F461986

General Info

Members Datasets Scaffolds Average Seq Length
546 349 1092 377

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10004619|Ga0105240_1000461915
Length 428
Sequence LGWPGGNSVSAATAKAAGGFVRPREGRTSLPRDNRGFRPARPGRDPLQIIDPTGDIRMLLSRVPFAARSLVVAGAAEAISGPAGQYGQSIRNGFQLAVDEINAAGGVKGNKIALQVEDEQGKKEQAIDVFKKLIFQDKVLMLFGPTLSNSAQAADPIAQAAKVVVFGTSNTADGITSIGDYVFRNSVTEADVLPETLRVAAKHTGLKKVAVMYGNDDVFTKSGYDAFKKALEDLKIPVTTTETFAKGDVDFKAQLTKIKASGADAIVLSALIAEGAPIMVQARQLGIDLPVIGGNGMNSAKIFDLAKEKSDNLWVGSPWALGNQTKENEHFVVAYTQKYKAAPDQFSAQAYDAMNIAAQALGKIKLSGDLAADRKALRDALPSVTWTGATGAFKFRQAMDKSGKPAGHDAQQAAIVSVTKGGKYSIEK

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
122 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
136 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
139 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
140 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
141 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
201 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
215 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
216 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
217 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
226 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
227 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
245 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
262 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
302 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
305 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
306 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
307 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
310 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
315 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
316 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
317 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
318 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
319 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
320 2643221569 Achromobacter sp. Root565 Isolate Unclassified
321 2643221594 Achromobacter sp. Root170 Isolate Unclassified
322 2643221621 Achromobacter sp. Root83 Isolate Unclassified
323 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
324 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
325 2738541277 Variovorax sp. GV051 Isolate Unclassified
326 2738541307 Variovorax sp. GV008 Isolate Unclassified
327 2738543019 Variovorax sp. GV040 Isolate Unclassified
328 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
329 2818991436 Collimonas arenae 515 Isolate Unclassified
330 2818991446 Variovorax sp. 1180 Isolate Unclassified
331 2855730933 Achromobacter sp. HZ28 Isolate Nodule
332 2855767633 Achromobacter sp. HZ34 Isolate Nodule
333 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
334 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
335 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
336 2858950400 Achromobacter sp. K91 Isolate Unclassified
337 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
338 2885266251 Ralstonia sp. SET104 Isolate Nodule
339 2899924645 Variovorax sp. 369 Isolate Unclassified
340 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
341 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
342 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
343 2928037797 Variovorax sp. 1126 Isolate Unclassified
344 2928044640 Variovorax sp. 1128 Isolate Unclassified
345 2928051484 Variovorax sp. 1133 Isolate Unclassified
346 2928058823 Ralstonia sp. 1138 Isolate Unclassified
347 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
348 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
349 2941479691

