F461985

General Info

Members Datasets Scaffolds Average Seq Length
546 333 1088 392

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10004321|Ga0105240_100043214
Length 435
Sequence MQFFAGVVVCIRADLTSLDPTHRCRTIRRFIFVHWRARMPVINRIASFHKDMTAWRHDIHSHPETAFEEVRTADVVAEKLKSFGLEVHRGLAKTGVVGVLRAGKSGRAIGLRADMDALDVHETNQFDHKSTIAGKMHACGHDGHTVMLLGAAKYLAETRNFDGTVYFIFQPAEENEGGGRVMVEEGLFEKFPVDGVYGMHNIPGIPVGKFAVRPGPMMAAYDIFEVVLKGVGGHGAMPHHTIDPVVVGAHIVTALQSIVARNVDPMDTAVVSTTQIHAGDAWNVIPQECVLRGTVRTFKKPVQDMIEKNIEKISRNVAAGFGAEVVKWRYERRYPATVNSVQETEFAAHAASALVGLDNVNRNPTPAMGSEDFAWMLLKKPGCYIWIGNGDGEGSCMVHNPGYDFNDDILPIGASYWATLVEQQLAREALPQAAE

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
73 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
74 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
113 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
132 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
133 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
134 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
135 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
136 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
210 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
224 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
232 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
250 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
255 2511231015 Pseudomonas sp. GM49 Isolate Nodule
256 2511231017 Pseudomonas sp. GM55 Isolate Nodule
257 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
258 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
259 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
260 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
261 2519103095 Burkholderia sp. KJ006 Isolate Nodule
262 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
263 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
264 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
265 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
266 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
267 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
268 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
269 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
270 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
271 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
272 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
273 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
274 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
275 2738543024 Aminobacter sp. AP02 Isolate Unclassified
276 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
277 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
278 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
279 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
280 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
281 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
282 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
283 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
284 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
285 2818991452 Burkholderia cepacia 561 Isolate Unclassified
286 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
287 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
288 2847085930 Erwinia persicina B64 Isolate Bulb
289 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
290 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
291 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
292 2865014394 Pantoea sp. R-71966 Isolate Unclassified
293 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
294 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
295 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
296 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
297 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
298 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
299 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
300 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
301 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
302 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
303 2904564687 Burkholderia sp. 571 Isolate Unclassified
304 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
305 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
306 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
307 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
308 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
309 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
310 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
311 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
312 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
313 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
314 2928163908 Burkholderia sp. 567 Isolate Unclassified
315 2928170801 Burkholderia sp. 572 Isolate Unclassified
316 2928536128 Burkholderia sola 565 Isolate Unclassified
317 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
318 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
319 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
320 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
321 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
322 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
323 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
324 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
325 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
326 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
327 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
328 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
