F461952

General Info

Members Datasets Scaffolds Average Seq Length
546 188 545 154

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10001103|Ga0070709_100011036
Length 168
Sequence MRNSGGDEERLTELSPGWDDEELLAALRQAFAARRAVPPEFVQAGKNAFAWHDIDAELAQLTYDSTRLTEEAVATRAQEEAAIRVLTFTSAQAGLQIELEVQEDALAGQILPMQAAAIEIQTRTGTQQPISADEVGCFWISPIPSGDFRLRCRPVTGNAEVVTAWVRL

Samples

Sample ID Description Type Environment
1 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.89
Metatranscriptomes 2.93
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 1.47
Rhizosphere 94.51
Stem 0
Stem Tuber 0
Unclassified 3.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10106360 3300003316 Bacteria 1362
2 Ga0058863_11779226 3300004799 Bacteria 711
3 Ga0070683_100012775 3300005329 Bacteria 7305
4 Ga0070680_100048080 3300005336 Bacteria 3476
5 Ga0070680_100704430 3300005336 Bacteria 869
6 Ga0070660_100065500 3300005339 Bacteria 2828
7 Ga0070671_100255816 3300005355 Bacteria 1488
8 Ga0070709_10001103 3300005434 Bacteria 14882
9 Ga0070709_10039817 3300005434 Bacteria 2886
10 Ga0070709_10495583 3300005434 Unclassified 927
11 Ga0070714_100002496 3300005435 Bacteria 13575
12 Ga0070714_100016814 3300005435 Bacteria 5915
13 Ga0070714_100025226 3300005435 Bacteria 4905
14 Ga0070714_100100616 3300005435 Bacteria 2546
15 Ga0070714_100208542 3300005435 Bacteria 1790
16 Ga0070714_100213732 3300005435 Bacteria 1769
17 Ga0070714_100479609 3300005435 Bacteria 1184
18 Ga0070714_100578384 3300005435 Unclassified 1077
19 Ga0070714_100637689 3300005435 Bacteria 1025
20 Ga0070714_101401149 3300005435 Unclassified 682
21 Ga0070713_100003051 3300005436 Bacteria 11002
22 Ga0070713_100021529 3300005436 Bacteria 4962
23 Ga0070713_100059325 3300005436 Bacteria 3195
24 Ga0070713_100169839 3300005436 Unclassified 1953
25 Ga0070713_100627372 3300005436 Bacteria 1022
26 Ga0070713_100937933 3300005436 Unclassified 833
27 Ga0070713_101183544 3300005436 Bacteria 740
28 Ga0070713_101355772 3300005436 Bacteria 689
29 Ga0070710_10000964 3300005437 Bacteria 13649
30 Ga0070710_10030877 3300005437 Bacteria 2886
31 Ga0070710_10061962 3300005437 Bacteria 2132
32 Ga0070710_10080405 3300005437 Bacteria 1901
33 Ga0070710_10109028 3300005437 Bacteria 1660
34 Ga0070710_10177182 3300005437 Bacteria 1332
35 Ga0070710_10275101 3300005437 Unclassified 1090
36 Ga0070710_11155570 3300005437 Bacteria 570
37 Ga0070711_100002034 3300005439 Bacteria 11400
38 Ga0070711_100092359 3300005439 Unclassified 2184
39 Ga0070711_100115781 3300005439 Bacteria 1974
40 Ga0070711_100336180 3300005439 Unclassified 1210
41 Ga0070711_101221956 3300005439 Bacteria 650
42 Ga0070705_100028852 3300005440 Bacteria 3044
43 Ga0070708_100008998 3300005445 Bacteria 8047
44 Ga0070708_100048091 3300005445 Bacteria 3769
45 Ga0070708_100170265 3300005445 Bacteria 2033
46 Ga0070708_100658658 3300005445 Bacteria 986
47 Ga0070663_100148415 3300005455 Bacteria 1796
48 Ga0070681_10005841 3300005458 Bacteria 11918
49 Ga0070706_100001732 3300005467 Bacteria 22598
50 Ga0070706_100006702 3300005467 Bacteria 10871
51 Ga0070706_100009069 3300005467 Bacteria 9261
52 Ga0070706_100081675 3300005467 Bacteria 2993
53 Ga0070706_100083657 3300005467 Bacteria 2957
54 Ga0070706_100128645 3300005467 Bacteria 2362
55 Ga0070706_100161419 3300005467 Bacteria 2093
56 Ga0070706_100171280 3300005467 Bacteria 2027
57 Ga0070706_100214245 3300005467 Bacteria 1798
58 Ga0070706_100490228 3300005467 Bacteria 1143
59 Ga0070706_100525196 3300005467 Bacteria 1101
60 Ga0070707_100000043 3300005468 Bacteria 108893
61 Ga0070707_100020875 3300005468 Bacteria 6182
62 Ga0070707_100035663 3300005468 Bacteria 4745
63 Ga0070707_100192001 3300005468 Bacteria 1991
64 Ga0070707_101238217 3300005468 Bacteria 712
65 Ga0070698_100000072 3300005471 Bacteria 75715
66 Ga0070698_100007190 3300005471 Bacteria 12058
67 Ga0070698_100022346 3300005471 Bacteria 6617
68 Ga0070698_100142499 3300005471 Bacteria 2347
69 Ga0070698_100600611 3300005471 Bacteria 1041
70 Ga0070699_100002469 3300005518 Bacteria 16624
71 Ga0070699_100018430 3300005518 Bacteria 5997
72 Ga0070699_100089733 3300005518 Bacteria 2686
73 Ga0070699_100626130 3300005518 Bacteria 982
74 Ga0070679_100018751 3300005530 Bacteria 6717
75 Ga0070684_100070212 3300005535 Bacteria 3082
76 Ga0070697_100001274 3300005536 Bacteria 19026
77 Ga0070697_100152403 3300005536 Bacteria 1949
78 Ga0068856_100813581 3300005614 Unclassified 954
79 Ga0068852_100408302 3300005616 Unclassified 1337
80 Ga0068859_101502536 3300005617 Bacteria 743
81 Ga0068864_100369049 3300005618 Bacteria 1358
82 Ga0068861_100466743 3300005719 Bacteria 1134
83 Ga0068863_100411672 3300005841 Bacteria 1323
84 Ga0081455_10033317 3300005937 Unclassified 4631
85 Ga0081540_1002497 3300005983 Bacteria 14976
86 Ga0081540_1282424 3300005983 Bacteria 573
87 Ga0070717_10005834 3300006028 Bacteria 9023
88 Ga0070717_10010153 3300006028 Bacteria 7091
89 Ga0070717_10013944 3300006028 Bacteria 6173
90 Ga0070717_10029484 3300006028 Bacteria 4402
91 Ga0070717_10103921 3300006028 Bacteria 2416
92 Ga0070717_10155379 3300006028 Bacteria 1981
93 Ga0070717_10155797 3300006028 Bacteria 1979
94 Ga0070717_10188882 3300006028 Bacteria 1799
95 Ga0070717_10245344 3300006028 Bacteria 1581
96 Ga0070717_10667380 3300006028 Unclassified 944
97 Ga0070717_10724968 3300006028 Bacteria 903
98 Ga0070717_11352791 3300006028 Unclassified 647
99 Ga0070715_10005600 3300006163 Bacteria 4201
100 Ga0070715_10084508 3300006163 Unclassified 1447
101 Ga0070715_10247098 3300006163 Bacteria 931
102 Ga0070716_100001284 3300006173 Bacteria 11091
103 Ga0070716_100006271 3300006173 Bacteria 5802
104 Ga0070716_100029261 3300006173 Bacteria 2976
105 Ga0070716_100300765 3300006173 Bacteria 1116
106 Ga0070712_100004057 3300006175 Bacteria 8988
107 Ga0070712_100021734 3300006175 Bacteria 4219
108 Ga0070712_100057191 3300006175 Bacteria 2738
109 Ga0070712_100246673 3300006175 Unclassified 1425
110 Ga0070712_100260971 3300006175 Bacteria 1388
111 Ga0070712_100915913 3300006175 Unclassified 756
112 Ga0070712_101100878 3300006175 Bacteria 689
113 Ga0075367_10831803 3300006178 Unclassified 588
114 Ga0068871_100123533 3300006358 Bacteria 2189
115 Ga0068871_100271415 3300006358 Bacteria 1482
116 Ga0075428_100180503 3300006844 Bacteria 2285
117 Ga0075428_100283073 3300006844 Bacteria 1784
118 Ga0075430_100813503 3300006846 Bacteria 770
119 Ga0075431_100188426 3300006847 Bacteria 2114
120 Ga0075434_100747531 3300006871 Bacteria 995
121 Ga0075436_100010349 3300006914 Bacteria 6390
122 Ga0097620_101502557 3300006931 Bacteria 743
123 Ga0075435_100729088 3300007076 Bacteria 862
124 Ga0099794_10066611 3300007265 Bacteria 1758
125 Ga0111539_10012462 3300009094 Bacteria 10657
126 Ga0105245_10392866 3300009098 Bacteria 1384
127 Ga0114129_10034238 3300009147 Bacteria 7174
128 Ga0105243_12864934 3300009148 Unclassified 523
129 Ga0105241_10682196 3300009174 Bacteria 936
130 Ga0105237_11755926 3300009545 Bacteria 628
131 Ga0105238_11774244 3300009551 Bacteria 649
132 Ga0105239_11288236 3300010375 Bacteria 843
133 Ga0157370_10332802 3300013104 Bacteria 1400
134 Ga0157369_10044810 3300013105 Bacteria 4813
135 Ga0157374_11435457 3300013296 Bacteria 713
136 Ga0163163_10177444 3300014325 Unclassified 2177
137 Ga0206356_11871563 3300020070 Bacteria 878
138 Ga0206353_10950019 3300020082 Bacteria 1593
139 Ga0213874_10057657 3300021377 Bacteria 1209
140 Ga0213876_10234974 3300021384 Bacteria 974
141 Ga0213875_10000341 3300021388 Bacteria 44027
142 Ga0213875_10012454 3300021388 Bacteria 4202
143 Ga0224712_10106871 3300022467 Bacteria 1195
144 Ga0224712_10153778 3300022467 Bacteria 1021
145 Ga0207692_10002476 3300025898 Bacteria 7090
146 Ga0207692_10016242 3300025898 Bacteria 3291
147 Ga0207692_10018339 3300025898 Bacteria 3140
148 Ga0207692_10095255 3300025898 Unclassified 1623