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 0.92
Isolates 6.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.5
Nodule 0.55
Rhizoplane 2.38
Rhizosphere 64.1
Stem 0
Stem Tuber 0
Unclassified 5.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10004619 3300009093 Bacteria 20879
2 JGI24741J21665_1000196 3300001915 Bacteria 17817
3 JGI24740J21852_10002700 3300001979 Bacteria 7967
4 JGI24740J21852_10003016 3300001979 Bacteria 7454
5 JGI25156J39149_1000060 3300002705 Bacteria 84857
6 JGI25156J39149_1000175 3300002705 Bacteria 47051
7 JGI25156J39149_1001779 3300002705 Bacteria 8529
8 JGI25156J39149_1016653 3300002705 Bacteria 1422
9 JGI25162J39368_1000036 3300002737 Bacteria 180433
10 JGI25154J39366_1000129 3300002738 Bacteria 59399
11 JGI25154J39366_1002385 3300002738 Bacteria 4930
12 JGI25157J39369_1000029 3300002741 Bacteria 146928
13 JGI25164J39214_1003957 3300002772 Bacteria 1772
14 JGI25151J46595_10000137 3300003187 Bacteria 96370
15 JGI25151J46595_10030179 3300003187 Bacteria 2135
16 JGI25165J46597_1000022 3300003214 Bacteria 357959
17 rootH1_10009484 3300003316 Bacteria 3739
18 rootH1_10017612 3300003316 Bacteria 3441
19 rootH2_10006384 3300003320 Bacteria 8049
20 rootH2_10082770 3300003320 Bacteria 3290
21 rootH1_10024154 3300003323 Bacteria 5841
22 rootH1_10142259 3300003323 Bacteria 3751
23 Ga0055538_1000011 3300003751 Bacteria 357959
24 Ga0055539_1000016 3300003752 Bacteria 358248
25 Ga0055539_1000081 3300003752 Bacteria 122891
26 Ga0055539_1000118 3300003752 Bacteria 86566
27 Ga0055539_1000739 3300003752 Bacteria 8155
28 Ga0055533_1000010 3300003756 Bacteria 491196
29 Ga0055533_1000019 3300003756 Bacteria 357959
30 Ga0055533_1000421 3300003756 Bacteria 16356
31 Ga0055532_1000048 3300003758 Bacteria 175560
32 Ga0055525_1000042 3300003759 Bacteria 279804
33 Ga0055525_1000273 3300003759 Bacteria 48163
34 Ga0055525_1000415 3300003759 Bacteria 25986
35 Ga0055527_1003308 3300003760 Bacteria 2435
36 Ga0055535_1000035 3300003761 Bacteria 175560
37 Ga0055535_1000076 3300003761 Bacteria 111203
38 Ga0055535_1000282 3300003761 Bacteria 53559
39 Ga0055542_1000009 3300003762 Bacteria 416550
40 Ga0055542_1000724 3300003762 Bacteria 25809
41 Ga0055529_1000101 3300003763 Bacteria 130709
42 Ga0055529_1000491 3300003763 Bacteria 36152
43 Ga0055529_1000810 3300003763 Bacteria 18955
44 Ga0055530_10020060 3300003791 Bacteria 2008
45 Ga0055540_1008797 3300003792 Bacteria 3582
46 Ga0055541_1000017 3300003841 Bacteria 286811
47 Ga0055541_1001235 3300003841 Bacteria 5646
48 Ga0065712_10000421 3300005290 Bacteria 18901
49 Ga0065712_10002802 3300005290 Bacteria 10865
50 Ga0065715_10012795 3300005293 Bacteria 4959
51 Ga0065715_10089174 3300005293 Bacteria 13129
52 Ga0065707_10190054 3300005295 Bacteria 1350
53 Ga0070658_10016597 3300005327 Bacteria 5892
54 Ga0070658_10129050 3300005327 Bacteria 2106
55 Ga0070676_10024807 3300005328 Bacteria 3382
56 Ga0070676_10038698 3300005328 Unclassified 2755
57 Ga0070690_100041526 3300005330 Unclassified 2912
58 Ga0070690_100064191 3300005330 Bacteria 2371
59 Ga0070670_100000191 3300005331 Bacteria 56346
60 Ga0070670_100068546 3300005331 Bacteria 3045
61 Ga0070677_10018449 3300005333 Bacteria 2512
62 Ga0070666_10020261 3300005335 Bacteria 4299
63 Ga0070666_10200122 3300005335 Bacteria 1405
64 Ga0070680_100002615 3300005336 Bacteria 13332
65 Ga0070682_100011098 3300005337 Bacteria 5139
66 Ga0068868_100010559 3300005338 Bacteria 6692
67 Ga0070687_100051249 3300005343 Unclassified 2136
68 Ga0070661_100000370 3300005344 Bacteria 35389
69 Ga0070661_100003806 3300005344 Bacteria 10397
70 Ga0070669_100064626 3300005353 Unclassified 2695
71 Ga0070675_100054510 3300005354 Bacteria 3290
72 Ga0070675_100070187 3300005354 Unclassified 2903
73 Ga0070671_100005369 3300005355 Bacteria 10216
74 Ga0070671_100025924 3300005355 Bacteria 4814
75 Ga0070671_100034890 3300005355 Unclassified 4165
76 Ga0070671_100161985 3300005355 Bacteria 1891
77 Ga0070674_100007062 3300005356 Bacteria 6603
78 Ga0070673_100055185 3300005364 Bacteria 3130
79 Ga0070673_100071309 3300005364 Bacteria 2791
80 Ga0070659_100014344 3300005366 Bacteria 5921
81 Ga0070659_100037086 3300005366 Bacteria 3800
82 Ga0070667_100063802 3300005367 Bacteria 3123
83 Ga0070667_100081858 3300005367 Bacteria 2763
84 Ga0070705_100020941 3300005440 Unclassified 3471
85 Ga0070700_100006624 3300005441 Bacteria 6202
86 Ga0070694_100015923 3300005444 Bacteria 4730
87 Ga0070708_100000336 3300005445 Bacteria 35498
88 Ga0070663_100000024 3300005455 Bacteria 108544
89 Ga0070663_100043513 3300005455 Unclassified 3161
90 Ga0070678_100030127 3300005456 Bacteria 3725
91 Ga0070678_100030389 3300005456 Unclassified 3713
92 Ga0070662_100026282 3300005457 Unclassified 4030
93 Ga0070662_100059309 3300005457 Bacteria 2788
94 Ga0070681_10018223 3300005458 Bacteria 7018
95 Ga0070681_10079034 3300005458 Bacteria 3246
96 Ga0068867_100022324 3300005459 Unclassified 4524
97 Ga0070706_100002692 3300005467 Bacteria 17790
98 Ga0070698_100251532 3300005471 Bacteria 1700
99 Ga0070698_100291246 3300005471 Bacteria 1564
100 Ga0070699_100139989 3300005518 Bacteria 2136
101 Ga0070679_100024625 3300005530 Bacteria 5899
102 Ga0070679_100052774 3300005530 Bacteria 4047
103 Ga0070697_100022408 3300005536 Bacteria 5013
104 Ga0070672_100064127 3300005543 Bacteria 2902
105 Ga0070695_100005789 3300005545 Bacteria 7283
106 Ga0070696_100014843 3300005546 Bacteria 5228
107 Ga0070696_100018017 3300005546 Bacteria 4770
108 Ga0070693_100044899 3300005547 Unclassified 2502
109 Ga0070665_100008996 3300005548 Bacteria 10112
110 Ga0070665_100219927 3300005548 Bacteria 1900
111 Ga0070704_100034440 3300005549 Unclassified 3435
112 Ga0070664_100000022 3300005564 Bacteria 108544
113 Ga0070664_100016829 3300005564 Bacteria 6002
114 Ga0068857_100026215 3300005577 Bacteria 5136
115 Ga0068857_100111768 3300005577 Bacteria 2456
116 Ga0068857_100166686 3300005577 Bacteria 2001
117 Ga0068854_100000336 3300005578 Bacteria 30476
118 Ga0068854_100004203 3300005578 Bacteria 9067
119 Ga0068854_100016099 3300005578 Bacteria 4974
120 Ga0068854_100077689 3300005578 Bacteria 2443
121 Ga0068856_100000049 3300005614 Bacteria 108544
122 Ga0068856_100005146 3300005614 Bacteria 12913
123 Ga0068856_100097086 3300005614 Unclassified 2935
124 Ga0068859_100111632 3300005617 Bacteria 2797
125 Ga0068864_100009857 3300005618 Bacteria 7877
126 Ga0068870_10011924 3300005840 Bacteria 4045
127 Ga0068863_100308158 3300005841 Bacteria 1537
128 Ga0068858_100213312 3300005842 Bacteria 1827