329 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
330 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
331 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
332 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
333 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.16
Metatranscriptomes 0
Isolates 14.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0.18
Endosphere 15.57
Nodule 2.01
Rhizoplane 3.11
Rhizosphere 64.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10004321 3300009093 Bacteria 21688
2 JGI24739J22299_10031577 3300001989 Bacteria 1829
3 JGI25156J39149_1000205 3300002705 Bacteria 40906
4 JGI25154J39366_1000101 3300002738 Bacteria 76597
5 JGI25165J46597_1001595 3300003214 Bacteria 10972
6 JGI25165J46597_1005351 3300003214 Bacteria 2491
7 rootH1_10062809 3300003316 Bacteria 5504
8 rootH2_10047895 3300003320 Bacteria 14337
9 rootH1_10083155 3300003323 Bacteria 10706
10 Ga0055538_1000008 3300003751 Bacteria 398547
11 Ga0055538_1000084 3300003751 Bacteria 81835
12 Ga0055539_1000012 3300003752 Bacteria 398547
13 Ga0055533_1000015 3300003756 Bacteria 398547
14 Ga0055533_1000095 3300003756 Bacteria 114060
15 Ga0055533_1008087 3300003756 Bacteria 1363
16 Ga0055532_1000010 3300003758 Bacteria 392055
17 Ga0055532_1000264 3300003758 Bacteria 34181
18 Ga0055532_1000351 3300003758 Bacteria 24599
19 Ga0055532_1000512 3300003758 Bacteria 16921
20 Ga0055525_1000017 3300003759 Bacteria 398547
21 Ga0055527_1000008 3300003760 Bacteria 392055
22 Ga0055527_1000268 3300003760 Bacteria 31437
23 Ga0055535_1000007 3300003761 Bacteria 392055
24 Ga0055535_1000157 3300003761 Bacteria 72863
25 Ga0055535_1000563 3300003761 Bacteria 31437
26 Ga0055542_1000011 3300003762 Bacteria 392055
27 Ga0055542_1000204 3300003762 Bacteria 72884
28 Ga0055542_1002102 3300003762 Bacteria 7384
29 Ga0055529_1000009 3300003763 Bacteria 392055
30 Ga0055529_1000221 3300003763 Bacteria 73491
31 Ga0055528_1001385 3300003790 Bacteria 14893
32 Ga0055541_1000009 3300003841 Bacteria 398547
33 Ga0058692_1000098 3300003856 Bacteria 57148
34 Ga0058692_1000202 3300003856 Bacteria 35967
35 Ga0058692_1001424 3300003856 Bacteria 8809
36 Ga0070658_10003024 3300005327 Bacteria 13911
37 Ga0070658_10039170 3300005327 Bacteria 3823
38 Ga0070683_100027919 3300005329 Bacteria 5095
39 Ga0070680_100017398 3300005336 Bacteria 5669
40 Ga0070660_100000457 3300005339 Bacteria 27258
41 Ga0070691_10001406 3300005341 Bacteria 10269
42 Ga0070668_100014373 3300005347 Bacteria 5915
43 Ga0070675_100251586 3300005354 Bacteria 1547
44 Ga0070659_100000108 3300005366 Bacteria 61185
45 Ga0070709_10037203 3300005434 Bacteria 2971
46 Ga0070662_100023500 3300005457 Bacteria 4235
47 Ga0070681_10000320 3300005458 Bacteria 39081
48 Ga0070698_100001190 3300005471 Bacteria 28851
49 Ga0070679_100004504 3300005530 Bacteria 12868
50 Ga0070697_100025217 3300005536 Bacteria 4741
51 Ga0070665_100013946 3300005548 Bacteria 8083
52 Ga0070665_100058939 3300005548 Bacteria 3848
53 Ga0068855_100000838 3300005563 Bacteria 38053
54 Ga0068855_100000904 3300005563 Bacteria 36789
55 Ga0068855_100058519 3300005563 Bacteria 4512
56 Ga0068855_100122262 3300005563 Bacteria 2979
57 Ga0070664_100060345 3300005564 Bacteria 3229
58 Ga0070664_100065890 3300005564 Bacteria 3092
59 Ga0068857_100219106 3300005577 Bacteria 1738
60 Ga0068854_100131749 3300005578 Bacteria 1910
61 Ga0068856_100046845 3300005614 Bacteria 4259
62 Ga0068856_100100644 3300005614 Bacteria 2882
63 Ga0068852_100017751 3300005616 Bacteria 5590
64 Ga0068852_100092879 3300005616 Bacteria 2704
65 Ga0081455_10000116 3300005937 Bacteria 91321
66 Ga0081455_10008619 3300005937 Bacteria 10577
67 Ga0081455_10024560 3300005937 Bacteria 5578
68 Ga0081539_10003020 3300005985 Bacteria 21846
69 Ga0081539_10016756 3300005985 Bacteria 5203
70 Ga0075365_10059001 3300006038 Bacteria 2556
71 Ga0075365_10082610 3300006038 Bacteria 2178
72 Ga0075432_10000877 3300006058 Bacteria 9484
73 Ga0070712_100108276 3300006175 Bacteria 2069
74 Ga0075362_10038336 3300006177 Bacteria 2105
75 Ga0075362_10078907 3300006177 Bacteria 1515
76 Ga0075367_10004904 3300006178 Bacteria 6591
77 Ga0075369_10001815 3300006186 Bacteria 7442
78 Ga0075369_10066329 3300006186 Bacteria 1583
79 Ga0075436_100018894 3300006914 Bacteria 4719
80 Ga0075436_100054452 3300006914 Bacteria 2761
81 Ga0079104_1000068 3300006946 Bacteria 154984
82 Ga0105251_10001827 3300009011 Bacteria 17545
83 Ga0105244_10000333 3300009036 Bacteria 44601
84 Ga0105244_10008807 3300009036 Bacteria 6267
85 Ga0105244_10028520 3300009036 Bacteria 2993
86 Ga0105240_10000586 3300009093 Bacteria 67524
87 Ga0105240_10096407 3300009093 Bacteria 3604
88 Ga0105240_10106278 3300009093 Bacteria 3405
89 Ga0105240_10109642 3300009093 Bacteria 3342
90 Ga0111539_10324922 3300009094 Bacteria 1791
91 Ga0105237_10015581 3300009545 Bacteria 7906
92 Ga0105237_10029105 3300009545 Bacteria 5619
93 Ga0105237_10033998 3300009545 Bacteria 5164
94 Ga0105237_10077543 3300009545 Bacteria 3313
95 Ga0105237_10436713 3300009545 Bacteria 1315
96 Ga0105238_10000111 3300009551 Bacteria 89931
97 Ga0105239_10046397 3300010375 Bacteria 4761
98 Ga0105246_10003091 3300011119 Bacteria 10100
99 Ga0157373_10006300 3300013100 Bacteria 8867
100 Ga0157373_10009596 3300013100 Bacteria 7144
101 Ga0157371_10022553 3300013102 Bacteria 4610
102 Ga0157371_10176889 3300013102 Bacteria 1526
103 Ga0157370_10000260 3300013104 Bacteria 66984
104 Ga0157370_10003456 3300013104 Bacteria 18523
105 Ga0157370_10008025 3300013104 Bacteria 11435
106 Ga0157370_10034702 3300013104 Bacteria 4908
107 Ga0157370_10103259 3300013104 Bacteria 2668