149 Ga0207692_10269675 3300025898 Bacteria 1026
150 Ga0207685_10010298 3300025905 Bacteria 2754
151 Ga0207699_10002431 3300025906 Bacteria 8789
152 Ga0207699_10094087 3300025906 Bacteria 1887
153 Ga0207699_10109433 3300025906 Bacteria 1768
154 Ga0207684_10004234 3300025910 Bacteria 13614
155 Ga0207684_10005262 3300025910 Bacteria 12001
156 Ga0207684_10009530 3300025910 Bacteria 8570
157 Ga0207684_10028757 3300025910 Bacteria 4735
158 Ga0207684_10183089 3300025910 Bacteria 1807
159 Ga0207684_10190081 3300025910 Bacteria 1771
160 Ga0207684_10401536 3300025910 Bacteria 1178
161 Ga0207684_10525445 3300025910 Bacteria 1013
162 Ga0207707_10023938 3300025912 Bacteria 5338
163 Ga0207695_10819211 3300025913 Unclassified 811
164 Ga0207693_10007216 3300025915 Bacteria 9145
165 Ga0207693_10060142 3300025915 Bacteria 2976
166 Ga0207693_10143188 3300025915 Unclassified 1880
167 Ga0207693_10194642 3300025915 Bacteria 1595
168 Ga0207693_10295526 3300025915 Bacteria 1269
169 Ga0207693_10334774 3300025915 Bacteria 1185
170 Ga0207693_10393444 3300025915 Unclassified 1084
171 Ga0207693_10474230 3300025915 Unclassified 977
172 Ga0207663_10023264 3300025916 Bacteria 3553
173 Ga0207663_10117727 3300025916 Bacteria 1813
174 Ga0207663_10181790 3300025916 Bacteria 1502
175 Ga0207663_10280106 3300025916 Unclassified 1238
176 Ga0207663_10737565 3300025916 Bacteria 782
177 Ga0207660_10098524 3300025917 Bacteria 2180
178 Ga0207657_10060305 3300025919 Bacteria 3256
179 Ga0207652_10012418 3300025921 Bacteria 6884
180 Ga0207646_10000300 3300025922 Bacteria 67365
181 Ga0207646_10018909 3300025922 Bacteria 6415
182 Ga0207646_10032763 3300025922 Bacteria 4701
183 Ga0207646_10043408 3300025922 Bacteria 4038
184 Ga0207646_10112796 3300025922 Bacteria 2440
185 Ga0207700_10001611 3300025928 Bacteria 12816
186 Ga0207700_10145577 3300025928 Bacteria 1952
187 Ga0207700_10158838 3300025928 Unclassified 1876
188 Ga0207700_10263348 3300025928 Unclassified 1477
189 Ga0207700_10415159 3300025928 Bacteria 1181
190 Ga0207664_10001224 3300025929 Bacteria 16988
191 Ga0207664_10045114 3300025929 Bacteria 3455
192 Ga0207664_10061451 3300025929 Bacteria 2997
193 Ga0207664_10089616 3300025929 Bacteria 2519
194 Ga0207664_10101240 3300025929 Bacteria 2380
195 Ga0207664_10111066 3300025929 Bacteria 2280
196 Ga0207664_10354612 3300025929 Bacteria 1299
197 Ga0207664_10595706 3300025929 Unclassified 993
198 Ga0207664_11007374 3300025929 Unclassified 746
199 Ga0207644_10241393 3300025931 Bacteria 1439
200 Ga0207665_10003655 3300025939 Bacteria 10268
201 Ga0207665_10021630 3300025939 Bacteria 4231
202 Ga0207665_10044621 3300025939 Unclassified 2966
203 Ga0207665_10175788 3300025939 Bacteria 1548
204 Ga0207665_11063509 3300025939 Bacteria 645
205 Ga0207661_10004104 3300025944 Bacteria 10180
206 Ga0207678_10242214 3300026067 Bacteria 1544
207 Ga0207702_11117593 3300026078 Unclassified 782
208 Ga0207676_11681283 3300026095 Bacteria 633
209 Ga0268264_10208845 3300028381 Bacteria 1791
210 Ga0307515_10157993 3300028794 Bacteria 2329
211 Ga0265764_101661 3300030882 Bacteria 1015
212 Ga0265760_10022173 3300031090 Bacteria 1840
213 Ga0265760_10138555 3300031090 Bacteria 791
214 Ga0307513_10000274 3300031456 Bacteria 74965
215 Ga0373926_0000242 3300035083 Bacteria 13057
216 Ga0373926_0023592 3300035083 Unclassified 2137
217 Ga0373934_0000007 3300035086 Bacteria 74186
218 Ga0373934_0002646 3300035086 Bacteria 6580
219 Ga0373934_0016239 3300035086 Bacteria 2830
220 Ga0373934_0024617 3300035086 Archaea 2327
221 Ga0373934_0098058 3300035086 Bacteria 1184
222 Ga0373934_0190120 3300035086 Bacteria 844
223 Ga0373944_0000017 3300035089 Bacteria 31097
224 Ga0373944_0023274 3300035089 Unclassified 1806
225 Ga0373923_0006819 3300035111 Bacteria 3972
226 Ga0373923_0040119 3300035111 Bacteria 1925
227 Ga0373936_0000069 3300035113 Bacteria 43349
228 Ga0373936_0127722 3300035113 Unclassified 1090
229 Ga0373936_0167173 3300035113 Bacteria 960
230 Ga0373936_0379035 3300035113 Unclassified 647
231 Ga0373945_0001579 3300035116 Bacteria 6980
232 Ga0373945_0001997 3300035116 Bacteria 6338
233 Ga0373945_0287707 3300035116 Bacteria 701
234 Ga0373953_0000044 3300035117 Bacteria 32505
235 Ga0373953_0326791 3300035117 Unclassified 671
236 Ga0373954_0001638 3300035118 Bacteria 9159
237 Ga0373954_0004338 3300035118 Bacteria 6098
238 Ga0373954_0025510 3300035118 Bacteria 2703
239 Ga0373954_0029269 3300035118 Bacteria 2536
240 Ga0373954_0050414 3300035118 Unclassified 1953
241 Ga0373954_0096050 3300035118 Bacteria 1427
242 Ga0373956_0002023 3300035119 Bacteria 8400
243 Ga0373956_0005299 3300035119 Bacteria 5163
244 Ga0373956_0023463 3300035119 Unclassified 2648
245 Ga0373956_0026900 3300035119 Unclassified 2494
246 Ga0373956_0198401 3300035119 Unclassified 951
247 Ga0373957_0000107 3300035120 Bacteria 20022
248 Ga0373957_0033018 3300035120 Bacteria 1910
249 Ga0373957_0038358 3300035120 Unclassified 1794
250 Ga0373957_0288584 3300035120 Bacteria 694
251 Ga0373957_0383505 3300035120 Bacteria 603
252 Ga0373943_0000750 3300035170 Bacteria 14141
253 Ga0373943_0004717 3300035170 Bacteria 6165
254 Ga0373943_0186450 3300035170 Bacteria 1143
255 Ga0373946_0005151 3300035171 Bacteria 4710
256 Ga0373955_0000014 3300035172 Bacteria 72349
257 Ga0373955_0001846 3300035172 Bacteria 9119
258 Ga0373955_0023067 3300035172 Unclassified 3166
259 Ga0373955_0025120 3300035172 Bacteria 3056
260 Ga0373955_0059036 3300035172 Bacteria 2111
261 Ga0373955_0071408 3300035172 Bacteria 1942
262 Ga0373955_0292175 3300035172 Unclassified 982
263 Ga0373955_0301831 3300035172 Bacteria 966
264 Ga0373924_0000098 3300035410 Bacteria 24338
265 Ga0373924_0013508 3300035410 Bacteria 3070
266 Ga0373924_0083426 3300035410 Bacteria 1361
267 Ga0373924_0085086 3300035410 Bacteria 1348
268 Ga0373935_0003214 3300035692 Bacteria 9432
269 Ga0373935_0021855 3300035692 Bacteria 3917
270 Ga0373935_0127796 3300035692 Bacteria 1704
271 Ga0373935_0715898 3300035692 Bacteria 736
272 Ga0373927_0000730 3300035695 Bacteria 25171
273 Ga0373927_0010591 3300035695 Bacteria 6145
274 Ga0373933_0000021 3300035724 Bacteria 96820
275 Ga0373933_0007286 3300035724 Bacteria 6032
276 Ga0373933_0032580 3300035724 Bacteria 3029
277 Ga0373933_0106570 3300035724 Unclassified 1744
278 Ga0373933_0295248 3300035724 Bacteria 1048
279 Ga0373947_0000137 3300035725 Bacteria 37905
280 Ga0373947_0002382 3300035725 Bacteria 11354
281 Ga0373937_0000032 3300036401 Bacteria 120148
282 Ga0373937_0010592 3300036401 Bacteria 8056
283 Ga0373937_0019226 3300036401 Bacteria 6115
284 Ga0373937_0026045 3300036401 Bacteria 5283
285 Ga0373937_0039634 3300036401 Bacteria 4293
286 Ga0373937_0118793 3300036401 Bacteria 2463
287 Ga0373937_0153799 3300036401 Unclassified 2155
288 Ga0373937_0481086 3300036401 Bacteria 1179
289 Ga0373937_0792385 3300036401 Unclassified 895
290 Ga0373937_0811414 3300036401 Bacteria 884
291 Ga0372808_006096 3300036459 Bacteria 1615
292 Ga0372808_018921 3300036459 Bacteria 990
293 Ga0373925_0002005 3300037068 Bacteria 16874
294 Ga0373925_0030808 3300037068 Bacteria 3938
295 Ga0373925_0138926 3300037068 Unclassified 1900
296 Ga0373925_0386991 3300037068 Unclassified 1139
297 Ga0373925_0581037 3300037068 Bacteria 922
298 Ga0373925_0846557 3300037068 Unclassified 754
299 Ga0436364_0201210 3300037853 Bacteria 60188
300 Ga0436364_0292123 3300037853 Bacteria 1083
301 Ga0436364_0589799 3300037853 Bacteria 5912
302 Ga0436364_0750468 3300037853 Bacteria 3836
303 Ga0436364_0985441 3300037853 Bacteria 4019
304 Ga0436364_1552281 3300037853 Unclassified 862
305 Ga0436365_1001548 3300039437 Bacteria 1589
306 Ga0436360_0908826 3300039438 Unclassified 652
307 Ga0436360_1131745 3300039438 Unclassified 1219
308 Ga0436361_0210589 3300039447 Bacteria 755
309 Ga0436363_0551126 3300039450 Bacteria 3448
310 Ga0436363_1044715 3300039450 Unclassified 946