129 Ga0068860_100123403 3300005843 Bacteria 2481
130 Ga0075365_10004760 3300006038 Bacteria 7235
131 Ga0075363_100016697 3300006048 Bacteria 3630
132 Ga0075364_10204542 3300006051 Bacteria 1339
133 Ga0070712_100044125 3300006175 Bacteria 3073
134 Ga0075362_10000766 3300006177 Bacteria 9569
135 Ga0075367_10019273 3300006178 Bacteria 3781
136 Ga0075367_10058564 3300006178 Bacteria 2292
137 Ga0075366_10024677 3300006195 Bacteria 3507
138 Ga0097621_100221734 3300006237 Bacteria 1648
139 Ga0075370_10002838 3300006353 Bacteria 8130
140 Ga0075370_10033148 3300006353 Bacteria 2891
141 Ga0068871_100333652 3300006358 Bacteria 1338
142 Ga0075430_100208405 3300006846 Bacteria 1622
143 Ga0075431_100003080 3300006847 Bacteria 16154
144 Ga0075433_10041459 3300006852 Bacteria 3989
145 Ga0075433_10082925 3300006852 Bacteria 2829
146 Ga0075434_100025998 3300006871 Bacteria 5731
147 Ga0075434_100063792 3300006871 Bacteria 3667
148 Ga0075429_100025185 3300006880 Bacteria 5165
149 Ga0068865_100042100 3300006881 Bacteria 3112
150 Ga0068865_100086607 3300006881 Bacteria 2262
151 Ga0097620_100111626 3300006931 Bacteria 2797
152 Ga0075435_100113729 3300007076 Bacteria 2253
153 Ga0099794_10003558 3300007265 Bacteria 5965
154 Ga0099794_10014932 3300007265 Bacteria 3415
155 Ga0105244_10025014 3300009036 Bacteria 3251
156 Ga0105240_10078101 3300009093 Bacteria 4077
157 Ga0105240_10098010 3300009093 Bacteria 3571
158 Ga0111539_10102731 3300009094 Unclassified 3355
159 Ga0105245_10006581 3300009098 Bacteria 10200
160 Ga0105245_10022850 3300009098 Bacteria 5487
161 Ga0114129_10003918 3300009147 Bacteria 21004
162 Ga0114129_10057414 3300009147 Bacteria 5447
163 Ga0114129_10403563 3300009147 Bacteria 1801
164 Ga0105243_10354979 3300009148 Bacteria 1347
165 Ga0105241_10046984 3300009174 Unclassified 3280
166 Ga0105241_10315112 3300009174 Bacteria 1347
167 Ga0105242_10091188 3300009176 Bacteria 2565
168 Ga0105242_10134701 3300009176 Bacteria 2137
169 Ga0105237_10003650 3300009545 Bacteria 18149
170 Ga0105237_10178738 3300009545 Bacteria 2122
171 Ga0105237_10200135 3300009545 Bacteria 1997
172 Ga0105238_10038373 3300009551 Bacteria 4865
173 Ga0105238_10076445 3300009551 Bacteria 3339
174 Ga0105239_10009773 3300010375 Bacteria 10783
175 Ga0105239_10026856 3300010375 Bacteria 6336
176 Ga0105239_10122142 3300010375 Bacteria 2893
177 Ga0105239_10148129 3300010375 Bacteria 2619
178 Ga0105246_10051850 3300011119 Bacteria 2818
179 Ga0105246_10083087 3300011119 Bacteria 2287
180 Ga0157373_10003934 3300013100 Bacteria 11217
181 Ga0157373_10008463 3300013100 Bacteria 7639
182 Ga0157373_10014407 3300013100 Bacteria 5796
183 Ga0157371_10000089 3300013102 Bacteria 145483
184 Ga0157370_10000002 3300013104 Bacteria 431400
185 Ga0157369_10018918 3300013105 Bacteria 7718
186 Ga0157374_10016308 3300013296 Bacteria 6526
187 Ga0157378_10013757 3300013297 Bacteria 7077
188 Ga0157378_10021758 3300013297 Bacteria 5639
189 Ga0157378_10091596 3300013297 Bacteria 2765
190 Ga0157378_10106430 3300013297 Bacteria 2566
191 Ga0163162_10044858 3300013306 Bacteria 4429
192 Ga0163162_10059556 3300013306 Bacteria 3851
193 Ga0163162_10115914 3300013306 Bacteria 2780
194 Ga0163162_10159051 3300013306 Unclassified 2380
195 Ga0157372_10000149 3300013307 Bacteria 76796
196 Ga0157372_10145094 3300013307 Bacteria 2737
197 Ga0157380_10063112 3300014326 Unclassified 2970
198 Ga0182008_10003693 3300014497 Bacteria 9130
199 Ga0182008_10007653 3300014497 Bacteria 5953
200 Ga0157379_10048868 3300014968 Bacteria 3776
201 Ga0157376_10024430 3300014969 Bacteria 4744
202 Ga0182006_1027763 3300015261 Bacteria 2307
203 Ga0182007_10000908 3300015262 Bacteria 16394
204 Ga0182007_10036058 3300015262 Bacteria 1665
205 Ga0183362_10003 3300015683 Bacteria 977584
206 Ga0206351_10088450 3300020077 Bacteria 1682
207 Ga0213872_10000453 3300021361 Bacteria 33422
208 Ga0213872_10011834 3300021361 Bacteria 4122
209 Ga0224712_10054704 3300022467 Bacteria 1568
210 Ga0209784_100019 3300025224 Bacteria 453558
211 Ga0209784_100024 3300025224 Bacteria 394613
212 Ga0209784_100435 3300025224 Bacteria 18206
213 Ga0209784_100569 3300025224 Bacteria 12778
214 Ga0209566_100017 3300025225 Bacteria 453558
215 Ga0209566_100018 3300025225 Bacteria 448638
216 Ga0209566_100251 3300025225 Bacteria 51274
217 Ga0209674_100003 3300025226 Bacteria 2196646
218 Ga0209674_100031 3300025226 Bacteria 453558
219 Ga0209674_100046 3300025226 Bacteria 357920
220 Ga0209674_100135 3300025226 Bacteria 113826
221 Ga0209672_100240 3300025228 Bacteria 41226
222 Ga0209672_104301 3300025228 Bacteria 2674
223 Ga0209672_105991 3300025228 Bacteria 2025
224 Ga0209147_100008 3300025229 Bacteria 777096
225 Ga0209147_101067 3300025229 Bacteria 11568
226 Ga0209563_100035 3300025230 Bacteria 453558
227 Ga0209563_100039 3300025230 Bacteria 409717
228 Ga0209563_100049 3300025230 Bacteria 358472
229 Ga0207427_100158 3300025231 Bacteria 76687
230 Ga0207427_100679 3300025231 Bacteria 16155
231 Ga0209437_100038 3300025233 Bacteria 453558
232 Ga0209258_100009 3300025242 Bacteria 996276
233 Ga0209258_100013 3300025242 Bacteria 777096
234 Ga0209258_100258 3300025242 Bacteria 92469
235 Ga0209258_100977 3300025242 Bacteria 13291
236 Ga0209646_1000027 3300025246 Bacteria 395141
237 Ga0209646_1000111 3300025246 Bacteria 155786
238 Ga0209026_1000054 3300025250 Bacteria 242508
239 Ga0209026_1001871 3300025250 Bacteria 8583
240 Ga0209677_100020 3300025253 Bacteria 453558
241 Ga0209677_100024 3300025253 Bacteria 406035
242 Ga0209677_100050 3300025253 Bacteria 176828
243 Ga0209677_100105 3300025253 Bacteria 89277
244 Ga0209677_107594 3300025253 Bacteria 2267
245 Ga0209148_1000007 3300025254 Bacteria 1592273
246 Ga0209148_1000019 3300025254 Bacteria 748518
247 Ga0209148_1006163 3300025254 Bacteria 2632
248 Ga0209759_1000043 3300025256 Bacteria 242513
249 Ga0209759_1000332 3300025256 Bacteria 62148
250 Ga0209759_1001539 3300025256 Bacteria 12648
251 Ga0209759_1002064 3300025256 Bacteria 9414
252 Ga0209759_1008320 3300025256 Bacteria 3244
253 Ga0209129_1014394 3300025258 Bacteria 1686
254 Ga0209233_1000049 3300025261 Bacteria 453558
255 Ga0209455_1000042 3300025272 Bacteria 419638
256 Ga0209455_1000092 3300025272 Bacteria 220516
257 Ga0209455_1000633 3300025272 Bacteria 21704
258 Ga0209676_1003758 3300025292 Bacteria 8999
259 Ga0209025_1000071 3300025294 Bacteria 287297
260 Ga0209025_1000103 3300025294 Bacteria 228054
261 Ga0209050_1001375 3300025298 Bacteria 26556
262 Ga0209051_1003989 3300025303 Bacteria 9370