108 Ga0157369_10000214 3300013105 Bacteria 80288
109 Ga0157369_10004707 3300013105 Bacteria 16041
110 Ga0157369_10008342 3300013105 Bacteria 11879
111 Ga0157369_10091243 3300013105 Bacteria 3252
112 Ga0157369_10212156 3300013105 Bacteria 2029
113 Ga0157374_10002568 3300013296 Bacteria 15311
114 Ga0163162_10260013 3300013306 Bacteria 1868
115 Ga0157372_10024223 3300013307 Bacteria 6589
116 Ga0157372_10069853 3300013307 Bacteria 3951
117 Ga0157372_10081515 3300013307 Bacteria 3662
118 Ga0157372_10084477 3300013307 Bacteria 3598
119 Ga0182006_1002600 3300015261 Bacteria 9754
120 Ga0182006_1006021 3300015261 Bacteria 5680
121 Ga0182006_1008796 3300015261 Bacteria 4565
122 Ga0182007_10001588 3300015262 Bacteria 12112
123 Ga0182005_1021802 3300015265 Bacteria 1756
124 Ga0163161_10020929 3300017792 Bacteria 4595
125 Ga0213872_10002340 3300021361 Bacteria 11262
126 Ga0213875_10004095 3300021388 Bacteria 8096
127 Ga0213871_10000826 3300021441 Bacteria 4652
128 Ga0209435_100069 3300025206 Bacteria 64808
129 Ga0209784_100005 3300025224 Bacteria 1040422
130 Ga0209784_100066 3300025224 Bacteria 154427
131 Ga0209566_100005 3300025225 Bacteria 1040422
132 Ga0209566_100125 3300025225 Bacteria 95628
133 Ga0209566_100510 3300025225 Bacteria 26904
134 Ga0209674_100009 3300025226 Bacteria 1040422
135 Ga0209674_100022 3300025226 Bacteria 563656
136 Ga0209674_100344 3300025226 Bacteria 27195
137 Ga0209674_100497 3300025226 Bacteria 16305
138 Ga0209672_100001 3300025228 Bacteria 2828210
139 Ga0209672_100040 3300025228 Bacteria 278858
140 Ga0209672_100044 3300025228 Bacteria 270292
141 Ga0209672_100120 3300025228 Bacteria 83650
142 Ga0209672_101665 3300025228 Bacteria 7231
143 Ga0209147_100001 3300025229 Bacteria 2384371
144 Ga0209147_100037 3300025229 Bacteria 326977
145 Ga0209147_100039 3300025229 Bacteria 311101
146 Ga0209147_100048 3300025229 Bacteria 278858
147 Ga0209563_100012 3300025230 Bacteria 1040422
148 Ga0209563_100370 3300025230 Bacteria 16574
149 Ga0207427_100612 3300025231 Bacteria 17719
150 Ga0209437_100212 3300025233 Bacteria 107265
151 Ga0209258_100001 3300025242 Bacteria 2384269
152 Ga0209258_100062 3300025242 Bacteria 311101
153 Ga0209258_100070 3300025242 Bacteria 278858
154 Ga0209646_1000108 3300025246 Bacteria 158853
155 Ga0209026_1000508 3300025250 Bacteria 27593
156 Ga0209677_100006 3300025253 Bacteria 1040422
157 Ga0209148_1000003 3300025254 Bacteria 2384288
158 Ga0209148_1000075 3300025254 Bacteria 311101
159 Ga0209148_1000691 3300025254 Bacteria 27615
160 Ga0209759_1000002 3300025256 Bacteria 1027596
161 Ga0209759_1000101 3300025256 Bacteria 155034
162 Ga0209759_1000173 3300025256 Bacteria 107724
163 Ga0209759_1000380 3300025256 Bacteria 55490
164 Ga0209759_1007207 3300025256 Bacteria 3613
165 Ga0209759_1015973 3300025256 Bacteria 1915
166 Ga0209233_1000061 3300025261 Bacteria 406211
167 Ga0209233_1011188 3300025261 Bacteria 2652
168 Ga0209455_1000001 3300025272 Bacteria 2384278
169 Ga0209455_1000067 3300025272 Bacteria 311101
170 Ga0209455_1000384 3300025272 Bacteria 39430
171 Ga0209673_1000044 3300025273 Bacteria 290647
172 Ga0207696_1003155 3300025711 Bacteria 7657
173 Ga0207655_1001590 3300025728 Bacteria 20355
174 Ga0207655_1003460 3300025728 Bacteria 11738
175 Ga0207655_1004491 3300025728 Bacteria 9878
176 Ga0207655_1028683 3300025728 Bacteria 2621
177 Ga0207713_1000001 3300025735 Bacteria 2295391
178 Ga0207713_1027199 3300025735 Bacteria 2603
179 Ga0207647_10003607 3300025904 Bacteria 11589
180 Ga0207647_10039918 3300025904 Bacteria 2959
181 Ga0207699_10038378 3300025906 Bacteria 2744
182 Ga0207705_10004932 3300025909 Bacteria 10017
183 Ga0207705_10006064 3300025909 Bacteria 8990
184 Ga0207705_10008789 3300025909 Bacteria 7363
185 Ga0207707_10052094 3300025912 Bacteria 3564
186 Ga0207695_10000661 3300025913 Bacteria 67973
187 Ga0207695_10015469 3300025913 Bacteria 8980
188 Ga0207695_10051571 3300025913 Bacteria 4318
189 Ga0207695_10084901 3300025913 Bacteria 3195
190 Ga0207695_10088117 3300025913 Bacteria 3125
191 Ga0207671_10022495 3300025914 Bacteria 4766
192 Ga0207671_10057071 3300025914 Bacteria 2893
193 Ga0207671_10066883 3300025914 Bacteria 2675
194 Ga0207671_10083459 3300025914 Bacteria 2399
195 Ga0207671_10098429 3300025914 Bacteria 2212
196 Ga0207693_10140864 3300025915 Bacteria 1896
197 Ga0207660_10054571 3300025917 Bacteria 2852
198 Ga0207660_10114095 3300025917 Bacteria 2037
199 Ga0207657_10000110 3300025919 Bacteria 80294
200 Ga0207657_10004191 3300025919 Bacteria 15275
201 Ga0207652_10032219 3300025921 Bacteria 4404
202 Ga0207694_10000199 3300025924 Bacteria 60220
203 Ga0207690_10000016 3300025932 Bacteria 256657
204 Ga0207690_10176187 3300025932 Bacteria 1606
205 Ga0207706_10289009 3300025933 Bacteria 1429
206 Ga0207667_10000028 3300025949 Bacteria 334510
207 Ga0207667_10007165 3300025949 Bacteria 13460
208 Ga0207667_10009007 3300025949 Bacteria 11806
209 Ga0207667_10015099 3300025949 Bacteria 8782
210 Ga0207667_10045640 3300025949 Bacteria 4640
211 Ga0207667_10112807 3300025949 Bacteria 2803
212 Ga0207677_10201649 3300026023 Bacteria 1582
213 Ga0207678_10000574 3300026067 Bacteria 33658
214 Ga0207702_10108045 3300026078 Bacteria 2468
215 Ga0207698_10051787 3300026142 Bacteria 3140
216 Ga0207698_10128752 3300026142 Bacteria 2159
217 Ga0209281_1000168 3300027111 Bacteria 155116
218 Ga0209371_1000005 3300027312 Bacteria 1061740
219 Ga0209371_1000102 3300027312 Bacteria 151286
220 Ga0209371_1000153 3300027312 Bacteria 108815
221 Ga0209371_1000452 3300027312 Bacteria 40935
222 Ga0209371_1000550 3300027312 Bacteria 34721
223 Ga0209371_1000782 3300027312 Bacteria 26291
224 Ga0209371_1001067 3300027312 Bacteria 20503