311 Ga0436363_1423380 3300039450 Bacteria 691
312 Ga0436362_0731252 3300039453 Unclassified 524
313 Ga0436362_0861895 3300039453 Bacteria 562
314 Ga0466963_0359092 3300044694 Bacteria 1026
315 Ga0466963_0363710 3300044694 Unclassified 1019
316 Ga0466957_0293799 3300044842 Bacteria 1090
317 Ga0466967_0028766 3300045976 Bacteria 4644
318 Ga0495592_0000079 3300046454 Bacteria 85581
319 Ga0495592_0000747 3300046454 Bacteria 22677
320 Ga0495592_0030619 3300046454 Bacteria 4070
321 Ga0495603_0004021 3300046455 Bacteria 8752
322 Ga0495629_0000857 3300046459 Bacteria 24550
323 Ga0495629_0678153 3300046459 Unclassified 685
324 Ga0495641_0001295 3300046461 Bacteria 21404
325 Ga0495641_0144229 3300046461 Bacteria 1064
326 Ga0495641_0167353 3300046461 Bacteria 983
327 Ga0495651_0000010 3300046462 Bacteria 148763
328 Ga0495651_0000862 3300046462 Bacteria 23521
329 Ga0495651_0003512 3300046462 Bacteria 12019
330 Ga0495651_0014825 3300046462 Bacteria 6027
331 Ga0495651_0049560 3300046462 Archaea 3241
332 Ga0495651_0060240 3300046462 Bacteria 2908
333 Ga0495651_0131961 3300046462 Bacteria 1822
334 Ga0495651_0196500 3300046462 Unclassified 1415
335 Ga0495653_0000601 3300046463 Bacteria 27606
336 Ga0495653_0014901 3300046463 Bacteria 6341
337 Ga0495653_0017905 3300046463 Bacteria 5759
338 Ga0495653_0046502 3300046463 Bacteria 3360
339 Ga0495653_0068539 3300046463 Unclassified 2661
340 Ga0495653_0097659 3300046463 Bacteria 2134
341 Ga0495653_0203187 3300046463 Unclassified 1343
342 Ga0495653_0229971 3300046463 Bacteria 1241
343 Ga0495580_0007482 3300046472 Bacteria 8777
344 Ga0495582_0000695 3300046473 Bacteria 18556
345 Ga0495582_0094058 3300046473 Unclassified 1673
346 Ga0495639_0000428 3300046475 Bacteria 20047
347 Ga0495639_0180975 3300046475 Unclassified 1026
348 Ga0495662_0000091 3300046476 Bacteria 32440
349 Ga0495662_0157307 3300046476 Unclassified 1119
350 Ga0495664_0001249 3300046477 Bacteria 13296
351 Ga0495664_0002533 3300046477 Bacteria 9818
352 Ga0495664_0059540 3300046477 Bacteria 2273
353 Ga0495664_0219430 3300046477 Bacteria 1151
354 Ga0495594_0045165 3300046499 Bacteria 2418
355 Ga0495608_0000037 3300046511 Bacteria 125064
356 Ga0495608_0003237 3300046511 Bacteria 11648
357 Ga0495608_0007402 3300046511 Bacteria 7751
358 Ga0495608_0048116 3300046511 Archaea 2834
359 Ga0495608_0171573 3300046511 Bacteria 1375
360 Ga0495608_0181667 3300046511 Bacteria 1330
361 Ga0495608_0383978 3300046511 Unclassified 861
362 Ga0495608_0820107 3300046511 Unclassified 548
363 Ga0495618_0006797 3300046514 Bacteria 6929
364 Ga0495618_0121307 3300046514 Bacteria 1674
365 Ga0495628_0007686 3300046516 Bacteria 9320
366 Ga0495628_0011294 3300046516 Bacteria 7554
367 Ga0495628_0020977 3300046516 Bacteria 5381
368 Ga0495628_0148664 3300046516 Bacteria 1785
369 Ga0495628_0208666 3300046516 Unclassified 1470
370 Ga0495628_0644187 3300046516 Bacteria 753
371 Ga0495628_0915139 3300046516 Unclassified 608
372 Ga0495630_0136967 3300046517 Unclassified 1860
373 Ga0495630_0441792 3300046517 Bacteria 997
374 Ga0495666_0000513 3300046526 Bacteria 17220
375 Ga0495652_0000180 3300046529 Bacteria 71646
376 Ga0495652_0005563 3300046529 Bacteria 11851
377 Ga0495652_0038457 3300046529 Bacteria 4145
378 Ga0495652_0055594 3300046529 Bacteria 3365
379 Ga0495652_0130814 3300046529 Bacteria 1987
380 Ga0495652_0132383 3300046529 Bacteria 1972
381 Ga0495652_0163466 3300046529 Bacteria 1725
382 Ga0495665_0000106 3300046531 Bacteria 39298
383 Ga0495665_0109472 3300046531 Unclassified 1449
384 Ga0495640_0003664 3300046533 Bacteria 12349
385 Ga0495640_0167267 3300046533 Bacteria 1406
386 Ga0495640_0314015 3300046533 Bacteria 971
387 Ga0495640_0657248 3300046533 Bacteria 630
388 Ga0495586_0008143 3300046535 Bacteria 5586
389 Ga0495586_0016296 3300046535 Bacteria 3952
390 Ga0495587_0000024 3300046536 Bacteria 148753
391 Ga0495587_0008385 3300046536 Bacteria 6650
392 Ga0495587_0019370 3300046536 Unclassified 4212
393 Ga0495587_0048769 3300046536 Bacteria 2508
394 Ga0495587_0115810 3300046536 Bacteria 1537
395 Ga0495587_0721046 3300046536 Unclassified 546
396 Ga0495645_0002631 3300046543 Bacteria 12213
397 Ga0495645_0023105 3300046543 Bacteria 4502
398 Ga0495645_0061278 3300046543 Bacteria 2726
399 Ga0495645_0094423 3300046543 Bacteria 2133
400 Ga0495645_0312032 3300046543 Bacteria 1024
401 Ga0495645_0592900 3300046543 Bacteria 682
402 Ga0495645_0649393 3300046543 Unclassified 645
403 Ga0495667_0000024 3300046559 Bacteria 168313
404 Ga0495667_0000532 3300046559 Bacteria 24365
405 Ga0495667_0004365 3300046559 Bacteria 9548
406 Ga0495667_0006941 3300046559 Bacteria 7678
407 Ga0495667_0018953 3300046559 Bacteria 4644
408 Ga0495667_0069448 3300046559 Bacteria 2299
409 Ga0495667_0308162 3300046559 Bacteria 1003
410 Ga0495667_0581322 3300046559 Unclassified 698
411 Ga0495634_0005989 3300046642 Bacteria 9288
412 Ga0495634_0014270 3300046642 Bacteria 5733
413 Ga0495634_0274475 3300046642 Bacteria 1025
414 Ga0495635_0002293 3300046663 Bacteria 13011
415 Ga0495635_0013653 3300046663 Bacteria 5686
416 Ga0495635_0015033 3300046663 Bacteria 5414
417 Ga0495635_0030159 3300046663 Bacteria 3769
418 Ga0495635_0067972 3300046663 Archaea 2444
419 Ga0495635_0072147 3300046663 Bacteria 2366
420 Ga0495635_0077916 3300046663 Bacteria 2270
421 Ga0495657_0000057 3300046675 Bacteria 98920
422 Ga0495657_0009020 3300046675 Bacteria 7585
423 Ga0495657_0010706 3300046675 Bacteria 6894
424 Ga0495657_0011111 3300046675 Bacteria 6747
425 Ga0495657_0016341 3300046675 Bacteria 5408
426 Ga0495657_0025680 3300046675 Bacteria 4180
427 Ga0495657_0036884 3300046675 Bacteria 3374
428 Ga0495657_0095907 3300046675 Unclassified 1895
429 Ga0495599_0000362 3300046678 Bacteria 26767
430 Ga0495599_0001181 3300046678 Bacteria 14819
431 Ga0495599_0017743 3300046678 Unclassified 4429
432 Ga0495599_0051001 3300046678 Bacteria 2593
433 Ga0495599_0141905 3300046678 Unclassified 1490
434 Ga0495599_0211512 3300046678 Bacteria 1189
435 Ga0495623_0001051 3300046679 Bacteria 18658
436 Ga0495623_0036378 3300046679 Bacteria 3154
437 Ga0495623_0343695 3300046679 Bacteria 814
438 Ga0495646_0005010 3300046680 Bacteria 8349
439 Ga0495646_0054291 3300046680 Bacteria 2411
440 Ga0495646_0111217 3300046680 Bacteria 1559
441 Ga0495646_0260505 3300046680 Bacteria 926
442 Ga0495646_0280877 3300046680 Unclassified 885
443 Ga0495646_0322524 3300046680 Bacteria 813
444 Ga0495646_0469260 3300046680 Bacteria 648
445 Ga0495647_0010483 3300046681 Bacteria 3157
446 Ga0495647_0115145 3300046681 Unclassified 1126
447 Ga0495658_0003066 3300046683 Bacteria 8357
448 Ga0495658_0846163 3300046683 Bacteria 585
449 Ga0495613_0014526 3300046689 Bacteria 5842
450 Ga0495624_0000640 3300046690 Bacteria 27384
451 Ga0495624_0009120 3300046690 Bacteria 6880
452 Ga0495624_0305388 3300046690 Bacteria 959
453 Ga0495624_0516637 3300046690 Unclassified 714
454 Ga0495624_0551266 3300046690 Unclassified 688
455 Ga0495600_0000907 3300046809 Bacteria 15888
456 Ga0495600_0012043 3300046809 Bacteria 5402
457 Ga0495600_0025829 3300046809 Bacteria 3786
458 Ga0495600_0027000 3300046809 Bacteria 3709
459 Ga0495600_0183198 3300046809 Unclassified 1349
460 Ga0495581_0000217 3300047315 Bacteria 27029
461 Ga0495581_0151491 3300047315 Bacteria 1354
462 Ga0495604_0000024 3300047317 Bacteria 148542
463 Ga0495604_0010270 3300047317 Bacteria 7416
464 Ga0495604_0028458 3300047317 Unclassified 4446
465 Ga0495604_0860122 3300047317 Bacteria 568
466 Ga0495674_0017491 3300047319 Bacteria 6671
467 Ga0495674_0033399 3300047319 Bacteria 4661
468 Ga0495674_0059323 3300047319 Bacteria 3342
469 Ga0495674_0085195 3300047319 Unclassified 2707
470 Ga0495674_0332639 3300047319 Bacteria 1235
471 Ga0495674_0357762 3300047319 Unclassified 1184
472 Ga0495676_0020811 3300047321 Bacteria 5747
473 Ga0495676_0042486 3300047321 Bacteria 3731
474 Ga0495680_0000005 3300047322 Bacteria 168308