263 Ga0209051_1011937 3300025303 Bacteria 4243
264 Ga0209257_1024765 3300025304 Bacteria 2068
265 Ga0209257_1043462 3300025304 Bacteria 1318
266 Ga0207697_10009381 3300025315 Unclassified 4231
267 Ga0207656_10008342 3300025321 Bacteria 3809
268 Ga0207682_10014762 3300025893 Bacteria 3043
269 Ga0207645_10001291 3300025907 Bacteria 20581
270 Ga0207645_10002413 3300025907 Bacteria 14716
271 Ga0207705_10177364 3300025909 Bacteria 1607
272 Ga0207684_10005030 3300025910 Bacteria 12325
273 Ga0207654_10085115 3300025911 Bacteria 1913
274 Ga0207707_10007506 3300025912 Bacteria 9502
275 Ga0207707_10012673 3300025912 Bacteria 7327
276 Ga0207707_10114551 3300025912 Bacteria 2356
277 Ga0207707_10297557 3300025912 Bacteria 1396
278 Ga0207695_10004273 3300025913 Bacteria 19616
279 Ga0207695_10057661 3300025913 Bacteria 4034
280 Ga0207695_10094630 3300025913 Bacteria 2994
281 Ga0207660_10013064 3300025917 Bacteria 5437
282 Ga0207662_10056815 3300025918 Bacteria 2338
283 Ga0207657_10015456 3300025919 Bacteria 7394
284 Ga0207657_10027582 3300025919 Bacteria 5200
285 Ga0207649_10000075 3300025920 Bacteria 83915
286 Ga0207649_10012065 3300025920 Bacteria 4781
287 Ga0207652_10016085 3300025921 Bacteria 6101
288 Ga0207694_10034447 3300025924 Bacteria 3882
289 Ga0207694_10188288 3300025924 Bacteria 1676
290 Ga0207694_10195598 3300025924 Bacteria 1644
291 Ga0207694_10202774 3300025924 Bacteria 1614
292 Ga0207650_10000481 3300025925 Bacteria 33253
293 Ga0207650_10055843 3300025925 Bacteria 2933
294 Ga0207650_10090967 3300025925 Bacteria 2331
295 Ga0207659_10065912 3300025926 Bacteria 2626
296 Ga0207687_10005774 3300025927 Bacteria 8190
297 Ga0207644_10028163 3300025931 Unclassified 3886
298 Ga0207644_10039695 3300025931 Bacteria 3324
299 Ga0207690_10014714 3300025932 Bacteria 4731
300 Ga0207690_10024118 3300025932 Bacteria 3806
301 Ga0207706_10003089 3300025933 Bacteria 16000
302 Ga0207706_10238285 3300025933 Bacteria 1591
303 Ga0207704_10067847 3300025938 Bacteria 2246
304 Ga0207691_10002287 3300025940 Bacteria 18750
305 Ga0207691_10107041 3300025940 Bacteria 2490
306 Ga0207711_10265421 3300025941 Bacteria 1579
307 Ga0207689_10041479 3300025942 Bacteria 3808
308 Ga0207689_10062154 3300025942 Bacteria 3071
309 Ga0207661_10194671 3300025944 Bacteria 1779
310 Ga0207679_10000004 3300025945 Bacteria 589021
311 Ga0207679_10003108 3300025945 Bacteria 10278
312 Ga0207679_10130171 3300025945 Bacteria 2017
313 Ga0207667_10009547 3300025949 Bacteria 11417
314 Ga0207651_10042178 3300025960 Bacteria 3035
315 Ga0207651_10122395 3300025960 Bacteria 1975
316 Ga0207712_10048412 3300025961 Unclassified 2957
317 Ga0207640_10000084 3300025981 Bacteria 74504
318 Ga0207640_10000813 3300025981 Bacteria 17745
319 Ga0207640_10015942 3300025981 Bacteria 4361
320 Ga0207658_10285067 3300025986 Bacteria 1417
321 Ga0207703_10294716 3300026035 Bacteria 1477
322 Ga0207639_10050298 3300026041 Unclassified 3165
323 Ga0207678_10000012 3300026067 Bacteria 145324
324 Ga0207678_10048694 3300026067 Unclassified 3663
325 Ga0207708_10020329 3300026075 Bacteria 5008
326 Ga0207702_10000020 3300026078 Bacteria 203299
327 Ga0207702_10000376 3300026078 Bacteria 50989
328 Ga0207641_10083691 3300026088 Bacteria 2775
329 Ga0207648_10033728 3300026089 Bacteria 4515
330 Ga0207648_10052066 3300026089 Unclassified 3579
331 Ga0207676_10034239 3300026095 Bacteria 3845
332 Ga0207676_10188715 3300026095 Bacteria 1812
333 Ga0207674_10006196 3300026116 Bacteria 14099
334 Ga0207674_10139974 3300026116 Bacteria 2380
335 Ga0207675_100040471 3300026118 Bacteria 4352
336 Ga0207675_100288250 3300026118 Bacteria 1597
337 Ga0207683_10003551 3300026121 Bacteria 13603
338 Ga0207683_10206555 3300026121 Bacteria 1786
339 Ga0207698_10102209 3300026142 Bacteria 2379
340 Ga0209371_1020996 3300027312 Bacteria 1593
341 Ga0209588_1002366 3300027671 Bacteria 5111
342 Ga0209588_1010407 3300027671 Bacteria 2796
343 Ga0209588_1028256 3300027671 Bacteria 1785
344 Ga0209971_1005267 3300027682 Bacteria 3075
345 Ga0209974_10012579 3300027876 Bacteria 2828
346 Ga0268265_10400740 3300028380 Bacteria 1268
347 Ga0268264_10079495 3300028381 Bacteria 2798
348 Ga0265336_10000006 3300028666 Bacteria 348453
349 Ga0307517_10058531 3300028786 Bacteria 3710
350 Ga0307515_10002038 3300028794 Bacteria 44609
351 Ga0307515_10038038 3300028794 Bacteria 7713
352 Ga0307515_10038364 3300028794 Bacteria 7666
353 Ga0307515_10054315 3300028794 Bacteria 5884
354 Ga0265324_10000948 3300029957 Bacteria 18150
355 Ga0307512_10011610 3300030522 Bacteria 8338
356 Ga0307512_10070739 3300030522 Bacteria 2596
357 Ga0307512_10118226 3300030522 Bacteria 1715
358 Ga0265327_10037005 3300031251 Bacteria 2677
359 Ga0307513_10011503 3300031456 Bacteria 10994
360 Ga0307513_10090506 3300031456 Bacteria 3120
361 Ga0307509_10001216 3300031507 Bacteria 43713
362 Ga0307509_10011687 3300031507 Bacteria 10603
363 Ga0307509_10139579 3300031507 Bacteria 2362
364 Ga0307509_10179594 3300031507 Bacteria 1984
365 Ga0307408_100038541 3300031548 Unclassified 3373
366 Ga0307408_100059739 3300031548 Bacteria 2776
367 Ga0307514_10164679 3300031649 Bacteria 1461
368 Ga0265342_10000556 3300031712 Bacteria 39445
369 Ga0307516_10001684 3300031730 Bacteria 30439
370 Ga0307516_10015404 3300031730 Bacteria 8047
371 Ga0307405_10008752 3300031731 Bacteria 5149
372 Ga0307412_10000137 3300031911 Bacteria 53231
373 Ga0307412_10132441 3300031911 Bacteria 1813
374 Ga0307414_10012293 3300032004 Bacteria 5056
375 Ga0307411_10019342 3300032005 Bacteria 3932
376 Ga0307415_100110802 3300032126 Unclassified 2036
377 Ga0307507_10051280 3300033179 Bacteria 3973
378 Ga0307510_10159712 3300033180 Bacteria 1853
379 Ga0373928_0020336 3300035084 Bacteria 1391
380 Ga0373934_0066414 3300035086 Bacteria 1440
381 Ga0373956_0042395 3300035119 Bacteria 2023
382 Ga0373931_0004078 3300035691 Bacteria 6625
383 Ga0395899_0234069 3300037312 Bacteria 1267
384 Ga0395898_0108732 3300037466 Bacteria 2658
385 Ga0395905_0016422 3300037471 Bacteria 7035
386 Ga0395905_0052879 3300037471 Bacteria 3802
387 Ga0395901_0034836 3300038443 Bacteria 5200
388 Ga0436361_0837231 3300039447 Bacteria 44100
389 Ga0451795_1108175 3300041456 Bacteria 1852
390 Ga0451802_0838037 3300041460 Bacteria 2362
391 Ga0451841_0285088 3300041498 Bacteria 1828
392 Ga0451577_0413014 3300042876 Bacteria 1225
393 Ga0495592_0000563 3300046454 Bacteria 26400
394 Ga0495651_0001276 3300046462 Bacteria 19507
395 Ga0495580_0015568 3300046472 Bacteria 5732
396 Ga0495639_0004301 3300046475 Bacteria 6107
397 Ga0495607_0000009 3300046501 Bacteria 216674