225 Ga0209371_1001640 3300027312 Bacteria 14413
226 Ga0207428_10019650 3300027907 Bacteria 5758
227 Ga0268265_10305787 3300028380 Bacteria 1434
228 Ga0307515_10001984 3300028794 Bacteria 45309
229 Ga0268256_1000006 3300030500 Bacteria 1063991
230 Ga0268256_1000035 3300030500 Bacteria 384794
231 Ga0268256_1000421 3300030500 Bacteria 38236
232 Ga0268256_1000598 3300030500 Bacteria 28598
233 Ga0268256_1000658 3300030500 Bacteria 26291
234 Ga0268256_1006044 3300030500 Bacteria 4596
235 Ga0268256_1013617 3300030500 Bacteria 2453
236 Ga0307409_100172839 3300031995 Bacteria 1903
237 Ga0307414_10180710 3300032004 Bacteria 1696
238 Ga0373937_0388129 3300036401 Bacteria 1324
239 Ga0395899_0000241 3300037312 Bacteria 72826
240 Ga0395899_0010044 3300037312 Bacteria 7256
241 Ga0395899_0024995 3300037312 Bacteria 4511
242 Ga0395899_0059956 3300037312 Bacteria 2804
243 Ga0395900_0000074 3300037418 Bacteria 184491
244 Ga0395900_0008101 3300037418 Bacteria 10818
245 Ga0395900_0014361 3300037418 Bacteria 8084
246 Ga0395900_0037628 3300037418 Bacteria 4988
247 Ga0395900_0132441 3300037418 Bacteria 2554
248 Ga0395900_0135792 3300037418 Bacteria 2520
249 Ga0395898_0000016 3300037466 Bacteria 435585
250 Ga0395898_0140563 3300037466 Bacteria 2311
251 Ga0395898_0153602 3300037466 Bacteria 2202
252 Ga0395898_0267911 3300037466 Bacteria 1629
253 Ga0395905_0000035 3300037471 Bacteria 272014
254 Ga0436364_0685758 3300037853 Bacteria 26800
255 Ga0436364_0982830 3300037853 Bacteria 39124
256 Ga0395901_0000105 3300038443 Bacteria 114318
257 Ga0395901_0000146 3300038443 Bacteria 91706
258 Ga0395901_0000879 3300038443 Bacteria 33046
259 Ga0395901_0001472 3300038443 Bacteria 24479
260 Ga0395901_0006255 3300038443 Bacteria 12067
261 Ga0395901_0025664 3300038443 Bacteria 6049
262 Ga0395901_0037337 3300038443 Bacteria 5024
263 Ga0436365_0053006 3300039437 Bacteria 19049
264 Ga0436365_0257773 3300039437 Bacteria 1186
265 Ga0436365_0755393 3300039437 Bacteria 1516
266 Ga0436360_0157941 3300039438 Bacteria 3599
267 Ga0436360_0530048 3300039438 Bacteria 4601
268 Ga0436360_0913204 3300039438 Bacteria 2947
269 Ga0436362_1302861 3300039453 Bacteria 1573
270 Ga0439436_0000144 3300041404 Bacteria 16508
271 Ga0439447_000922 3300041407 Bacteria 10732
272 Ga0439447_004510 3300041407 Bacteria 4774
273 Ga0439466_0000001 3300041411 Bacteria 647258
274 Ga0439451_004722 3300042009 Bacteria 2770
275 Ga0439452_000001 3300042010 Bacteria 1725439
276 Ga0439452_011885 3300042010 Bacteria 2492
277 Ga0439463_007582 3300042016 Bacteria 2675
278 Ga0450907_000167 3300042146 Bacteria 24105
279 Ga0466969_0001340 3300044656 Bacteria 13284
280 Ga0466972_0088792 3300044658 Bacteria 1467
281 Ga0466965_0004474 3300044683 Bacteria 6221
282 Ga0466965_0013219 3300044683 Bacteria 3892
283 Ga0466966_0000009 3300044684 Bacteria 150954
284 Ga0466966_0018014 3300044684 Bacteria 4664
285 Ga0466961_0000825 3300044693 Bacteria 19372
286 Ga0466961_0022957 3300044693 Bacteria 4014
287 Ga0466963_0007149 3300044694 Bacteria 6651
288 Ga0466963_0066976 3300044694 Bacteria 2409
289 Ga0466971_0019947 3300044719 Bacteria 2979
290 Ga0466971_0023410 3300044719 Bacteria 2753
291 Ga0466957_0000908 3300044842 Bacteria 15151
292 Ga0466957_0004620 3300044842 Bacteria 7692
293 Ga0466957_0052128 3300044842 Bacteria 2491
294 Ga0466957_0104613 3300044842 Bacteria 1788
295 Ga0466960_0005960 3300044901 Bacteria 4863
296 Ga0466959_0006203 3300045049 Bacteria 8260
297 Ga0466959_0045586 3300045049 Bacteria 3228
298 Ga0466958_0021988 3300045836 Bacteria 3730
299 Ga0466958_0024318 3300045836 Bacteria 3564
300 Ga0466967_0319675 3300045976 Bacteria 1496
301 Ga0495617_009972 3300046452 Bacteria 3256
302 Ga0495627_006004 3300046453 Bacteria 4816
303 Ga0495603_0081097 3300046455 Bacteria 1901
304 Ga0495591_000059 3300046458 Bacteria 130522
305 Ga0495591_003010 3300046458 Bacteria 8969
306 Ga0495629_0145260 3300046459 Bacteria 1650
307 Ga0495651_0066850 3300046462 Bacteria 2743
308 Ga0495650_0007178 3300046471 Bacteria 6755
309 Ga0495580_0204833 3300046472 Bacteria 1358
310 Ga0495582_0006408 3300046473 Bacteria 6537
311 Ga0495605_0000036 3300046474 Bacteria 203902
312 Ga0495605_0061860 3300046474 Bacteria 1790
313 Ga0495639_0004600 3300046475 Bacteria 5918
314 Ga0495585_0010905 3300046492 Bacteria 5399
315 Ga0495594_0006259 3300046499 Bacteria 6121
316 Ga0495596_0001570 3300046500 Bacteria 13022
317 Ga0495607_0022885 3300046501 Bacteria 3919
318 Ga0495607_0035646 3300046501 Bacteria 3007
319 Ga0495583_0000028 3300046506 Bacteria 255787
320 Ga0495583_0003370 3300046506 Bacteria 12273
321 Ga0495583_0003876 3300046506 Bacteria 11077
322 Ga0495606_0000112 3300046507 Bacteria 138076
323 Ga0495610_0002063 3300046512 Bacteria 17146
324 Ga0495620_0000073 3300046515 Bacteria 83446
325 Ga0495628_0003075 3300046516 Bacteria 14949
326 Ga0495628_0235451 3300046516 Bacteria 1371
327 Ga0495630_0003683 3300046517 Bacteria 10683
328 Ga0495630_0022455 3300046517 Bacteria 4660
329 Ga0495630_0153010 3300046517 Bacteria 1755
330 Ga0495631_0006361 3300046518 Bacteria 6109
331 Ga0495631_0009676 3300046518 Bacteria 4807
332 Ga0495632_0016334 3300046519 Bacteria 4132
333 Ga0495637_0025327 3300046520 Bacteria 2674
334 Ga0495637_0049693 3300046520 Bacteria 1760
335 Ga0495643_0014101 3300046522 Bacteria 4765
336 Ga0495648_0000392 3300046524 Bacteria 47998
337 Ga0495648_0000560 3300046524 Bacteria 39735
338 Ga0495648_0001641 3300046524 Bacteria 21739
339 Ga0495648_0006236 3300046524 Bacteria 9753
340 Ga0495666_0010709 3300046526 Bacteria 4573
341 Ga0495652_0005427 3300046529 Bacteria 12012
342 Ga0495654_0000009 3300046530 Bacteria 381872
343 Ga0495654_0000246 3300046530 Bacteria 50620