475 Ga0495680_0005616 3300047322 Bacteria 11755
476 Ga0495680_0006369 3300047322 Bacteria 10985
477 Ga0495680_0012416 3300047322 Bacteria 7496
478 Ga0495680_0020852 3300047322 Bacteria 5499
479 Ga0495680_0065413 3300047322 Bacteria 2784
480 Ga0495680_0089074 3300047322 Unclassified 2317
481 Ga0495680_0430201 3300047322 Unclassified 906
482 Ga0495680_0640491 3300047322 Bacteria 707
483 Ga0495680_0646066 3300047322 Bacteria 703
484 Ga0495680_0767339 3300047322 Bacteria 632
485 Ga0495675_0001438 3300047444 Bacteria 14415
486 Ga0495675_0003093 3300047444 Bacteria 10000
487 Ga0495675_0095923 3300047444 Bacteria 1859
488 Ga0495675_0170085 3300047444 Unclassified 1339
489 Ga0495684_0006376 3300047471 Bacteria 9161
490 Ga0495684_0009729 3300047471 Bacteria 7417
491 Ga0495684_0014679 3300047471 Bacteria 6027
492 Ga0495684_0021290 3300047471 Bacteria 4995
493 Ga0495684_0030070 3300047471 Bacteria 4170
494 Ga0495684_0096587 3300047471 Archaea 2236
495 Ga0495593_0003735 3300047673 Bacteria 9082
496 Ga0495593_0112451 3300047673 Unclassified 1390
497 Ga0495602_0000198 3300048088 Bacteria 56006
498 Ga0495602_0011452 3300048088 Bacteria 9169
499 Ga0495602_0015318 3300048088 Bacteria 7745
500 Ga0495602_0036095 3300048088 Bacteria 4604
501 Ga0495602_0043823 3300048088 Bacteria 4063
502 Ga0495602_0059060 3300048088 Bacteria 3351
503 Ga0495602_0144726 3300048088 Bacteria 1877
504 Ga0495602_0156490 3300048088 Unclassified 1784
505 Ga0495602_0290096 3300048088 Bacteria 1201
506 Ga0495602_0949275 3300048088 Unclassified 570
507 Ga0495614_0005230 3300048089 Bacteria 5856
508 Ga0495614_0095587 3300048089 Unclassified 1295
509 Ga0496102_0316276 3300048905 Bacteria 1471
510 Ga0496104_0437814 3300048907 Bacteria 1219
511 Ga0496108_0128537 3300048911 Bacteria 2177
512 Ga0496109_0369567 3300048912 Bacteria 1355
513 Ga0496112_0659301 3300048915 Bacteria 976
514 Ga0496113_0393260 3300048916 Bacteria 1113
515 Ga0496115_0046116 3300048918 Bacteria 3482
516 Ga0496115_0605544 3300048918 Unclassified 871
517 Ga0496126_0118620 3300048929 Bacteria 2297
518 nmdc:mga06z11_744256_c1 3300050494 Unclassified 597
519 nmdc:mga05p37_1765_c2 3300050507 Bacteria 19708
520 nmdc:mga06r32_1059668_c1 3300050510 Bacteria 761
521 nmdc:mga08y16_796861_c1 3300050511 Bacteria 938
522 nmdc:mga0n895_1262929_c1 3300050512 Bacteria 711
523 nmdc:mga0rr50_1391934_c1 3300050513 Unclassified 594
524 nmdc:mga0rr50_521909_c1 3300050513 Bacteria 1011
525 nmdc:mga08x19_347553_c1 3300050514 Bacteria 1035
526 nmdc:mga08x19_361414_c1 3300050514 Bacteria 1015
527 Ga0495601_0003051 3300053077 Bacteria 9548
528 Ga0495601_0139479 3300053077 Bacteria 1581
529 Ga0495601_0153424 3300053077 Bacteria 1504
530 Ga0495601_0347017 3300053077 Bacteria 965
531 Ga0495612_0003724 3300053078 Bacteria 6334
532 Ga0495612_0066563 3300053078 Bacteria 1498
533 Ga0495612_0308443 3300053078 Bacteria 710
534 Ga0495595_0000633 3300053084 Bacteria 13387
535 Ga0495595_0004296 3300053084 Bacteria 5731
536 Ga0495619_0002574 3300053085 Bacteria 11856
537 Ga0495619_0236803 3300053085 Bacteria 1265
538 Ga0495619_0275895 3300053085 Bacteria 1165
539 Ga0495619_0575603 3300053085 Bacteria 771
540 Ga0587073_0028441 3300059492 Unclassified 1135
541 Ga0587077_020635 3300059493 Bacteria 1160
542 Ga0587082_015795 3300059504 Bacteria 1170
543 Ga0587069_008346 3300059642 Unclassified 1307
544 Ga0587079_020642 3300059647 Bacteria 1177
545 Ga0587105_011324 3300059651 Bacteria 686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300022467 Ga0224712_10106871 Ga0224712_101068711 124
2 3300005434 Ga0070709_10495583 Ga0070709_104955832 129
3 3300005435 Ga0070714_100025226 Ga0070714_1000252261 129
4 3300005436 Ga0070713_100021529 Ga0070713_1000215292 129
5 3300005439 Ga0070711_100092359 Ga0070711_1000923592 129
6 3300006028 Ga0070717_10667380 Ga0070717_106673802 129
7 3300006175 Ga0070712_100246673 Ga0070712_1002466732 129
8 3300006358 Ga0068871_100123533 Ga0068871_1001235333 129
9 3300025915 Ga0207693_10194642 Ga0207693_101946422 129
10 3300005437 Ga0070710_10061962 Ga0070710_100619622 130
11 3300005614 Ga0068856_100813581 Ga0068856_1008135812 130
12 3300025898 Ga0207692_10095255 Ga0207692_100952552 130
13 3300025916 Ga0207663_10117727 Ga0207663_101177272 130
14 3300025939 Ga0207665_11063509 Ga0207665_110635091 130
15 3300026078 Ga0207702_11117593 Ga0207702_111175932 130
16 3300048907 Ga0496104_0437814 Ga0496104_0437814_744_1145 133
17 3300048915 Ga0496112_0659301 Ga0496112_0659301_521_922 133
18 3300048916 Ga0496113_0393260 Ga0496113_0393260_567_968 133
19 3300050514 nmdc:mga08x19_347553_c1 nmdc:mga08x19_347553_c1_244_645 133
20 3300035120 Ga0373957_0288584 Ga0373957_0288584_26_433 134
21 3300021377 Ga0213874_10057657 Ga0213874_100576572 136
22 3300039450 Ga0436363_0551126 Ga0436363_0551126_557_1012 136
23 3300046463 Ga0495653_0097659 Ga0495653_0097659_1457_1873 138
24 3300046516 Ga0495628_0644187 Ga0495628_0644187_68_484 138
25 3300046533 Ga0495640_0657248 Ga0495640_0657248_138_554 138
26 3300046543 Ga0495645_0649393 Ga0495645_0649393_94_510 138
27 3300046559 Ga0495667_0069448 Ga0495667_0069448_535_951 138
28 3300046680 Ga0495646_0280877 Ga0495646_0280877_151_567 138
29 3300046680 Ga0495646_0469260 Ga0495646_0469260_134_550 138
30 3300046690 Ga0495624_0305388 Ga0495624_0305388_147_563 138
31 3300047319 Ga0495674_0059323 Ga0495674_0059323_1711_2127 138
32 3300047319 Ga0495674_0332639 Ga0495674_0332639_755_1171 138
33 3300047322 Ga0495680_0640491 Ga0495680_0640491_237_653 138
34 3300050513 nmdc:mga0rr50_1391934_c1 nmdc:mga0rr50_1391934_c1_43_459 138
35 3300005937 Ga0081455_10033317 Ga0081455_100333177 140
36 3300035172 Ga0373955_0025120 Ga0373955_0025120_2322_2747 141
37 3300046517 Ga0495630_0441792 Ga0495630_0441792_225_650 141
38 3300046543 Ga0495645_0592900 Ga0495645_0592900_17_442 141
39 3300039438 Ga0436360_1131745 Ga0436360_1131745_335_787 142
40 3300005435 Ga0070714_100016814 Ga0070714_1000168143 143
41 3300005436 Ga0070713_100627372 Ga0070713_1006273722 143
42 3300005445 Ga0070708_100170265 Ga0070708_1001702652 143
43 3300005468 Ga0070707_100035663 Ga0070707_1000356632 143
44 3300005518 Ga0070699_100626130 Ga0070699_1006261302 143
45 3300005536 Ga0070697_100152403 Ga0070697_1001524032 143
46 3300006028 Ga0070717_10029484 Ga0070717_100294842 143
47 3300006175 Ga0070712_100021734 Ga0070712_1000217344 143
48 3300025915 Ga0207693_10393444 Ga0207693_103934442 143
49 3300025922 Ga0207646_10112796 Ga0207646_101127962 143
50 3300025928 Ga0207700_10415159 Ga0207700_104151591 143
51 3300025929 Ga0207664_10045114 Ga0207664_100451143 143
52 3300005437 Ga0070710_10109028 Ga0070710_101090283 144
53 3300005719 Ga0068861_100466743 Ga0068861_1004667432 144
54 3300025898 Ga0207692_10269675 Ga0207692_102696751 144
55 3300005435 Ga0070714_100637689 Ga0070714_1006376892 147
56 3300006028 Ga0070717_10155379 Ga0070717_101553792 147
57 3300006175 Ga0070712_100915913 Ga0070712_1009159132 147
58 3300031090 Ga0265760_10138555 Ga0265760_101385551 147
59 iso_pu_bacteria 2816332119 2816420784 147
60 3300005467 Ga0070706_100009069 Ga0070706_1000090696 148
61 3300021388 Ga0213875_10000341 Ga0213875_1000034134 148
62 3300025910 Ga0207684_10028757 Ga0207684_100287574 148
63 3300025915 Ga0207693_10334774 Ga0207693_103347742 148
64 3300037853 Ga0436364_0201210 Ga0436364_0201210_9651_10097 148
65 3300039437 Ga0436365_1001548 Ga0436365_1001548_685_1131 148
66 3300039438 Ga0436360_0908826 Ga0436360_0908826_116_562 148
67 3300004799 Ga0058863_11779226 Ga0058863_117792261 150
68 3300005336 Ga0070680_100704430 Ga0070680_1007044302 150
69 3300005355 Ga0070671_100255816 Ga0070671_1002558161 150
70 3300005437 Ga0070710_11155570 Ga0070710_111555701 150
71 3300005440 Ga0070705_100028852 Ga0070705_1000288523 150
72 3300005618 Ga0068864_100369049 Ga0068864_1003690491 150