398 Ga0495608_0018334 3300046511 Bacteria 4830
399 Ga0495610_0039051 3300046512 Bacteria 2404
400 Ga0495620_0017477 3300046515 Bacteria 3574
401 Ga0495628_0001650 3300046516 Bacteria 20411
402 Ga0495628_0026135 3300046516 Bacteria 4766
403 Ga0495632_0049653 3300046519 Bacteria 2073
404 Ga0495648_0065979 3300046524 Bacteria 2124
405 Ga0495666_0056612 3300046526 Bacteria 1878
406 Ga0495642_0015016 3300046528 Bacteria 3006
407 Ga0495642_0106169 3300046528 Bacteria 1198
408 Ga0495652_0003089 3300046529 Bacteria 16662
409 Ga0495625_0000602 3300046660 Bacteria 52321
410 Ga0495659_0038979 3300046664 Bacteria 1689
411 Ga0495661_0029227 3300046665 Bacteria 3521
412 Ga0495623_0001311 3300046679 Bacteria 16923
413 Ga0495623_0011379 3300046679 Bacteria 5757
414 Ga0495646_0001063 3300046680 Bacteria 15918
415 Ga0495658_0048392 3300046683 Bacteria 2397
416 Ga0495600_0020177 3300046809 Bacteria 4262
417 Ga0495687_013016 3300047443 Bacteria 4363
418 Ga0495686_0011776 3300047472 Bacteria 6154
419 Ga0495602_0017442 3300048088 Bacteria 7199
420 Ga0496100_0083360 3300048903 Bacteria 2164
421 Ga0496101_0056881 3300048904 Bacteria 2827
422 Ga0496102_0144584 3300048905 Unclassified 2231
423 Ga0496103_0112413 3300048906 Bacteria 1731
424 Ga0496108_0079585 3300048911 Bacteria 2775
425 Ga0496109_0242694 3300048912 Bacteria 1696
426 Ga0496111_0042150 3300048914 Bacteria 3277
427 Ga0496112_0019288 3300048915 Bacteria 6434
428 Ga0496112_0031926 3300048915 Bacteria 5111
429 Ga0496116_0039211 3300048919 Bacteria 3277
430 Ga0496117_0012798 3300048920 Bacteria 7359
431 Ga0496117_0062034 3300048920 Bacteria 2565
432 Ga0496121_0000411 3300048924 Bacteria 85089
433 Ga0496121_0130845 3300048924 Bacteria 1878
434 Ga0496122_0001568 3300048925 Bacteria 36083
435 Ga0496122_0111268 3300048925 Bacteria 1796
436 Ga0496123_0080219 3300048926 Bacteria 1990
437 Ga0496123_0082706 3300048926 Bacteria 1945
438 Ga0496124_0000103 3300048927 Bacteria 179162
439 Ga0496124_0067965 3300048927 Bacteria 2963
440 Ga0496125_0000096 3300048928 Bacteria 205618
441 Ga0496125_0007183 3300048928 Bacteria 11877
442 Ga0496126_0037790 3300048929 Bacteria 4499
443 Ga0501031_0014987 3300049568 Bacteria 5035
444 Ga0501032_0009263 3300049569 Bacteria 7138
445 Ga0501033_0004879 3300049570 Bacteria 10682
446 Ga0501033_0045764 3300049570 Bacteria 3255
447 Ga0501041_0023036 3300049577 Bacteria 3732
448 Ga0501043_0000010 3300049579 Bacteria 206374
449 Ga0501043_0018580 3300049579 Bacteria 5454
450 Ga0501043_0130414 3300049579 Bacteria 1970
451 Ga0501046_0000132 3300049580 Bacteria 79506
452 Ga0501046_0080947 3300049580 Bacteria 2508
453 Ga0501047_0000026 3300049581 Bacteria 225296
454 Ga0501047_0014502 3300049581 Bacteria 7495
455 Ga0501048_0002295 3300049582 Bacteria 14590
456 Ga0501068_0095979 3300049584 Bacteria 1833
457 Ga0501070_0014719 3300049586 Bacteria 6582
458 Ga0501070_0051865 3300049586 Bacteria 3404
459 Ga0501071_0192313 3300049587 Bacteria 1531
460 Ga0501072_0118147 3300049588 Bacteria 2112
461 Ga0501073_0024666 3300049589 Bacteria 4318
462 Ga0501074_0012356 3300049590 Bacteria 6206
463 Ga0501076_0166138 3300049592 Bacteria 1798
464 Ga0501077_0030023 3300049593 Bacteria 3457
465 Ga0501079_0074034 3300049741 Bacteria 2632
466 Ga0501079_0122229 3300049741 Bacteria 2025
467 Ga0501035_0005340 3300049822 Bacteria 12155
468 Ga0501035_0009597 3300049822 Bacteria 9000
469 Ga0501044_0000045 3300049823 Bacteria 148353
470 Ga0501044_0006513 3300049823 Bacteria 12897
471 Ga0501044_0047658 3300049823 Bacteria 4432
472 nmdc:mga0yw44_131515_c1 3300050492 Bacteria 1620
473 nmdc:mga0k408_118405_c1 3300050493 Bacteria 1568
474 nmdc:mga0k408_27666_c1 3300050493 Bacteria 3221
475 nmdc:mga0k408_732_c1 3300050493 Bacteria 18001
476 nmdc:mga06z11_6883_c1 3300050494 Bacteria 4651
477 nmdc:mga07m45_32159_c1 3300050496 Bacteria 2910
478 nmdc:mga07m45_434_c1 3300050496 Bacteria 17366
479 nmdc:mga07m45_50697_c1 3300050496 Bacteria 2340
480 nmdc:mga05p37_202878_c1 3300050507 Bacteria 2400
481 nmdc:mga09592_107867_c1 3300050508 Bacteria 2388
482 nmdc:mga0qj67_189184_c1 3300050509 Bacteria 1673
483 nmdc:mga06r32_100409_c1 3300050510 Bacteria 2839
484 nmdc:mga06r32_36209_c1 3300050510 Bacteria 4661
485 nmdc:mga08y16_86176_c1 3300050511 Bacteria 3273
486 nmdc:mga0n895_116726_c1 3300050512 Unclassified 2688
487 nmdc:mga0n895_15430_c1 3300050512 Bacteria 6966
488 nmdc:mga0n895_16785_c1 3300050512 Bacteria 6727
489 nmdc:mga0n895_686744_c1 3300050512 Unclassified 1020
490 nmdc:mga0n895_8459_c1 3300050512 Bacteria 8910
491 nmdc:mga0rr50_254317_c1 3300050513 Bacteria 1460
492 nmdc:mga0rr50_34582_c1 3300050513 Bacteria 3620
493 nmdc:mga0rr50_9819_c1 3300050513 Bacteria 6043
494 nmdc:mga08x19_71890_c1 3300050514 Bacteria 2256
495 nmdc:mga0a205_158611_c1 3300050515 Bacteria 2160
496 nmdc:mga0a205_169288_c1 3300050515 Bacteria 2080
497 nmdc:mga0a205_31569_c1 3300050515 Bacteria 5075
498 Ga0500635_0000007 3300053080 Bacteria 169379
499 Ga0500644_0002663 3300053088 Bacteria 4459
500 Ga0500651_0015446 3300053093 Bacteria 4685
501 Ga0500594_0001534 3300053118 Bacteria 5029
502 Ga0500574_001794 3300053141 Bacteria 3328
503 Ga0500622_0000585 3300053156 Bacteria 33068
504 Ga0500634_0003843 3300053161 Bacteria 6800
505 Ga0501084_0071460 3300054114 Bacteria 2906
506 Ga0590077_012424 3300059426 Bacteria 1765
507 Ga0587067_003515 3300059640 Bacteria 1966
508 Ga0587068_003846 3300059641 Bacteria 1950
509 Ga0587072_001638 3300059643 Bacteria 2833
510 Ga0501082_0012399 3300060353 Bacteria 7325
511 Ga0466962_0006170 3300061719 Bacteria 5758
512 Ga0530510_0122412 3300061734 Bacteria 1910
513 2587755844 2585428062 Bacteria 6842168
514 2597027979 2596583598 Bacteria 5251611
515 2599444652 2599185178 Bacteria 5365746
516 2599904618 2599185292 Bacteria 6290804
517 2643861165 2643221569 Bacteria 6064337
518 2643983373 2643221594 Bacteria 5811388
519 2644124513 2643221621 Bacteria 6212786
520 2644301855 2643221654 Bacteria 5273570
521 2723876959 2721755763 Bacteria 4464185
522 2738719628 2738541277 Bacteria 7458140
523 2738879937 2738541307 Bacteria 8606193
524 2739278827 2738543019 Bacteria 7459457
525 2809032709 2808606395 Bacteria 6020352
526 2819542599 2818991436 Bacteria 5376622
527 2819599377 2818991446 Bacteria 7757362
528 2855735070 2855730933 Bacteria 7047938
529 2855770854 2855767633 Bacteria 7049357
530 2857540529 2857537821 Bacteria 5248181
531 2857543447 2857542790 Bacteria 5326616
532 2857578059 2857576091 Bacteria 5465855
533 2858951315 2858950400 Bacteria 6783797