344 Ga0495665_0000067 3300046531 Bacteria 43494
345 Ga0495586_0009005 3300046535 Bacteria 5310
346 Ga0495587_0006977 3300046536 Bacteria 7335
347 Ga0495587_0045976 3300046536 Bacteria 2593
348 Ga0495609_0000115 3300046538 Bacteria 93419
349 Ga0495597_0000635 3300046542 Bacteria 28659
350 Ga0495645_0151127 3300046543 Bacteria 1613
351 Ga0495622_0014787 3300046557 Bacteria 3627
352 Ga0495622_0018819 3300046557 Bacteria 3217
353 Ga0495633_0000028 3300046558 Bacteria 203214
354 Ga0495668_0060216 3300046616 Bacteria 2094
355 Ga0495611_0006438 3300046648 Bacteria 5006
356 Ga0495611_0014727 3300046648 Bacteria 3344
357 Ga0495635_0043006 3300046663 Bacteria 3118
358 Ga0495661_0000211 3300046665 Bacteria 67481
359 Ga0495661_0029530 3300046665 Bacteria 3498
360 Ga0495599_0011912 3300046678 Bacteria 5350
361 Ga0495623_0004181 3300046679 Bacteria 9513
362 Ga0495646_0000220 3300046680 Bacteria 28302
363 Ga0495613_0056371 3300046689 Bacteria 2885
364 Ga0495624_0000356 3300046690 Bacteria 36264
365 Ga0495670_0013367 3300046691 Bacteria 4038
366 Ga0495671_0014537 3300046692 Bacteria 4232
367 Ga0495671_0015462 3300046692 Bacteria 4087
368 Ga0495649_0009018 3300046694 Bacteria 5956
369 Ga0495589_0001586 3300046794 Bacteria 13040
370 Ga0495589_0003366 3300046794 Bacteria 8669
371 Ga0495600_0198568 3300046809 Bacteria 1288
372 Ga0495660_0002289 3300046810 Bacteria 12310
373 Ga0495581_0004683 3300047315 Bacteria 7902
374 Ga0495604_0001313 3300047317 Bacteria 20315
375 Ga0495604_0008974 3300047317 Bacteria 7906
376 Ga0495604_0025650 3300047317 Bacteria 4695
377 Ga0495674_0015050 3300047319 Bacteria 7239
378 Ga0495672_0000015 3300047320 Bacteria 502855
379 Ga0495672_0020348 3300047320 Bacteria 4352
380 Ga0495672_0052058 3300047320 Bacteria 2407
381 Ga0495680_0001377 3300047322 Bacteria 26282
382 Ga0495683_0000091 3300047323 Bacteria 91313
383 Ga0495683_0019614 3300047323 Bacteria 3490
384 Ga0495675_0007846 3300047444 Bacteria 6593
385 Ga0495679_000083 3300047446 Bacteria 87051
386 Ga0495679_002028 3300047446 Bacteria 10707
387 Ga0495673_0003738 3300047469 Bacteria 9882
388 Ga0495673_0010678 3300047469 Bacteria 4978
389 Ga0495681_0001059 3300047470 Bacteria 20990
390 Ga0495681_0008999 3300047470 Bacteria 6197
391 Ga0495681_0041952 3300047470 Bacteria 2218
392 Ga0495686_0000119 3300047472 Bacteria 165244
393 Ga0495593_0000220 3300047673 Bacteria 30381
394 Ga0495602_0001823 3300048088 Bacteria 21295
395 Ga0496100_0017350 3300048903 Bacteria 4248
396 Ga0496101_0001303 3300048904 Bacteria 14907
397 Ga0496101_0131453 3300048904 Bacteria 1901
398 Ga0496102_0001042 3300048905 Bacteria 25728
399 Ga0496102_0026784 3300048905 Bacteria 5146
400 Ga0496104_0012350 3300048907 Bacteria 7676
401 Ga0496105_0023875 3300048908 Bacteria 4965
402 Ga0496110_0118958 3300048913 Bacteria 2379
403 Ga0496116_0000143 3300048919 Bacteria 149129
404 Ga0496116_0000631 3300048919 Bacteria 46228
405 Ga0496117_0000009 3300048920 Bacteria 613759
406 Ga0496117_0000138 3300048920 Bacteria 159456
407 Ga0496117_0018566 3300048920 Bacteria 5752
408 Ga0496118_0000017 3300048921 Bacteria 549445
409 Ga0496118_0001574 3300048921 Bacteria 33838
410 Ga0496118_0008877 3300048921 Bacteria 10274
411 Ga0496118_0022653 3300048921 Bacteria 5482
412 Ga0496118_0049407 3300048921 Bacteria 3239
413 Ga0496119_0000012 3300048922 Bacteria 411917
414 Ga0496119_0000027 3300048922 Bacteria 249124
415 Ga0496119_0000773 3300048922 Bacteria 42871
416 Ga0496120_0000022 3300048923 Bacteria 249124
417 Ga0496120_0002549 3300048923 Bacteria 18169
418 Ga0496121_0000215 3300048924 Bacteria 127059
419 Ga0496121_0023412 3300048924 Bacteria 5949
420 Ga0496122_0000755 3300048925 Bacteria 62678
421 Ga0496123_0001304 3300048926 Bacteria 35436
422 Ga0496124_0008890 3300048927 Bacteria 10419
423 Ga0496124_0054585 3300048927 Bacteria 3381
424 Ga0496125_0027261 3300048928 Bacteria 5183
425 Ga0496126_0017152 3300048929 Bacteria 7221
426 Ga0496126_0067554 3300048929 Bacteria 3194
427 Ga0496126_0360485 3300048929 Bacteria 1187
428 Ga0495678_000020 3300049459 Bacteria 253654
429 Ga0495678_009432 3300049459 Bacteria 4829
430 Ga0495678_035117 3300049459 Bacteria 2058
431 Ga0495682_0000318 3300049460 Bacteria 35731
432 Ga0501032_0043052 3300049569 Bacteria 3060
433 Ga0501034_0008458 3300049571 Bacteria 10869
434 Ga0501034_0079004 3300049571 Bacteria 3293
435 Ga0501034_0129557 3300049571 Bacteria 2507
436 Ga0501034_0142212 3300049571 Bacteria 2378
437 Ga0501037_0139361 3300049573 Bacteria 1736
438 Ga0501043_0094929 3300049579 Bacteria 2344
439 Ga0501043_0303737 3300049579 Bacteria 1219
440 Ga0501046_0093306 3300049580 Bacteria 2314
441 Ga0501047_0278151 3300049581 Bacteria 1519
442 Ga0501048_0158236 3300049582 Bacteria 1603
443 nmdc:mga03683_1614_c1 3300050489 Bacteria 6754
444 nmdc:mga00v17_5650_c1 3300050491 Bacteria 3104
445 nmdc:mga00v17_93967_c1 3300050491 Bacteria 1886
446 nmdc:mga0yw44_80262_c1 3300050492 Bacteria 2043
447 nmdc:mga0k408_52779_c1 3300050493 Bacteria 2356
448 nmdc:mga06z11_18378_c1 3300050494 Bacteria 3192
449 nmdc:mga08y16_312898_c1 3300050511 Bacteria 1617
450 nmdc:mga08x19_27516_c1 3300050514 Bacteria 3556
451 nmdc:mga08x19_52928_c1 3300050514 Bacteria 2611
452 nmdc:mga0sz30_20827_c1 3300050516 Bacteria 2647
453 nmdc:mga0sz30_619_c1 3300050516 Bacteria 13165
454 Ga0500643_000207 3300053087 Bacteria 55425
455 Ga0500647_0026103 3300053091 Bacteria 2754
456 Ga0500641_0000688 3300053096 Bacteria 12215
457 Ga0500559_0001328 3300053136 Bacteria 14239
458 Ga0500616_0000459 3300053153 Bacteria 53223
459 Ga0500616_0006717 3300053153 Bacteria 7469
460 Ga0500616_0097727 3300053153 Bacteria 1441
