Superfamily
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9695 28 75 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9623 83 240 3.30.70.980
4f3qA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9391 130 205 3.30.70.980
4f3qA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9273 130 205 3.30.70.980
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9197 19 79 1.10.10.200
ID Description Score Start End GO Terms
AF-Q8P6E3-F1-model_v4 Probable transcriptional regulatory protein XCC3027 0.9918 18 237 GO:0003677
GO:0005829
GO:0006355
AF-A0A2D6IY08-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9907 125 240 GO:0003677
GO:0005829
AF-A0A377V8M7-F1-model_v4 Probable transcriptional regulatory protein YebC 0.9823 83 190 GO:0005829
AF-A0A3B9L7U6-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9811 62 240 GO:0003677
GO:0005829
AF-A0A536RP66-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9802 1 135 GO:0003677
GO:0005829

Map