534 2881418244 2881412998 Bacteria 6492157
535 2885266425 2885266251 Bacteria 4796748
536 2899925883 2899924645 Bacteria 7487985
537 2900580034 2900577576 Bacteria 5438534
538 2904481508 2904479285 Bacteria 5073931
539 2904544298 2904541872 Bacteria 8915136
540 2928041729 2928037797 Bacteria 7273642
541 2928049293 2928044640 Bacteria 7271509
542 2928052099 2928051484 Bacteria 7773759
543 2928059790 2928058823 Bacteria 5520022
544 2928065221 2928064002 Bacteria 7419480
545 2929162130 2929160207 Bacteria 9075316
546 2941485355
547 Ga0105240_10004619
548 JGI24741J21665_1000196
549 JGI24740J21852_10002700
550 JGI24740J21852_10003016
551 JGI25156J39149_1000060
552 JGI25156J39149_1000175
553 JGI25156J39149_1001779
554 JGI25156J39149_1016653
555 JGI25162J39368_1000036
556 JGI25154J39366_1000129
557 JGI25154J39366_1002385
558 JGI25157J39369_1000029
559 JGI25164J39214_1003957
560 JGI25151J46595_10000137
561 JGI25151J46595_10030179
562 JGI25165J46597_1000022
563 rootH1_10009484
564 rootH1_10017612
565 rootH2_10006384
566 rootH2_10082770
567 rootH1_10024154
568 rootH1_10142259
569 Ga0055538_1000011
570 Ga0055539_1000016
571 Ga0055539_1000081
572 Ga0055539_1000118
573 Ga0055539_1000739
574 Ga0055533_1000010
575 Ga0055533_1000019
576 Ga0055533_1000421
577 Ga0055532_1000048
578 Ga0055525_1000042
579 Ga0055525_1000273
580 Ga0055525_1000415
581 Ga0055527_1003308
582 Ga0055535_1000035
583 Ga0055535_1000076
584 Ga0055535_1000282
585 Ga0055542_1000009
586 Ga0055542_1000724
587 Ga0055529_1000101
588 Ga0055529_1000491
589 Ga0055529_1000810
590 Ga0055530_10020060
591 Ga0055540_1008797
592 Ga0055541_1000017
593 Ga0055541_1001235
594 Ga0065712_10000421
595 Ga0065712_10002802
596 Ga0065715_10012795
597 Ga0065715_10089174
598 Ga0065707_10190054
599 Ga0070658_10016597
600 Ga0070658_10129050
601 Ga0070676_10024807
602 Ga0070676_10038698
603 Ga0070690_100041526
604 Ga0070690_100064191
605 Ga0070670_100000191
606 Ga0070670_100068546
607 Ga0070677_10018449
608 Ga0070666_10020261
609 Ga0070666_10200122
610 Ga0070680_100002615
611 Ga0070682_100011098
612 Ga0068868_100010559
613 Ga0070687_100051249
614 Ga0070661_100000370
615 Ga0070661_100003806
616 Ga0070669_100064626
617 Ga0070675_100054510
618 Ga0070675_100070187
619 Ga0070671_100005369
620 Ga0070671_100025924
621 Ga0070671_100034890
622 Ga0070671_100161985
623 Ga0070674_100007062
624 Ga0070673_100055185
625 Ga0070673_100071309
626 Ga0070659_100014344
627 Ga0070659_100037086
628 Ga0070667_100063802
629 Ga0070667_100081858
630 Ga0070705_100020941
631 Ga0070700_100006624
632 Ga0070694_100015923
633 Ga0070708_100000336
634 Ga0070663_100000024
635 Ga0070663_100043513
636 Ga0070678_100030127
637 Ga0070678_100030389
638 Ga0070662_100026282
639 Ga0070662_100059309
640 Ga0070681_10018223
641 Ga0070681_10079034
642 Ga0068867_100022324
643 Ga0070706_100002692
644 Ga0070698_100251532
645 Ga0070698_100291246
646 Ga0070699_100139989
647 Ga0070679_100024625
648 Ga0070679_100052774
649 Ga0070697_100022408
650 Ga0070672_100064127
651 Ga0070695_100005789
652 Ga0070696_100014843
653 Ga0070696_100018017
654 Ga0070693_100044899
655 Ga0070665_100008996
656 Ga0070665_100219927
657 Ga0070704_100034440
658 Ga0070664_100000022
659 Ga0070664_100016829
660 Ga0068857_100026215
661 Ga0068857_100111768
662 Ga0068857_100166686
663 Ga0068854_100000336
664 Ga0068854_100004203
665 Ga0068854_100016099
666 Ga0068854_100077689
667 Ga0068856_100000049
668 Ga0068856_100005146
669 Ga0068856_100097086
670 Ga0068859_100111632
671 Ga0068864_100009857
672 Ga0068870_10011924
673 Ga0068863_100308158
674 Ga0068858_100213312
675 Ga0068860_100123403
676 Ga0075365_10004760
677 Ga0075363_100016697
678 Ga0075364_10204542
679 Ga0070712_100044125
680 Ga0075362_10000766
681 Ga0075367_10019273
682 Ga0075367_10058564
683 Ga0075366_10024677
684 Ga0097621_100221734
685 Ga0075370_10002838
686 Ga0075370_10033148
687 Ga0068871_100333652
688 Ga0075430_100208405
689 Ga0075431_100003080
690 Ga0075433_10041459
691 Ga0075433_10082925
692 Ga0075434_100025998
693 Ga0075434_100063792
694 Ga0075429_100025185
695 Ga0068865_100042100
696 Ga0068865_100086607
697 Ga0097620_100111626
698 Ga0075435_100113729
699 Ga0099794_10003558
700 Ga0099794_10014932
701 Ga0105244_10025014
702 Ga0105240_10078101
703 Ga0105240_10098010
704 Ga0111539_10102731
705 Ga0105245_10006581
706 Ga0105245_10022850
707 Ga0114129_10003918
708 Ga0114129_10057414
709 Ga0114129_10403563
710 Ga0105243_10354979
711 Ga0105241_10046984
712 Ga0105241_10315112
713 Ga0105242_10091188
714 Ga0105242_10134701
715 Ga0105237_10003650
716 Ga0105237_10178738
717 Ga0105237_10200135
718 Ga0105238_10038373
719 Ga0105238_10076445
720 Ga0105239_10009773
721 Ga0105239_10026856
722 Ga0105239_10122142
723 Ga0105239_10148129
724 Ga0105246_10051850
725 Ga0105246_10083087
726 Ga0157373_10003934
727 Ga0157373_10008463
728 Ga0157373_10014407
729 Ga0157371_10000089
730 Ga0157370_10000002
731 Ga0157369_10018918
732 Ga0157374_10016308
733 Ga0157378_10013757
734 Ga0157378_10021758
735 Ga0157378_10091596
736 Ga0157378_10106430
737 Ga0163162_10044858
738 Ga0163162_10059556
739 Ga0163162_10115914
740 Ga0163162_10159051
741 Ga0157372_10000149
742 Ga0157372_10145094
743 Ga0157380_10063112
744 Ga0182008_10003693
745 Ga0182008_10007653
746 Ga0157379_10048868
747 Ga0157376_10024430
748 Ga0182006_1027763
749 Ga0182007_10000908
750 Ga0182007_10036058
751 Ga0183362_10003
752 Ga0206351_10088450
753 Ga0213872_10000453
754 Ga0213872_10011834
755 Ga0224712_10054704
756 Ga0209784_100019
757 Ga0209784_100024
758 Ga0209784_100435
759 Ga0209784_100569
760 Ga0209566_100017
761 Ga0209566_100018
762 Ga0209566_100251
763 Ga0209674_100003
764 Ga0209674_100031
765 Ga0209674_100046
766 Ga0209674_100135
767 Ga0209672_100240
768 Ga0209672_104301
769 Ga0209672_105991
770 Ga0209147_100008
771 Ga0209147_101067
772 Ga0209563_100035
773 Ga0209563_100039
774 Ga0209563_100049
775 Ga0207427_100158
776 Ga0207427_100679
777 Ga0209437_100038
778 Ga0209258_100009
779 Ga0209258_100013
780 Ga0209258_100258
781 Ga0209258_100977
782 Ga0209646_1000027
783 Ga0209646_1000111
784 Ga0209026_1000054
785 Ga0209026_1001871
786 Ga0209677_100020
787 Ga0209677_100024
788 Ga0209677_100050
789 Ga0209677_100105
790 Ga0209677_107594
791 Ga0209148_1000007
792 Ga0209148_1000019
793 Ga0209148_1006163
794 Ga0209759_1000043
795 Ga0209759_1000332
796 Ga0209759_1001539
797 Ga0209759_1002064
798 Ga0209759_1008320
799 Ga0209129_1014394
800 Ga0209233_1000049
801 Ga0209455_1000042
802 Ga0209455_1000092
803 Ga0209455_1000633
804 Ga0209676_1003758