461 Ga0500552_000382 3300053733 Bacteria 4113
462 Ga0466962_0024590 3300061719 Bacteria 2892
463 Ga0466962_0050767 3300061719 Bacteria 1983
464 2511318519 2511231015 Bacteria 6598026
465 2511331795 2511231017 Bacteria 6503007
466 2511382407 2511231025 Bacteria 5324661
467 2512352835 2512047030 Bacteria 9031815
468 2513556694 2513237082 Bacteria 8640282
469 2513563963 2513237083 Bacteria 8410967
470 2519463101 2519103095 Bacteria 6629912
471 2521557028 2521172590 Bacteria 5047645
472 2521559796 2521172590 Bacteria 5047645
473 2553004825 2551306416 Bacteria 6152985
474 2585293455 2582581311 Bacteria 6763856
475 2599501537 2599185188 Bacteria 6164180
476 2599737895 2599185239 Bacteria 8686614
477 2599746255 2599185240 Bacteria 7968121
478 2599926272 2599185299 Bacteria 4854625
479 2599931544 2599185300 Bacteria 6062622
480 2600208350 2599185355 Bacteria 7968906
481 2608671785 2608642108 Bacteria 4104624
482 2650897033 2648501693 Bacteria 5069560
483 2676744034 2675903129 Bacteria 7964495
484 2686353927 2684622997 Bacteria 4624240
485 2739306198 2738543024 Bacteria 5603683
486 2739611927 2739367655 Bacteria 4051151
487 2808972568 2808606384 Bacteria 8474373
488 2809007439 2808606390 Bacteria 8476311
489 2809014535 2808606391 Bacteria 8308166
490 2809125491 2808606414 Bacteria 4917181
491 2817263512 2816332253 Bacteria 6764532
492 2817276889 2816332256 Bacteria 6891714
493 2817457210 2816332286 Bacteria 6853759
494 2819616792 2818991449 Bacteria 5518009
495 2819631740 2818991452 Bacteria 8442785
496 2842333927 2842333319 Bacteria 8899485
497 2844528899 2844528606 Bacteria 4733806
498 2847086938 2847085930 Bacteria 5070450
499 2847799216 2847797336 Bacteria 5176640
500 2857365044 2857357740 Bacteria 9937880
501 2863422993 2863421361 Bacteria 7300805
502 2865017946 2865014394 Bacteria 4764573
503 2870075716 2870068957 Bacteria 8925310
504 2881612791 2881609920 Bacteria 4405319
505 2881929680 2881927736 Bacteria 3993927
506 2885279509 2885270888 Bacteria 9831543
507 2889790929 2889790730 Bacteria 5689708
508 2889918362 2889914905 Bacteria 5702301
509 2900640672 2900634093 Bacteria 10263517
510 2904440270 2904439833 Bacteria 5931679
511 2904485498 2904483920 Bacteria 7545285
512 2904530818 2904530477 Bacteria 5876334
513 2904566833 2904564687 Bacteria 7609577
514 2904574223 2904571731 Bacteria 7608790
515 2904585768 2904584206 Bacteria 6028872
516 2904592419 2904589729 Bacteria 6113573
517 2904601447 2904601388 Bacteria 5884906
518 2908447627 2908446538 Bacteria 6829095
519 2919047515 2919046199 Bacteria 5567169
520 2919049835 2919046199 Bacteria 5567169
521 2919082902 2919079590 Bacteria 5946433
522 2923515658 2923510766 Bacteria 5926163
523 2928134557 2928130867 Bacteria 5467269
524 2928162334 2928157003 Bacteria 7522202
525 2928166242 2928163908 Bacteria 7561269
526 2928173597 2928170801 Bacteria 8785406
527 2928539733 2928536128 Bacteria 7657547
528 2945952463 2945951305 Bacteria 4918162
529 2981995672 2981990288 Bacteria 7590678
530 2984497236 2984494565 Bacteria 5000175
531 2990261188 2990261002 Bacteria 4919493
532 2996316777 2996310559 Bacteria 6357320
533 642414370 641736154 Bacteria 7689995
534 642616601 642555113 Bacteria 8214658
535 8002286502 8002285264 Bacteria 6717907
536 8003960102 8003955200 Bacteria 8601927
537 8018847469 8018845410 Bacteria 8933938
538 8020813373 8020807995 Bacteria 6801506
539 8020940503 8020938398 Bacteria 7472757
540 8020951143 8020945358 Bacteria 8467355
541 8020955118 8020953355 Bacteria 7439080
542 8021125008 8021120328 Bacteria 8782274
543 8040170106 8040167225 Bacteria 6542727
544 8040175335 8040173305 Bacteria 6827067
545 Ga0105240_10004321
546 JGI24739J22299_10031577
547 JGI25156J39149_1000205
548 JGI25154J39366_1000101
549 JGI25165J46597_1001595
550 JGI25165J46597_1005351
551 rootH1_10062809
552 rootH2_10047895
553 rootH1_10083155
554 Ga0055538_1000008
555 Ga0055538_1000084
556 Ga0055539_1000012
557 Ga0055533_1000015
558 Ga0055533_1000095
559 Ga0055533_1008087
560 Ga0055532_1000010
561 Ga0055532_1000264
562 Ga0055532_1000351
563 Ga0055532_1000512
564 Ga0055525_1000017
565 Ga0055527_1000008
566 Ga0055527_1000268
567 Ga0055535_1000007
568 Ga0055535_1000157
569 Ga0055535_1000563
570 Ga0055542_1000011
571 Ga0055542_1000204
572 Ga0055542_1002102
573 Ga0055529_1000009
574 Ga0055529_1000221
575 Ga0055528_1001385
576 Ga0055541_1000009
577 Ga0058692_1000098
578 Ga0058692_1000202
579 Ga0058692_1001424
580 Ga0070658_10003024
581 Ga0070658_10039170
582 Ga0070683_100027919
583 Ga0070680_100017398
584 Ga0070660_100000457
585 Ga0070691_10001406
586 Ga0070668_100014373
587 Ga0070675_100251586
588 Ga0070659_100000108
589 Ga0070709_10037203
590 Ga0070662_100023500
591 Ga0070681_10000320
592 Ga0070698_100001190
593 Ga0070679_100004504
594 Ga0070697_100025217
595 Ga0070665_100013946
596 Ga0070665_100058939
597 Ga0068855_100000838
598 Ga0068855_100000904
599 Ga0068855_100058519
600 Ga0068855_100122262
601 Ga0070664_100060345
602 Ga0070664_100065890
603 Ga0068857_100219106
604 Ga0068854_100131749
605 Ga0068856_100046845
606 Ga0068856_100100644
607 Ga0068852_100017751
608 Ga0068852_100092879
609 Ga0081455_10000116
610 Ga0081455_10008619
611 Ga0081455_10024560
612 Ga0081539_10003020
613 Ga0081539_10016756
614 Ga0075365_10059001
615 Ga0075365_10082610
616 Ga0075432_10000877
617 Ga0070712_100108276
618 Ga0075362_10038336
619 Ga0075362_10078907
620 Ga0075367_10004904
621 Ga0075369_10001815
622 Ga0075369_10066329
623 Ga0075436_100018894
624 Ga0075436_100054452
625 Ga0079104_1000068
626 Ga0105251_10001827
627 Ga0105244_10000333
628 Ga0105244_10008807
629 Ga0105244_10028520
630 Ga0105240_10000586