73 3300005841 Ga0068863_100411672 Ga0068863_1004116722 150
74 3300006028 Ga0070717_10188882 Ga0070717_101888822 150
75 3300006163 Ga0070715_10084508 Ga0070715_100845083 150
76 3300006173 Ga0070716_100006271 Ga0070716_1000062712 150
77 3300006175 Ga0070712_101100878 Ga0070712_1011008781 150
78 3300006358 Ga0068871_100271415 Ga0068871_1002714152 150
79 3300006871 Ga0075434_100747531 Ga0075434_1007475311 150
80 3300007076 Ga0075435_100729088 Ga0075435_1007290882 150
81 3300009148 Ga0105243_12864934 Ga0105243_128649341 150
82 3300013296 Ga0157374_11435457 Ga0157374_114354571 150
83 3300014325 Ga0163163_10177444 Ga0163163_101774443 150
84 3300022467 Ga0224712_10153778 Ga0224712_101537781 150
85 3300025898 Ga0207692_10016242 Ga0207692_100162422 150
86 3300025906 Ga0207699_10109433 Ga0207699_101094332 150
87 3300025915 Ga0207693_10143188 Ga0207693_101431883 150
88 3300025916 Ga0207663_10280106 Ga0207663_102801063 150
89 3300025928 Ga0207700_10263348 Ga0207700_102633482 150
90 3300025929 Ga0207664_10089616 Ga0207664_100896162 150
91 3300025929 Ga0207664_10101240 Ga0207664_101012402 150
92 3300025931 Ga0207644_10241393 Ga0207644_102413932 150
93 3300025939 Ga0207665_10044621 Ga0207665_100446212 150
94 3300026095 Ga0207676_11681283 Ga0207676_116812831 150
95 3300035083 Ga0373926_0000242 Ga0373926_0000242_3478_3978 150
96 3300035083 Ga0373926_0023592 Ga0373926_0023592_919_1392 150
97 3300035086 Ga0373934_0002646 Ga0373934_0002646_5974_6474 150
98 3300035086 Ga0373934_0024617 Ga0373934_0024617_859_1320 150
99 3300035089 Ga0373944_0000017 Ga0373944_0000017_3923_4423 150
100 3300035089 Ga0373944_0023274 Ga0373944_0023274_868_1341 150
101 3300035111 Ga0373923_0006819 Ga0373923_0006819_121_621 150
102 3300035113 Ga0373936_0000069 Ga0373936_0000069_17429_17929 150
103 3300035113 Ga0373936_0127722 Ga0373936_0127722_508_981 150
104 3300035116 Ga0373945_0001579 Ga0373945_0001579_4783_5283 150
105 3300035116 Ga0373945_0001997 Ga0373945_0001997_4609_5082 150
106 3300035116 Ga0373945_0287707 Ga0373945_0287707_56_520 150
107 3300035118 Ga0373954_0001638 Ga0373954_0001638_5108_5608 150
108 3300035118 Ga0373954_0050414 Ga0373954_0050414_528_989 150
109 3300035119 Ga0373956_0005299 Ga0373956_0005299_3397_3897 150
110 3300035119 Ga0373956_0023463 Ga0373956_0023463_1046_1507 150
111 3300035120 Ga0373957_0383505 Ga0373957_0383505_13_486 150
112 3300035170 Ga0373943_0000750 Ga0373943_0000750_4769_5269 150
113 3300035170 Ga0373943_0004717 Ga0373943_0004717_2523_2996 150
114 3300035171 Ga0373946_0005151 Ga0373946_0005151_4212_4685 150
115 3300035172 Ga0373955_0001846 Ga0373955_0001846_7617_8117 150
116 3300035172 Ga0373955_0023067 Ga0373955_0023067_1803_2264 150
117 3300035172 Ga0373955_0292175 Ga0373955_0292175_30_503 150
118 3300035410 Ga0373924_0085086 Ga0373924_0085086_166_627 150
119 3300035692 Ga0373935_0003214 Ga0373935_0003214_3952_4452 150
120 3300035692 Ga0373935_0021855 Ga0373935_0021855_794_1267 150
121 3300035695 Ga0373927_0000730 Ga0373927_0000730_24565_25065 150
122 3300035695 Ga0373927_0010591 Ga0373927_0010591_3023_3496 150
123 3300035724 Ga0373933_0007286 Ga0373933_0007286_3518_3979 150
124 3300035725 Ga0373947_0000137 Ga0373947_0000137_32701_33174 150
125 3300035725 Ga0373947_0002382 Ga0373947_0002382_4881_5381 150
126 3300036401 Ga0373937_0010592 Ga0373937_0010592_4333_4794 150
127 3300036401 Ga0373937_0026045 Ga0373937_0026045_3074_3574 150
128 3300036401 Ga0373937_0792385 Ga0373937_0792385_375_848 150
129 3300037068 Ga0373925_0002005 Ga0373925_0002005_2630_3130 150
130 3300037068 Ga0373925_0030808 Ga0373925_0030808_3200_3673 150
131 3300037853 Ga0436364_0985441 Ga0436364_0985441_686_1138 150
132 3300039447 Ga0436361_0210589 Ga0436361_0210589_32_484 150
133 3300039450 Ga0436363_1044715 Ga0436363_1044715_389_841 150
134 3300039450 Ga0436363_1423380 Ga0436363_1423380_185_637 150
135 3300044694 Ga0466963_0359092 Ga0466963_0359092_374_847 150
136 3300044694 Ga0466963_0363710 Ga0466963_0363710_403_855 150
137 3300044842 Ga0466957_0293799 Ga0466957_0293799_49_522 150
138 3300045976 Ga0466967_0028766 Ga0466967_0028766_2674_3147 150
139 3300046454 Ga0495592_0000747 Ga0495592_0000747_11781_12281 150
140 3300046455 Ga0495603_0004021 Ga0495603_0004021_1212_1712 150
141 3300046459 Ga0495629_0000857 Ga0495629_0000857_17775_18275 150
142 3300046461 Ga0495641_0001295 Ga0495641_0001295_11606_12106 150
143 3300046461 Ga0495641_0167353 Ga0495641_0167353_416_889 150
144 3300046462 Ga0495651_0003512 Ga0495651_0003512_8168_8668 150
145 3300046462 Ga0495651_0049560 Ga0495651_0049560_1176_1637 150
146 3300046462 Ga0495651_0196500 Ga0495651_0196500_641_1114 150
147 3300046463 Ga0495653_0014901 Ga0495653_0014901_508_981 150
148 3300046463 Ga0495653_0068539 Ga0495653_0068539_1609_2070 150
149 3300046472 Ga0495580_0007482 Ga0495580_0007482_4990_5490 150
150 3300046473 Ga0495582_0000695 Ga0495582_0000695_6276_6776 150
151 3300046473 Ga0495582_0094058 Ga0495582_0094058_498_971 150
152 3300046475 Ga0495639_0000428 Ga0495639_0000428_8038_8538 150
153 3300046475 Ga0495639_0180975 Ga0495639_0180975_519_992 150
154 3300046476 Ga0495662_0000091 Ga0495662_0000091_30938_31438 150
155 3300046476 Ga0495662_0157307 Ga0495662_0157307_222_695 150
156 3300046477 Ga0495664_0001249 Ga0495664_0001249_5103_5603 150
157 3300046477 Ga0495664_0002533 Ga0495664_0002533_5230_5703 150
158 3300046499 Ga0495594_0045165 Ga0495594_0045165_916_1416 150
159 3300046511 Ga0495608_0007402 Ga0495608_0007402_304_804 150
160 3300046511 Ga0495608_0048116 Ga0495608_0048116_1406_1867 150
161 3300046514 Ga0495618_0006797 Ga0495618_0006797_842_1342 150
162 3300046516 Ga0495628_0011294 Ga0495628_0011294_107_607 150
163 3300046517 Ga0495630_0136967 Ga0495630_0136967_639_1112 150
164 3300046526 Ga0495666_0000513 Ga0495666_0000513_16515_17015 150
165 3300046529 Ga0495652_0005563 Ga0495652_0005563_1831_2331 150
166 3300046529 Ga0495652_0038457 Ga0495652_0038457_1866_2339 150
167 3300046529 Ga0495652_0130814 Ga0495652_0130814_325_786 150
168 3300046531 Ga0495665_0000106 Ga0495665_0000106_28385_28885 150
169 3300046531 Ga0495665_0109472 Ga0495665_0109472_810_1283 150
170 3300046533 Ga0495640_0003664 Ga0495640_0003664_2329_2829 150
171 3300046535 Ga0495586_0008143 Ga0495586_0008143_304_804 150
172 3300046535 Ga0495586_0016296 Ga0495586_0016296_172_633 150
173 3300046536 Ga0495587_0008385 Ga0495587_0008385_2026_2526 150
174 3300046536 Ga0495587_0019370 Ga0495587_0019370_3356_3817 150
175 3300046543 Ga0495645_0002631 Ga0495645_0002631_9855_10355 150
176 3300046543 Ga0495645_0094423 Ga0495645_0094423_149_613 150
177 3300046559 Ga0495667_0004365 Ga0495667_0004365_8873_9373 150
178 3300046559 Ga0495667_0006941 Ga0495667_0006941_875_1336 150
179 3300046642 Ga0495634_0005989 Ga0495634_0005989_108_608 150
180 3300046642 Ga0495634_0014270 Ga0495634_0014270_1132_1605 150
181 3300046663 Ga0495635_0002293 Ga0495635_0002293_508_981 150
182 3300046663 Ga0495635_0015033 Ga0495635_0015033_4807_5307 150
183 3300046663 Ga0495635_0067972 Ga0495635_0067972_34_495 150
184 3300046675 Ga0495657_0010706 Ga0495657_0010706_5392_5892 150
185 3300046675 Ga0495657_0016341 Ga0495657_0016341_2308_2769 150
186 3300046675 Ga0495657_0036884 Ga0495657_0036884_2556_3017 150
187 3300046675 Ga0495657_0095907 Ga0495657_0095907_492_965 150
188 3300046678 Ga0495599_0001181 Ga0495599_0001181_1414_1914 150
189 3300046678 Ga0495599_0017743 Ga0495599_0017743_1069_1530 150
190 3300046678 Ga0495599_0141905 Ga0495599_0141905_554_1027 150
191 3300046680 Ga0495646_0005010 Ga0495646_0005010_7742_8242 150
192 3300046680 Ga0495646_0260505 Ga0495646_0260505_279_740 150
193 3300046681 Ga0495647_0010483 Ga0495647_0010483_2565_3065 150
194 3300046681 Ga0495647_0115145 Ga0495647_0115145_633_1106 150
195 3300046683 Ga0495658_0003066 Ga0495658_0003066_5983_6483 150
196 3300046683 Ga0495658_0846163 Ga0495658_0846163_78_551 150