805 Ga0209025_1000071
806 Ga0209025_1000103
807 Ga0209050_1001375
808 Ga0209051_1003989
809 Ga0209051_1011937
810 Ga0209257_1024765
811 Ga0209257_1043462
812 Ga0207697_10009381
813 Ga0207656_10008342
814 Ga0207682_10014762
815 Ga0207645_10001291
816 Ga0207645_10002413
817 Ga0207705_10177364
818 Ga0207684_10005030
819 Ga0207654_10085115
820 Ga0207707_10007506
821 Ga0207707_10012673
822 Ga0207707_10114551
823 Ga0207707_10297557
824 Ga0207695_10004273
825 Ga0207695_10057661
826 Ga0207695_10094630
827 Ga0207660_10013064
828 Ga0207662_10056815
829 Ga0207657_10015456
830 Ga0207657_10027582
831 Ga0207649_10000075
832 Ga0207649_10012065
833 Ga0207652_10016085
834 Ga0207694_10034447
835 Ga0207694_10188288
836 Ga0207694_10195598
837 Ga0207694_10202774
838 Ga0207650_10000481
839 Ga0207650_10055843
840 Ga0207650_10090967
841 Ga0207659_10065912
842 Ga0207687_10005774
843 Ga0207644_10028163
844 Ga0207644_10039695
845 Ga0207690_10014714
846 Ga0207690_10024118
847 Ga0207706_10003089
848 Ga0207706_10238285
849 Ga0207704_10067847
850 Ga0207691_10002287
851 Ga0207691_10107041
852 Ga0207711_10265421
853 Ga0207689_10041479
854 Ga0207689_10062154
855 Ga0207661_10194671
856 Ga0207679_10000004
857 Ga0207679_10003108
858 Ga0207679_10130171
859 Ga0207667_10009547
860 Ga0207651_10042178
861 Ga0207651_10122395
862 Ga0207712_10048412
863 Ga0207640_10000084
864 Ga0207640_10000813
865 Ga0207640_10015942
866 Ga0207658_10285067
867 Ga0207703_10294716
868 Ga0207639_10050298
869 Ga0207678_10000012
870 Ga0207678_10048694
871 Ga0207708_10020329
872 Ga0207702_10000020
873 Ga0207702_10000376
874 Ga0207641_10083691
875 Ga0207648_10033728
876 Ga0207648_10052066
877 Ga0207676_10034239
878 Ga0207676_10188715
879 Ga0207674_10006196
880 Ga0207674_10139974
881 Ga0207675_100040471
882 Ga0207675_100288250
883 Ga0207683_10003551
884 Ga0207683_10206555
885 Ga0207698_10102209
886 Ga0209371_1020996
887 Ga0209588_1002366
888 Ga0209588_1010407
889 Ga0209588_1028256
890 Ga0209971_1005267
891 Ga0209974_10012579
892 Ga0268265_10400740
893 Ga0268264_10079495
894 Ga0265336_10000006
895 Ga0307517_10058531
896 Ga0307515_10002038
897 Ga0307515_10038038
898 Ga0307515_10038364
899 Ga0307515_10054315
900 Ga0265324_10000948
901 Ga0307512_10011610
902 Ga0307512_10070739
903 Ga0307512_10118226
904 Ga0265327_10037005
905 Ga0307513_10011503
906 Ga0307513_10090506
907 Ga0307509_10001216
908 Ga0307509_10011687
909 Ga0307509_10139579
910 Ga0307509_10179594
911 Ga0307408_100038541
912 Ga0307408_100059739
913 Ga0307514_10164679
914 Ga0265342_10000556
915 Ga0307516_10001684
916 Ga0307516_10015404
917 Ga0307405_10008752
918 Ga0307412_10000137
919 Ga0307412_10132441
920 Ga0307414_10012293
921 Ga0307411_10019342
922 Ga0307415_100110802
923 Ga0307507_10051280
924 Ga0307510_10159712
925 Ga0373928_0020336
926 Ga0373934_0066414
927 Ga0373956_0042395
928 Ga0373931_0004078
929 Ga0395899_0234069
930 Ga0395898_0108732
931 Ga0395905_0016422
932 Ga0395905_0052879
933 Ga0395901_0034836
934 Ga0436361_0837231
935 Ga0451795_1108175
936 Ga0451802_0838037
937 Ga0451841_0285088
938 Ga0451577_0413014
939 Ga0495592_0000563
940 Ga0495651_0001276
941 Ga0495580_0015568
942 Ga0495639_0004301
943 Ga0495607_0000009
944 Ga0495608_0018334
945 Ga0495610_0039051
946 Ga0495620_0017477
947 Ga0495628_0001650
948 Ga0495628_0026135
949 Ga0495632_0049653
950 Ga0495648_0065979
951 Ga0495666_0056612
952 Ga0495642_0015016
953 Ga0495642_0106169
954 Ga0495652_0003089
955 Ga0495625_0000602
956 Ga0495659_0038979
957 Ga0495661_0029227
958 Ga0495623_0001311
959 Ga0495623_0011379
960 Ga0495646_0001063
961 Ga0495658_0048392
962 Ga0495600_0020177
963 Ga0495687_013016
964 Ga0495686_0011776
965 Ga0495602_0017442
966 Ga0496100_0083360
967 Ga0496101_0056881
968 Ga0496102_0144584
969 Ga0496103_0112413
970 Ga0496108_0079585
971 Ga0496109_0242694
972 Ga0496111_0042150
973 Ga0496112_0019288
974 Ga0496112_0031926
975 Ga0496116_0039211
976 Ga0496117_0012798
977 Ga0496117_0062034
978 Ga0496121_0000411
979 Ga0496121_0130845
980 Ga0496122_0001568
981 Ga0496122_0111268
982 Ga0496123_0080219
983 Ga0496123_0082706
984 Ga0496124_0000103
985 Ga0496124_0067965
986 Ga0496125_0000096
987 Ga0496125_0007183
988 Ga0496126_0037790
989 Ga0501031_0014987
990 Ga0501032_0009263
991 Ga0501033_0004879
992 Ga0501033_0045764
993 Ga0501041_0023036
994 Ga0501043_0000010
995 Ga0501043_0018580
996 Ga0501043_0130414
997 Ga0501046_0000132
998 Ga0501046_0080947
999 Ga0501047_0000026
1000 Ga0501047_0014502
1001 Ga0501048_0002295
1002 Ga0501068_0095979
1003 Ga0501070_0014719
1004 Ga0501070_0051865
1005 Ga0501071_0192313
1006 Ga0501072_0118147
1007 Ga0501073_0024666
1008 Ga0501074_0012356
1009 Ga0501076_0166138
1010 Ga0501077_0030023
1011 Ga0501079_0074034
1012 Ga0501079_0122229
1013 Ga0501035_0005340
1014 Ga0501035_0009597
1015 Ga0501044_0000045
1016 Ga0501044_0006513
1017 Ga0501044_0047658
1018 nmdc:mga0yw44_131515_c1
1019 nmdc:mga0k408_118405_c1
1020 nmdc:mga0k408_27666_c1
1021 nmdc:mga0k408_732_c1
1022 nmdc:mga06z11_6883_c1
1023 nmdc:mga07m45_32159_c1
1024 nmdc:mga07m45_434_c1
1025 nmdc:mga07m45_50697_c1
1026 nmdc:mga05p37_202878_c1
1027 nmdc:mga09592_107867_c1
1028 nmdc:mga0qj67_189184_c1
1029 nmdc:mga06r32_100409_c1
1030 nmdc:mga06r32_36209_c1
1031 nmdc:mga08y16_86176_c1
1032 nmdc:mga0n895_116726_c1
1033 nmdc:mga0n895_15430_c1
1034 nmdc:mga0n895_16785_c1
1035 nmdc:mga0n895_686744_c1
1036 nmdc:mga0n895_8459_c1
1037 nmdc:mga0rr50_254317_c1
1038 nmdc:mga0rr50_34582_c1
1039 nmdc:mga0rr50_9819_c1
1040 nmdc:mga08x19_71890_c1
1041 nmdc:mga0a205_158611_c1
1042 nmdc:mga0a205_169288_c1
1043 nmdc:mga0a205_31569_c1
1044 Ga0500635_0000007
1045 Ga0500644_0002663
1046 Ga0500651_0015446
1047 Ga0500594_0001534
1048 Ga0500574_001794
1049 Ga0500622_0000585
1050 Ga0500634_0003843
1051 Ga0501084_0071460
1052 Ga0590077_012424
1053 Ga0587067_003515
1054 Ga0587068_003846
1055 Ga0587072_001638
1056 Ga0501082_0012399
1057 Ga0466962_0006170
1058 Ga0530510_0122412
1059 2587755844
1060 2597027979
1061 2599444652
1062 2599904618
1063 2643861165
1064 2643983373
1065 2644124513
1066 2644301855
1067 2723876959
1068 2738719628
1069 2738879937
1070 2739278827
1071 2809032709
1072 2819542599
1073 2819599377
1074 2855735070
1075 2855770854
1076 2857540529
1077 2857543447
1078 2857578059
1079 2858951315
1080 2881418244
1081 2885266425
1082 2899925883
1083 2900580034
1084 2904481508
1085 2904544298
1086 2928041729
1087 2928049293
1088 2928052099
1089 2928059790
1090 2928065221
1091 2929162130
1092 2941485355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