631 Ga0105240_10096407
632 Ga0105240_10106278
633 Ga0105240_10109642
634 Ga0111539_10324922
635 Ga0105237_10015581
636 Ga0105237_10029105
637 Ga0105237_10033998
638 Ga0105237_10077543
639 Ga0105237_10436713
640 Ga0105238_10000111
641 Ga0105239_10046397
642 Ga0105246_10003091
643 Ga0157373_10006300
644 Ga0157373_10009596
645 Ga0157371_10022553
646 Ga0157371_10176889
647 Ga0157370_10000260
648 Ga0157370_10003456
649 Ga0157370_10008025
650 Ga0157370_10034702
651 Ga0157370_10103259
652 Ga0157369_10000214
653 Ga0157369_10004707
654 Ga0157369_10008342
655 Ga0157369_10091243
656 Ga0157369_10212156
657 Ga0157374_10002568
658 Ga0163162_10260013
659 Ga0157372_10024223
660 Ga0157372_10069853
661 Ga0157372_10081515
662 Ga0157372_10084477
663 Ga0182006_1002600
664 Ga0182006_1006021
665 Ga0182006_1008796
666 Ga0182007_10001588
667 Ga0182005_1021802
668 Ga0163161_10020929
669 Ga0213872_10002340
670 Ga0213875_10004095
671 Ga0213871_10000826
672 Ga0209435_100069
673 Ga0209784_100005
674 Ga0209784_100066
675 Ga0209566_100005
676 Ga0209566_100125
677 Ga0209566_100510
678 Ga0209674_100009
679 Ga0209674_100022
680 Ga0209674_100344
681 Ga0209674_100497
682 Ga0209672_100001
683 Ga0209672_100040
684 Ga0209672_100044
685 Ga0209672_100120
686 Ga0209672_101665
687 Ga0209147_100001
688 Ga0209147_100037
689 Ga0209147_100039
690 Ga0209147_100048
691 Ga0209563_100012
692 Ga0209563_100370
693 Ga0207427_100612
694 Ga0209437_100212
695 Ga0209258_100001
696 Ga0209258_100062
697 Ga0209258_100070
698 Ga0209646_1000108
699 Ga0209026_1000508
700 Ga0209677_100006
701 Ga0209148_1000003
702 Ga0209148_1000075
703 Ga0209148_1000691
704 Ga0209759_1000002
705 Ga0209759_1000101
706 Ga0209759_1000173
707 Ga0209759_1000380
708 Ga0209759_1007207
709 Ga0209759_1015973
710 Ga0209233_1000061
711 Ga0209233_1011188
712 Ga0209455_1000001
713 Ga0209455_1000067
714 Ga0209455_1000384
715 Ga0209673_1000044
716 Ga0207696_1003155
717 Ga0207655_1001590
718 Ga0207655_1003460
719 Ga0207655_1004491
720 Ga0207655_1028683
721 Ga0207713_1000001
722 Ga0207713_1027199
723 Ga0207647_10003607
724 Ga0207647_10039918
725 Ga0207699_10038378
726 Ga0207705_10004932
727 Ga0207705_10006064
728 Ga0207705_10008789
729 Ga0207707_10052094
730 Ga0207695_10000661
731 Ga0207695_10015469
732 Ga0207695_10051571
733 Ga0207695_10084901
734 Ga0207695_10088117
735 Ga0207671_10022495
736 Ga0207671_10057071
737 Ga0207671_10066883
738 Ga0207671_10083459
739 Ga0207671_10098429
740 Ga0207693_10140864
741 Ga0207660_10054571
742 Ga0207660_10114095
743 Ga0207657_10000110
744 Ga0207657_10004191
745 Ga0207652_10032219
746 Ga0207694_10000199
747 Ga0207690_10000016
748 Ga0207690_10176187
749 Ga0207706_10289009
750 Ga0207667_10000028
751 Ga0207667_10007165
752 Ga0207667_10009007
753 Ga0207667_10015099
754 Ga0207667_10045640
755 Ga0207667_10112807
756 Ga0207677_10201649
757 Ga0207678_10000574
758 Ga0207702_10108045
759 Ga0207698_10051787
760 Ga0207698_10128752
761 Ga0209281_1000168
762 Ga0209371_1000005
763 Ga0209371_1000102
764 Ga0209371_1000153
765 Ga0209371_1000452
766 Ga0209371_1000550
767 Ga0209371_1000782
768 Ga0209371_1001067
769 Ga0209371_1001640
770 Ga0207428_10019650
771 Ga0268265_10305787
772 Ga0307515_10001984
773 Ga0268256_1000006
774 Ga0268256_1000035
775 Ga0268256_1000421
776 Ga0268256_1000598
777 Ga0268256_1000658
778 Ga0268256_1006044
779 Ga0268256_1013617
780 Ga0307409_100172839
781 Ga0307414_10180710
782 Ga0373937_0388129
783 Ga0395899_0000241
784 Ga0395899_0010044
785 Ga0395899_0024995
786 Ga0395899_0059956
787 Ga0395900_0000074
788 Ga0395900_0008101
789 Ga0395900_0014361
790 Ga0395900_0037628
791 Ga0395900_0132441
792 Ga0395900_0135792
793 Ga0395898_0000016
794 Ga0395898_0140563
795 Ga0395898_0153602
796 Ga0395898_0267911
797 Ga0395905_0000035
798 Ga0436364_0685758
799 Ga0436364_0982830
800 Ga0395901_0000105
801 Ga0395901_0000146
802 Ga0395901_0000879
803 Ga0395901_0001472
804 Ga0395901_0006255
805 Ga0395901_0025664
806 Ga0395901_0037337
807 Ga0436365_0053006
808 Ga0436365_0257773
809 Ga0436365_0755393
810 Ga0436360_0157941
811 Ga0436360_0530048
812 Ga0436360_0913204
813 Ga0436362_1302861
814 Ga0439436_0000144
815 Ga0439447_000922
816 Ga0439447_004510
817 Ga0439466_0000001
818 Ga0439451_004722
819 Ga0439452_000001
820 Ga0439452_011885
821 Ga0439463_007582
822 Ga0450907_000167
823 Ga0466969_0001340
824 Ga0466972_0088792
825 Ga0466965_0004474
826 Ga0466965_0013219
827 Ga0466966_0000009
828 Ga0466966_0018014
829 Ga0466961_0000825
830 Ga0466961_0022957
831 Ga0466963_0007149
832 Ga0466963_0066976
833 Ga0466971_0019947
834 Ga0466971_0023410
835 Ga0466957_0000908
836 Ga0466957_0004620
837 Ga0466957_0052128
838 Ga0466957_0104613
839 Ga0466960_0005960
840 Ga0466959_0006203
841 Ga0466959_0045586
842 Ga0466958_0021988
843 Ga0466958_0024318
844 Ga0466967_0319675
845 Ga0495617_009972
846 Ga0495627_006004
847 Ga0495603_0081097
848 Ga0495591_000059
849 Ga0495591_003010
850 Ga0495629_0145260
851 Ga0495651_0066850
852 Ga0495650_0007178
853 Ga0495580_0204833
854 Ga0495582_0006408
855 Ga0495605_0000036
856 Ga0495605_0061860
857 Ga0495639_0004600
858 Ga0495585_0010905
859 Ga0495594_0006259
860 Ga0495596_0001570
861 Ga0495607_0022885
862 Ga0495607_0035646
863 Ga0495583_0000028
864 Ga0495583_0003370
865 Ga0495583_0003876
866 Ga0495606_0000112
867 Ga0495610_0002063
868 Ga0495620_0000073
869 Ga0495628_0003075
870 Ga0495628_0235451
871 Ga0495630_0003683
872 Ga0495630_0022455
873 Ga0495630_0153010
874 Ga0495631_0006361
875 Ga0495631_0009676
876 Ga0495632_0016334
877 Ga0495637_0025327
878 Ga0495637_0049693
879 Ga0495643_0014101
880 Ga0495648_0000392
881 Ga0495648_0000560
882 Ga0495648_0001641
883 Ga0495648_0006236
884 Ga0495666_0010709