197 3300046689 Ga0495613_0014526 Ga0495613_0014526_5318_5818 150
198 3300046690 Ga0495624_0000640 Ga0495624_0000640_24766_25266 150
199 3300046690 Ga0495624_0009120 Ga0495624_0009120_3094_3567 150
200 3300046809 Ga0495600_0000907 Ga0495600_0000907_11437_11937 150
201 3300046809 Ga0495600_0183198 Ga0495600_0183198_404_877 150
202 3300047315 Ga0495581_0000217 Ga0495581_0000217_4294_4803 150
203 3300047315 Ga0495581_0151491 Ga0495581_0151491_147_620 150
204 3300047317 Ga0495604_0010270 Ga0495604_0010270_5453_5953 150
205 3300047317 Ga0495604_0028458 Ga0495604_0028458_936_1397 150
206 3300047319 Ga0495674_0017491 Ga0495674_0017491_2257_2730 150
207 3300047321 Ga0495676_0020811 Ga0495676_0020811_1319_1819 150
208 3300047321 Ga0495676_0042486 Ga0495676_0042486_3200_3673 150
209 3300047322 Ga0495680_0005616 Ga0495680_0005616_11207_11680 150
210 3300047322 Ga0495680_0006369 Ga0495680_0006369_8405_8905 150
211 3300047322 Ga0495680_0012416 Ga0495680_0012416_2808_3269 150
212 3300047322 Ga0495680_0430201 Ga0495680_0430201_304_777 150
213 3300047322 Ga0495680_0646066 Ga0495680_0646066_186_647 150
214 3300047444 Ga0495675_0003093 Ga0495675_0003093_4085_4585 150
215 3300047444 Ga0495675_0170085 Ga0495675_0170085_218_691 150
216 3300047471 Ga0495684_0009729 Ga0495684_0009729_6707_7180 150
217 3300047471 Ga0495684_0014679 Ga0495684_0014679_108_608 150
218 3300047471 Ga0495684_0096587 Ga0495684_0096587_440_901 150
219 3300047673 Ga0495593_0003735 Ga0495593_0003735_4665_5165 150
220 3300047673 Ga0495593_0112451 Ga0495593_0112451_380_853 150
221 3300048088 Ga0495602_0011452 Ga0495602_0011452_5318_5818 150
222 3300048088 Ga0495602_0036095 Ga0495602_0036095_1449_1910 150
223 3300048088 Ga0495602_0156490 Ga0495602_0156490_286_759 150
224 3300048088 Ga0495602_0290096 Ga0495602_0290096_592_1053 150
225 3300048089 Ga0495614_0005230 Ga0495614_0005230_4602_5102 150
226 3300048089 Ga0495614_0095587 Ga0495614_0095587_741_1214 150
227 3300048911 Ga0496108_0128537 Ga0496108_0128537_94_567 150
228 3300048912 Ga0496109_0369567 Ga0496109_0369567_866_1339 150
229 3300048918 Ga0496115_0605544 Ga0496115_0605544_316_789 150
230 3300053077 Ga0495601_0003051 Ga0495601_0003051_8873_9373 150
231 3300053078 Ga0495612_0003724 Ga0495612_0003724_2891_3391 150
232 3300053078 Ga0495612_0308443 Ga0495612_0308443_55_528 150
233 3300053084 Ga0495595_0004296 Ga0495595_0004296_637_1137 150
234 3300053085 Ga0495619_0002574 Ga0495619_0002574_7776_8276 150
235 3300059492 Ga0587073_0028441 Ga0587073_0028441_29_502 150
236 3300059493 Ga0587077_020635 Ga0587077_020635_74_547 150
237 3300059504 Ga0587082_015795 Ga0587082_015795_67_540 150
238 3300059642 Ga0587069_008346 Ga0587069_008346_787_1260 150
239 3300059647 Ga0587079_020642 Ga0587079_020642_634_1107 150
240 3300059651 Ga0587105_011324 Ga0587105_011324_29_502 150
241 3300005329 Ga0070683_100012775 Ga0070683_1000127753 151
242 3300005336 Ga0070680_100048080 Ga0070680_1000480803 151
243 3300005339 Ga0070660_100065500 Ga0070660_1000655003 151
244 3300005434 Ga0070709_10001103 Ga0070709_100011036 151
245 3300005434 Ga0070709_10039817 Ga0070709_100398173 151
246 3300005435 Ga0070714_100002496 Ga0070714_1000024965 151
247 3300005435 Ga0070714_100100616 Ga0070714_1001006163 151
248 3300005435 Ga0070714_100208542 Ga0070714_1002085422 151
249 3300005435 Ga0070714_100213732 Ga0070714_1002137323 151
250 3300005435 Ga0070714_100479609 Ga0070714_1004796092 151
251 3300005435 Ga0070714_100578384 Ga0070714_1005783842 151
252 3300005435 Ga0070714_101401149 Ga0070714_1014011491 151
253 3300005436 Ga0070713_100003051 Ga0070713_1000030514 151
254 3300005436 Ga0070713_100059325 Ga0070713_1000593252 151
255 3300005436 Ga0070713_100169839 Ga0070713_1001698392 151
256 3300005436 Ga0070713_100937933 Ga0070713_1009379331 151
257 3300005436 Ga0070713_101183544 Ga0070713_1011835442 151
258 3300005436 Ga0070713_101355772 Ga0070713_1013557722 151
259 3300005437 Ga0070710_10000964 Ga0070710_100009646 151
260 3300005437 Ga0070710_10030877 Ga0070710_100308774 151
261 3300005437 Ga0070710_10080405 Ga0070710_100804053 151
262 3300005437 Ga0070710_10177182 Ga0070710_101771822 151
263 3300005437 Ga0070710_10275101 Ga0070710_102751013 151
264 3300005439 Ga0070711_100002034 Ga0070711_1000020344 151
265 3300005439 Ga0070711_100115781 Ga0070711_1001157812 151
266 3300005439 Ga0070711_100336180 Ga0070711_1003361802 151
267 3300005439 Ga0070711_101221956 Ga0070711_1012219561 151
268 3300005445 Ga0070708_100008998 Ga0070708_1000089982 151
269 3300005445 Ga0070708_100048091 Ga0070708_1000480912 151
270 3300005445 Ga0070708_100658658 Ga0070708_1006586581 151
271 3300005455 Ga0070663_100148415 Ga0070663_1001484151 151
272 3300005458 Ga0070681_10005841 Ga0070681_100058419 151
273 3300005467 Ga0070706_100001732 Ga0070706_1000017329 151
274 3300005467 Ga0070706_100006702 Ga0070706_1000067024 151
275 3300005467 Ga0070706_100081675 Ga0070706_1000816754 151
276 3300005467 Ga0070706_100083657 Ga0070706_1000836573 151
277 3300005467 Ga0070706_100128645 Ga0070706_1001286452 151
278 3300005467 Ga0070706_100161419 Ga0070706_1001614194 151
279 3300005467 Ga0070706_100171280 Ga0070706_1001712802 151
280 3300005467 Ga0070706_100214245 Ga0070706_1002142452 151
281 3300005467 Ga0070706_100490228 Ga0070706_1004902281 151
282 3300005467 Ga0070706_100525196 Ga0070706_1005251961 151
283 3300005468 Ga0070707_100000043 Ga0070707_10000004342 151
284 3300005468 Ga0070707_100020875 Ga0070707_1000208752 151
285 3300005468 Ga0070707_100192001 Ga0070707_1001920013 151
286 3300005468 Ga0070707_101238217 Ga0070707_1012382172 151
287 3300005471 Ga0070698_100000072 Ga0070698_10000007243 151
288 3300005471 Ga0070698_100007190 Ga0070698_1000071908 151
289 3300005471 Ga0070698_100022346 Ga0070698_1000223463 151
290 3300005471 Ga0070698_100142499 Ga0070698_1001424991 151
291 3300005471 Ga0070698_100600611 Ga0070698_1006006111 151
292 3300005518 Ga0070699_100002469 Ga0070699_1000024696 151
293 3300005518 Ga0070699_100018430 Ga0070699_1000184302 151
294 3300005518 Ga0070699_100089733 Ga0070699_1000897334 151
295 3300005530 Ga0070679_100018751 Ga0070679_1000187515 151
296 3300005535 Ga0070684_100070212 Ga0070684_1000702122 151
297 3300005536 Ga0070697_100001274 Ga0070697_1000012748 151
298 3300005616 Ga0068852_100408302 Ga0068852_1004083022 151
299 3300005983 Ga0081540_1002497 Ga0081540_100249711 151
300 3300006028 Ga0070717_10005834 Ga0070717_100058343 151
301 3300006028 Ga0070717_10010153 Ga0070717_100101534 151
302 3300006028 Ga0070717_10013944 Ga0070717_100139444 151
303 3300006028 Ga0070717_10155797 Ga0070717_101557972 151
304 3300006028 Ga0070717_10245344 Ga0070717_102453442 151
305 3300006028 Ga0070717_10724968 Ga0070717_107249682 151
306 3300006028 Ga0070717_11352791 Ga0070717_113527912 151
307 3300006163 Ga0070715_10005600 Ga0070715_100056003 151
308 3300006163 Ga0070715_10247098 Ga0070715_102470982 151
309 3300006173 Ga0070716_100001284 Ga0070716_1000012848 151
310 3300006173 Ga0070716_100029261 Ga0070716_1000292614 151
311 3300006173 Ga0070716_100300765 Ga0070716_1003007652 151
312 3300006175 Ga0070712_100004057 Ga0070712_1000040577 151
313 3300006175 Ga0070712_100057191 Ga0070712_1000571913 151
314 3300006175 Ga0070712_100260971 Ga0070712_1002609711 151
315 3300006844 Ga0075428_100180503 Ga0075428_1001805032 151
316 3300006847 Ga0075431_100188426 Ga0075431_1001884262 151
317 3300006914 Ga0075436_100010349 Ga0075436_1000103492 151
318 3300007265 Ga0099794_10066611 Ga0099794_100666112 151
319 3300009094 Ga0111539_10012462 Ga0111539_100124625 151
320 3300009098 Ga0105245_10392866 Ga0105245_103928662 151
321 3300009147 Ga0114129_10034238 Ga0114129_100342386 151
322 3300009174 Ga0105241_10682196 Ga0105241_106821961 151
323 3300009545 Ga0105237_11755926 Ga0105237_117559261 151
324 3300009551 Ga0105238_11774244 Ga0105238_117742441 151