71

423

0.92

PF01094

ANF_receptor

Receptor family ligand binding region

90

404

0.85

PF13433

Peripla_BP_5

Periplasmic binding protein domain

74

426

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jfn-assembly1.cif.gz_A crystal structure of leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein from brucella ovis, closed conformation 0.8577 19 361
4obb-assembly2.cif.gz_B the crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with (3s)-3-methyl-2-oxopentanoic acid. 0.8452 21 363
4m88-assembly1.cif.gz_A crystal structure of extracellular ligand-binding receptor from verminephrobacter eiseniae ef01-2 0.8403 21 360
4zpj-assembly1.cif.gz_A abc transporter substrate-binding protein from sphaerobacter thermophilus 0.8375 21 361
4oat-assembly1.cif.gz_A the crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with isoleucine. 0.8318 21 363
ID Description Score Start End Superfamily
4nqrA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9495 126 256 3.40.50.2300
3td9A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9149 126 251 3.40.50.2300
4gnrA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.911 126 253 3.40.50.2300
4n0qA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9061 126 251 3.40.50.2300
1usiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8992 126 251 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4Q3AAT3-F1-model_v4 deleted 0.928 15 98
AF-A0A2N0QHD5-F1-model_v4 Periplasmic binding protein-like I 0.9213 20 110
AF-A0A1B8P3D6-F1-model_v4 Aliphatic amidase expression-regulating protein 0.9161 16 111
AF-F1W248-F1-model_v4 Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein 0.9145 217 363
AF-A0A2V6S585-F1-model_v4 ABC transporter substrate-binding protein 0.9131 12 111 GO:0006865

Map