885 Ga0495652_0005427
886 Ga0495654_0000009
887 Ga0495654_0000246
888 Ga0495665_0000067
889 Ga0495586_0009005
890 Ga0495587_0006977
891 Ga0495587_0045976
892 Ga0495609_0000115
893 Ga0495597_0000635
894 Ga0495645_0151127
895 Ga0495622_0014787
896 Ga0495622_0018819
897 Ga0495633_0000028
898 Ga0495668_0060216
899 Ga0495611_0006438
900 Ga0495611_0014727
901 Ga0495635_0043006
902 Ga0495661_0000211
903 Ga0495661_0029530
904 Ga0495599_0011912
905 Ga0495623_0004181
906 Ga0495646_0000220
907 Ga0495613_0056371
908 Ga0495624_0000356
909 Ga0495670_0013367
910 Ga0495671_0014537
911 Ga0495671_0015462
912 Ga0495649_0009018
913 Ga0495589_0001586
914 Ga0495589_0003366
915 Ga0495600_0198568
916 Ga0495660_0002289
917 Ga0495581_0004683
918 Ga0495604_0001313
919 Ga0495604_0008974
920 Ga0495604_0025650
921 Ga0495674_0015050
922 Ga0495672_0000015
923 Ga0495672_0020348
924 Ga0495672_0052058
925 Ga0495680_0001377
926 Ga0495683_0000091
927 Ga0495683_0019614
928 Ga0495675_0007846
929 Ga0495679_000083
930 Ga0495679_002028
931 Ga0495673_0003738
932 Ga0495673_0010678
933 Ga0495681_0001059
934 Ga0495681_0008999
935 Ga0495681_0041952
936 Ga0495686_0000119
937 Ga0495593_0000220
938 Ga0495602_0001823
939 Ga0496100_0017350
940 Ga0496101_0001303
941 Ga0496101_0131453
942 Ga0496102_0001042
943 Ga0496102_0026784
944 Ga0496104_0012350
945 Ga0496105_0023875
946 Ga0496110_0118958
947 Ga0496116_0000143
948 Ga0496116_0000631
949 Ga0496117_0000009
950 Ga0496117_0000138
951 Ga0496117_0018566
952 Ga0496118_0000017
953 Ga0496118_0001574
954 Ga0496118_0008877
955 Ga0496118_0022653
956 Ga0496118_0049407
957 Ga0496119_0000012
958 Ga0496119_0000027
959 Ga0496119_0000773
960 Ga0496120_0000022
961 Ga0496120_0002549
962 Ga0496121_0000215
963 Ga0496121_0023412
964 Ga0496122_0000755
965 Ga0496123_0001304
966 Ga0496124_0008890
967 Ga0496124_0054585
968 Ga0496125_0027261
969 Ga0496126_0017152
970 Ga0496126_0067554
971 Ga0496126_0360485
972 Ga0495678_000020
973 Ga0495678_009432
974 Ga0495678_035117
975 Ga0495682_0000318
976 Ga0501032_0043052
977 Ga0501034_0008458
978 Ga0501034_0079004
979 Ga0501034_0129557
980 Ga0501034_0142212
981 Ga0501037_0139361
982 Ga0501043_0094929
983 Ga0501043_0303737
984 Ga0501046_0093306
985 Ga0501047_0278151
986 Ga0501048_0158236
987 nmdc:mga03683_1614_c1
988 nmdc:mga00v17_5650_c1
989 nmdc:mga00v17_93967_c1
990 nmdc:mga0yw44_80262_c1
991 nmdc:mga0k408_52779_c1
992 nmdc:mga06z11_18378_c1
993 nmdc:mga08y16_312898_c1
994 nmdc:mga08x19_27516_c1
995 nmdc:mga08x19_52928_c1
996 nmdc:mga0sz30_20827_c1
997 nmdc:mga0sz30_619_c1
998 Ga0500643_000207
999 Ga0500647_0026103
1000 Ga0500641_0000688
1001 Ga0500559_0001328
1002 Ga0500616_0000459
1003 Ga0500616_0006717
1004 Ga0500616_0097727
1005 Ga0500552_000382
1006 Ga0466962_0024590
1007 Ga0466962_0050767
1008 2511318519
1009 2511331795
1010 2511382407
1011 2512352835
1012 2513556694
1013 2513563963
1014 2519463101
1015 2521557028
1016 2521559796
1017 2553004825
1018 2585293455
1019 2599501537
1020 2599737895
1021 2599746255
1022 2599926272
1023 2599931544
1024 2600208350
1025 2608671785
1026 2650897033
1027 2676744034
1028 2686353927
1029 2739306198
1030 2739611927
1031 2808972568
1032 2809007439
1033 2809014535
1034 2809125491
1035 2817263512
1036 2817276889
1037 2817457210
1038 2819616792
1039 2819631740
1040 2842333927
1041 2844528899
1042 2847086938
1043 2847799216
1044 2857365044
1045 2863422993
1046 2865017946
1047 2870075716
1048 2881612791
1049 2881929680
1050 2885279509
1051 2889790929
1052 2889918362
1053 2900640672
1054 2904440270
1055 2904485498
1056 2904530818
1057 2904566833
1058 2904574223
1059 2904585768
1060 2904592419
1061 2904601447
1062 2908447627
1063 2919047515
1064 2919049835
1065 2919082902
1066 2923515658
1067 2928134557
1068 2928162334
1069 2928166242
1070 2928173597
1071 2928539733
1072 2945952463
1073 2981995672
1074 2984497236
1075 2990261188
1076 2996316777
1077 642414370
1078 642616601
1079 8002286502
1080 8003960102
1081 8018847469
1082 8020813373
1083 8020940503
1084 8020951143
1085 8020955118
1086 8021125008
1087 8040170106
1088 8040175335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

110

423

0.95

PF07687

M20_dimer

Peptidase dimerisation domain

223

321

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ewt-assembly1.cif.gz_D the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus 0.9544 5 387
4ewt-assembly1.cif.gz_B the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus 0.9495 5 384
1ysj-assembly1.cif.gz_A crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family 0.9427 8 390
1ysj-assembly1.cif.gz_B crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family 0.9427 8 390
1ysj-assembly1.cif.gz_B crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family 0.9376 8 390
ID Description Score Start End Superfamily
af_A0A0R0IPM0_41_149_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9732 183 290 3.30.70.360
af_A0A0R0IPM1_21_184_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9674 11 119 3.40.630.10
4ewtD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9627 182 295 3.30.70.360
af_A0A0R0IPM0_41_149_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.956 183 290 3.30.70.360
4ewtD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9466 182 295 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A3A1VML7-F1-model_v4 deleted 0.9813 109 279
AF-A0A1C2EDY4-F1-model_v4 Peptidase M20 0.9771 5 387 GO:0016787
GO:0046872
AF-A0A164HNZ5-F1-model_v4 Putative Thermostable carboxypeptidase 1 0.9766 4 164 GO:0004180
AF-A0A848EJJ0-F1-model_v4 Amidohydrolase 0.9765 1 387 GO:0016787
GO:0046872
AF-A0A534GGS6-F1-model_v4 Amidohydrolase 0.9758 5 110 GO:0016787

Map