325 3300010375 Ga0105239_11288236 Ga0105239_112882361 151
326 3300013104 Ga0157370_10332802 Ga0157370_103328022 151
327 3300013105 Ga0157369_10044810 Ga0157369_100448104 151
328 3300020070 Ga0206356_11871563 Ga0206356_118715632 151
329 3300020082 Ga0206353_10950019 Ga0206353_109500192 151
330 3300021384 Ga0213876_10234974 Ga0213876_102349742 151
331 3300025898 Ga0207692_10002476 Ga0207692_100024763 151
332 3300025898 Ga0207692_10018339 Ga0207692_100183394 151
333 3300025905 Ga0207685_10010298 Ga0207685_100102982 151
334 3300025906 Ga0207699_10002431 Ga0207699_100024317 151
335 3300025906 Ga0207699_10094087 Ga0207699_100940872 151
336 3300025910 Ga0207684_10004234 Ga0207684_100042347 151
337 3300025910 Ga0207684_10005262 Ga0207684_100052624 151
338 3300025910 Ga0207684_10009530 Ga0207684_100095303 151
339 3300025910 Ga0207684_10183089 Ga0207684_101830892 151
340 3300025910 Ga0207684_10190081 Ga0207684_101900812 151
341 3300025910 Ga0207684_10401536 Ga0207684_104015362 151
342 3300025910 Ga0207684_10525445 Ga0207684_105254451 151
343 3300025912 Ga0207707_10023938 Ga0207707_100239382 151
344 3300025913 Ga0207695_10819211 Ga0207695_108192112 151
345 3300025915 Ga0207693_10007216 Ga0207693_100072163 151
346 3300025915 Ga0207693_10060142 Ga0207693_100601423 151
347 3300025915 Ga0207693_10295526 Ga0207693_102955261 151
348 3300025915 Ga0207693_10474230 Ga0207693_104742302 151
349 3300025916 Ga0207663_10023264 Ga0207663_100232642 151
350 3300025916 Ga0207663_10181790 Ga0207663_101817901 151
351 3300025916 Ga0207663_10737565 Ga0207663_107375651 151
352 3300025917 Ga0207660_10098524 Ga0207660_100985242 151
353 3300025919 Ga0207657_10060305 Ga0207657_100603053 151
354 3300025921 Ga0207652_10012418 Ga0207652_100124182 151
355 3300025922 Ga0207646_10000300 Ga0207646_1000030049 151
356 3300025922 Ga0207646_10018909 Ga0207646_100189094 151
357 3300025922 Ga0207646_10032763 Ga0207646_100327633 151
358 3300025922 Ga0207646_10043408 Ga0207646_100434082 151
359 3300025928 Ga0207700_10001611 Ga0207700_100016118 151
360 3300025928 Ga0207700_10145577 Ga0207700_101455772 151
361 3300025928 Ga0207700_10158838 Ga0207700_101588382 151
362 3300025929 Ga0207664_10001224 Ga0207664_100012249 151
363 3300025929 Ga0207664_10061451 Ga0207664_100614514 151
364 3300025929 Ga0207664_10111066 Ga0207664_101110663 151
365 3300025929 Ga0207664_10354612 Ga0207664_103546122 151
366 3300025929 Ga0207664_10595706 Ga0207664_105957062 151
367 3300025929 Ga0207664_11007374 Ga0207664_110073742 151
368 3300025939 Ga0207665_10003655 Ga0207665_100036555 151
369 3300025939 Ga0207665_10021630 Ga0207665_100216303 151
370 3300025939 Ga0207665_10175788 Ga0207665_101757881 151
371 3300025944 Ga0207661_10004104 Ga0207661_100041046 151
372 3300026067 Ga0207678_10242214 Ga0207678_102422142 151
373 3300030882 Ga0265764_101661 Ga0265764_1016612 151
374 3300031090 Ga0265760_10022173 Ga0265760_100221733 151
375 3300035086 Ga0373934_0000007 Ga0373934_0000007_70737_71201 151
376 3300035086 Ga0373934_0016239 Ga0373934_0016239_1843_2307 151
377 3300035086 Ga0373934_0098058 Ga0373934_0098058_236_691 151
378 3300035086 Ga0373934_0190120 Ga0373934_0190120_344_823 151
379 3300035111 Ga0373923_0040119 Ga0373923_0040119_984_1448 151
380 3300035113 Ga0373936_0167173 Ga0373936_0167173_38_547 151
381 3300035113 Ga0373936_0379035 Ga0373936_0379035_140_598 151
382 3300035117 Ga0373953_0000044 Ga0373953_0000044_23584_24048 151
383 3300035117 Ga0373953_0326791 Ga0373953_0326791_72_530 151
384 3300035118 Ga0373954_0004338 Ga0373954_0004338_1660_2124 151
385 3300035118 Ga0373954_0025510 Ga0373954_0025510_192_656 151
386 3300035118 Ga0373954_0029269 Ga0373954_0029269_114_593 151
387 3300035118 Ga0373954_0096050 Ga0373954_0096050_309_767 151
388 3300035119 Ga0373956_0002023 Ga0373956_0002023_301_765 151
389 3300035119 Ga0373956_0026900 Ga0373956_0026900_1180_1659 151
390 3300035119 Ga0373956_0198401 Ga0373956_0198401_166_624 151
391 3300035120 Ga0373957_0000107 Ga0373957_0000107_16573_17037 151
392 3300035120 Ga0373957_0033018 Ga0373957_0033018_1352_1810 151
393 3300035120 Ga0373957_0038358 Ga0373957_0038358_523_981 151
394 3300035170 Ga0373943_0186450 Ga0373943_0186450_581_1090 151
395 3300035172 Ga0373955_0000014 Ga0373955_0000014_52081_52545 151
396 3300035172 Ga0373955_0059036 Ga0373955_0059036_279_758 151
397 3300035172 Ga0373955_0071408 Ga0373955_0071408_1417_1872 151
398 3300035172 Ga0373955_0301831 Ga0373955_0301831_471_935 151
399 3300035410 Ga0373924_0000098 Ga0373924_0000098_7156_7620 151
400 3300035410 Ga0373924_0013508 Ga0373924_0013508_1469_1933 151
401 3300035410 Ga0373924_0083426 Ga0373924_0083426_471_926 151
402 3300035692 Ga0373935_0127796 Ga0373935_0127796_196_705 151
403 3300035692 Ga0373935_0715898 Ga0373935_0715898_156_635 151
404 3300035724 Ga0373933_0000021 Ga0373933_0000021_25777_26241 151
405 3300035724 Ga0373933_0032580 Ga0373933_0032580_2543_3001 151
406 3300035724 Ga0373933_0106570 Ga0373933_0106570_279_737 151
407 3300035724 Ga0373933_0295248 Ga0373933_0295248_477_956 151
408 3300036401 Ga0373937_0000032 Ga0373937_0000032_70807_71271 151
409 3300036401 Ga0373937_0019226 Ga0373937_0019226_3716_4180 151
410 3300036401 Ga0373937_0039634 Ga0373937_0039634_3520_3999 151
411 3300036401 Ga0373937_0118793 Ga0373937_0118793_1496_1951 151
412 3300036401 Ga0373937_0153799 Ga0373937_0153799_1437_1895 151
413 3300036401 Ga0373937_0481086 Ga0373937_0481086_204_659 151
414 3300036401 Ga0373937_0811414 Ga0373937_0811414_137_637 151
415 3300036459 Ga0372808_006096 Ga0372808_006096_521_985 151
416 3300036459 Ga0372808_018921 Ga0372808_018921_113_568 151
417 3300037068 Ga0373925_0386991 Ga0373925_0386991_386_862 151
418 3300037068 Ga0373925_0581037 Ga0373925_0581037_303_758 151
419 3300037068 Ga0373925_0846557 Ga0373925_0846557_197_655 151
420 3300037853 Ga0436364_0292123 Ga0436364_0292123_434_889 151
421 3300037853 Ga0436364_0750468 Ga0436364_0750468_1816_2271 151
422 3300037853 Ga0436364_1552281 Ga0436364_1552281_66_563 151
423 3300039453 Ga0436362_0731252 Ga0436362_0731252_16_480 151
424 3300039453 Ga0436362_0861895 Ga0436362_0861895_28_519 151
425 3300046454 Ga0495592_0000079 Ga0495592_0000079_77483_77947 151
426 3300046454 Ga0495592_0030619 Ga0495592_0030619_1634_2092 151
427 3300046459 Ga0495629_0678153 Ga0495629_0678153_57_515 151
428 3300046461 Ga0495641_0144229 Ga0495641_0144229_110_589 151
429 3300046462 Ga0495651_0000010 Ga0495651_0000010_77483_77947 151
430 3300046462 Ga0495651_0000862 Ga0495651_0000862_22791_23249 151
431 3300046462 Ga0495651_0014825 Ga0495651_0014825_1614_2093 151
432 3300046462 Ga0495651_0060240 Ga0495651_0060240_1665_2129 151
433 3300046462 Ga0495651_0131961 Ga0495651_0131961_132_587 151
434 3300046463 Ga0495653_0000601 Ga0495653_0000601_15251_15715 151
435 3300046463 Ga0495653_0017905 Ga0495653_0017905_3119_3577 151
436 3300046463 Ga0495653_0046502 Ga0495653_0046502_508_987 151
437 3300046463 Ga0495653_0203187 Ga0495653_0203187_694_1152 151
438 3300046463 Ga0495653_0229971 Ga0495653_0229971_558_1013 151
439 3300046477 Ga0495664_0059540 Ga0495664_0059540_1126_1581 151
440 3300046477 Ga0495664_0219430 Ga0495664_0219430_594_1052 151
441 3300046511 Ga0495608_0000037 Ga0495608_0000037_60081_60545 151
442 3300046511 Ga0495608_0003237 Ga0495608_0003237_11019_11477 151
443 3300046511 Ga0495608_0171573 Ga0495608_0171573_454_909 151
444 3300046511 Ga0495608_0181667 Ga0495608_0181667_171_650 151
445 3300046511 Ga0495608_0820107 Ga0495608_0820107_49_507 151
446 3300046514 Ga0495618_0121307 Ga0495618_0121307_658_1113 151
447 3300046516 Ga0495628_0007686 Ga0495628_0007686_4751_5215 151
448 3300046516 Ga0495628_0020977 Ga0495628_0020977_2436_2894 151
449 3300046516 Ga0495628_0148664 Ga0495628_0148664_1137_1592 151
450 3300046516 Ga0495628_0208666 Ga0495628_0208666_808_1272 151
451 3300046516 Ga0495628_0915139 Ga0495628_0915139_27_485 151
452 3300046529 Ga0495652_0000180 Ga0495652_0000180_63452_63916 151
453 3300046529 Ga0495652_0055594 Ga0495652_0055594_2366_2824 151
454 3300046529 Ga0495652_0132383 Ga0495652_0132383_1478_1933 151
455 3300046529 Ga0495652_0163466 Ga0495652_0163466_94_549 151
456 3300046533 Ga0495640_0167267 Ga0495640_0167267_49_507 151
457 3300046533 Ga0495640_0314015 Ga0495640_0314015_450_929 151
458 3300046536 Ga0495587_0000024 Ga0495587_0000024_70806_71270 151
459 3300046536 Ga0495587_0048769 Ga0495587_0048769_1495_1953 151
460 3300046536 Ga0495587_0115810 Ga0495587_0115810_349_828 151
461 3300046536 Ga0495587_0721046 Ga0495587_0721046_13_477 151
462 3300046543 Ga0495645_0023105 Ga0495645_0023105_2984_3448 151
463 3300046543 Ga0495645_0061278 Ga0495645_0061278_1021_1500 151
464 3300046543 Ga0495645_0312032 Ga0495645_0312032_412_876 151
465 3300046559 Ga0495667_0000024 Ga0495667_0000024_90365_90829 151
466 3300046559 Ga0495667_0000532 Ga0495667_0000532_1345_1803 151
467 3300046559 Ga0495667_0018953 Ga0495667_0018953_400_879 151
468 3300046559 Ga0495667_0308162 Ga0495667_0308162_424_888 151
469 3300046559 Ga0495667_0581322 Ga0495667_0581322_200_658 151
470 3300046642 Ga0495634_0274475 Ga0495634_0274475_334_813 151
471 3300046663 Ga0495635_0013653 Ga0495635_0013653_508_987 151
472 3300046663 Ga0495635_0030159 Ga0495635_0030159_598_1056 151
473 3300046663 Ga0495635_0072147 Ga0495635_0072147_1722_2180 151
474 3300046663 Ga0495635_0077916 Ga0495635_0077916_1391_1855 151
475 3300046675 Ga0495657_0000057 Ga0495657_0000057_90342_90806 151
476 3300046675 Ga0495657_0009020 Ga0495657_0009020_2281_2739 151
477 3300046675 Ga0495657_0011111 Ga0495657_0011111_2332_2811 151
478 3300046675 Ga0495657_0025680 Ga0495657_0025680_1462_1917 151
479 3300046678 Ga0495599_0000362 Ga0495599_0000362_11811_12275 151
480 3300046678 Ga0495599_0051001 Ga0495599_0051001_1016_1471 151
481 3300046678 Ga0495599_0211512 Ga0495599_0211512_304_762 151
482 3300046679 Ga0495623_0001051 Ga0495623_0001051_3711_4175 151
483 3300046679 Ga0495623_0036378 Ga0495623_0036378_68_532 151
484 3300046679 Ga0495623_0343695 Ga0495623_0343695_285_764 151
485 3300046680 Ga0495646_0054291 Ga0495646_0054291_75_533 151
486 3300046680 Ga0495646_0111217 Ga0495646_0111217_723_1187 151
487 3300046680 Ga0495646_0322524 Ga0495646_0322524_167_646 151
488 3300046690 Ga0495624_0516637 Ga0495624_0516637_224_682 151
489 3300046690 Ga0495624_0551266 Ga0495624_0551266_185_661 151
490 3300046809 Ga0495600_0012043 Ga0495600_0012043_3761_4225 151
491 3300046809 Ga0495600_0025829 Ga0495600_0025829_1938_2396 151
492 3300046809 Ga0495600_0027000 Ga0495600_0027000_1055_1534 151
493 3300047317 Ga0495604_0000024 Ga0495604_0000024_70623_71087 151
494 3300047317 Ga0495604_0860122 Ga0495604_0860122_52_516 151
495 3300047319 Ga0495674_0033399 Ga0495674_0033399_3213_3671 151
496 3300047319 Ga0495674_0085195 Ga0495674_0085195_552_1010 151
497 3300047319 Ga0495674_0357762 Ga0495674_0357762_650_1108 151
498 3300047322 Ga0495680_0000005 Ga0495680_0000005_77459_77923 151
499 3300047322 Ga0495680_0020852 Ga0495680_0020852_4717_5196 151
500 3300047322 Ga0495680_0065413 Ga0495680_0065413_561_1019 151
501 3300047322 Ga0495680_0089074 Ga0495680_0089074_225_683 151
502 3300047322 Ga0495680_0767339 Ga0495680_0767339_37_501 151
503 3300047444 Ga0495675_0001438 Ga0495675_0001438_639_1103 151
504 3300047444 Ga0495675_0095923 Ga0495675_0095923_579_1037 151
505 3300047471 Ga0495684_0006376 Ga0495684_0006376_3568_4026 151
506 3300047471 Ga0495684_0021290 Ga0495684_0021290_2537_2995 151
507 3300047471 Ga0495684_0030070 Ga0495684_0030070_2668_3147 151
508 3300048088 Ga0495602_0000198 Ga0495602_0000198_48878_49342 151
509 3300048088 Ga0495602_0015318 Ga0495602_0015318_6905_7363 151
510 3300048088 Ga0495602_0043823 Ga0495602_0043823_863_1327 151
511 3300048088 Ga0495602_0059060 Ga0495602_0059060_2585_3040 151
512 3300048088 Ga0495602_0144726 Ga0495602_0144726_412_891 151
513 3300048088 Ga0495602_0949275 Ga0495602_0949275_80_538 151
514 3300048905 Ga0496102_0316276 Ga0496102_0316276_45_509 151
515 3300048918 Ga0496115_0046116 Ga0496115_0046116_1504_1968 151
516 3300048929 Ga0496126_0118620 Ga0496126_0118620_1229_1684 151
517 3300050507 nmdc:mga05p37_1765_c2 nmdc:mga05p37_1765_c2_16623_17090 151
518 3300050510 nmdc:mga06r32_1059668_c1 nmdc:mga06r32_1059668_c1_195_662 151
519 3300050511 nmdc:mga08y16_796861_c1 nmdc:mga08y16_796861_c1_304_771 151
520 3300050512 nmdc:mga0n895_1262929_c1 nmdc:mga0n895_1262929_c1_137_604 151
521 3300050513 nmdc:mga0rr50_521909_c1 nmdc:mga0rr50_521909_c1_281_748 151
522 3300050514 nmdc:mga08x19_361414_c1 nmdc:mga08x19_361414_c1_280_747 151
523 3300053077 Ga0495601_0139479 Ga0495601_0139479_350_814 151
524 3300053077 Ga0495601_0153424 Ga0495601_0153424_250_708 151
525 3300053077 Ga0495601_0347017 Ga0495601_0347017_454_909 151
526 3300053078 Ga0495612_0066563 Ga0495612_0066563_686_1144 151
527 3300053084 Ga0495595_0000633 Ga0495595_0000633_8169_8633 151
528 3300053085 Ga0495619_0236803 Ga0495619_0236803_74_532 151
529 3300053085 Ga0495619_0275895 Ga0495619_0275895_274_753 151
530 3300053085 Ga0495619_0575603 Ga0495619_0575603_239_703 151
531 3300006028 Ga0070717_10103921 Ga0070717_101039213 152
532 3300037068 Ga0373925_0138926 Ga0373925_0138926_899_1360 152
533 3300021388 Ga0213875_10012454 Ga0213875_100124543 153
534 3300028794 Ga0307515_10157993 Ga0307515_101579933 153
535 3300031456 Ga0307513_10000274 Ga0307513_1000027429 153
536 3300037853 Ga0436364_0589799 Ga0436364_0589799_4660_5130 153
537 3300046511 Ga0495608_0383978 Ga0495608_0383978_366_827 153
538 3300003316 rootH1_10106360 rootH1_101063602 155
539 3300005617 Ga0068859_101502536 Ga0068859_1015025361 155
540 3300005983 Ga0081540_1282424 Ga0081540_12824241 155
541 3300006178 Ga0075367_10831803 Ga0075367_108318031 155
542 3300006844 Ga0075428_100283073 Ga0075428_1002830732 155
543 3300006846 Ga0075430_100813503 Ga0075430_1008135032 155
544 3300006931 Ga0097620_101502557 Ga0097620_1015025572 155
545 3300028381 Ga0268264_10208845 Ga0268264_102088453 155
546 3300050494 nmdc:mga06z11_744256_c1 nmdc:mga06z11_744256_c1_108_575 155

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vne-assembly1.cif.gz_A structure of the ebolavirus protein vp24 from sudan 0.8786 74 98
4v4c-assembly3.cif.gz_F crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici 0.7816 102 155
4s3r-assembly1.cif.gz_A amylomaltase malq from escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose 0.7585 91 149
4s3q-assembly1.cif.gz_A amylomaltase malq from escherichia coli in complex with maltose 0.7572 91 149
4s3p-assembly1.cif.gz_A amylomaltase malq from escherichia coli, apo structure 0.7531 91 149
ID Description Score Start End Superfamily
af_Q5AAP7_3_152_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8003 104 143 2.60.40.10
af_I1L2X5_101_167_3.10.450.700 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7866 74 99 3.10.450.700
1ti2B03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7746 102 155 2.60.40.10
af_Q9W4F5_615_704_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7593 85 151 2.60.40.10
af_I1JV26_333_420_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7461 91 153 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A3N4ZL60-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9019 75 155
AF-A0A7C2ILE5-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.8735 101 150 GO:0004180
GO:0016020
AF-A0A2V7XHN8-F1-model_v4 TonB-dependent receptor-like beta-barrel domain-containing protein 0.8694 101 155 GO:0030246
AF-A0A3D0S307-F1-model_v4 Uncharacterized protein 0.8686 75 155
AF-A0A6L8GQU3-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.867 101 155 GO:0004180
GO:0016020

Feature Viewer

pLDDT pTM Quality
80.47 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map