F462008

General Info

Members Datasets Scaffolds Average Seq Length
546 243 1092 337

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10201979|Ga0207428_102019792
Length 325
Sequence MIVIQAHDLTKRYRVAKKREGIGGAIIDLFRPRHEMLNAVNGVSFSLERGEMVGYIGANGAGKSTTIKMLTGILTPTSGEILVNGYVPSKERRAYTRTIGAVFGQRTQLWWDIAVIESLKLLKKIYEVPDDVYREQMKDFLSQPVRTLSLGQRMRCDLAAALLHRPSIVFLDEPTIGLDVVSKENIRRFLRRVNEELKTTVILTTHDLGDIEQLCRRVIVIDQGKILYDGDLAGLKKSTGDIARLRVEIRGEDGGELLARATNGVPIEWKRIGPGLYEGEFPKDSTSVADVVRRIVTDAPVHDLAVLEPPIEEVVRKIYRREIAL

Samples

Sample ID Description Type Environment
1 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
239 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
240 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 5.68
Rhizosphere 90.11
Stem 0
Stem Tuber 0
Unclassified 6.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207428_10201979 3300027907 Bacteria 1495
2 CNXas_1000009 3300000545 Bacteria 42024
3 JGI24737J22298_10050373 3300001990 Bacteria 1266
4 JGI24743J22301_10001127 3300001991 Bacteria 3584
5 JGI24033J26618_1000063 3300002155 Bacteria 15592
6 rootH2_10005428 3300003320 Bacteria 3373
7 rootH2_10006650 3300003320 Bacteria 18133
8 rootH2_10016401 3300003320 Bacteria 7400
9 rootL2_10043152 3300003322 Bacteria 16356
10 rootH1_10025348 3300003323 Bacteria 15775
11 JGI25404J52841_10001788 3300003659 Bacteria 3896
12 Ga0055530_10010894 3300003791 Bacteria 3312
13 Ga0065704_10005956 3300005289 Bacteria 4752
14 Ga0065704_10018270 3300005289 Bacteria 3396
15 Ga0065704_10110450 3300005289 Bacteria 1960
16 Ga0065704_10209150 3300005289 Bacteria 1115
17 Ga0065712_10002047 3300005290 Bacteria 4929
18 Ga0065712_10004529 3300005290 Bacteria 3195
19 Ga0065712_10089630 3300005290 Bacteria 2461
20 Ga0065712_10092062 3300005290 Bacteria 2346
21 Ga0065712_10110450 3300005290 Bacteria 1836
22 Ga0065715_10008361 3300005293 Bacteria 6657
23 Ga0065715_10091931 3300005293 Bacteria 5450
24 Ga0065715_10099155 3300005293 Bacteria 3451
25 Ga0065715_10127476 3300005293 Bacteria 2086
26 Ga0065715_10159950 3300005293 Bacteria 1639
27 Ga0065707_10113797 3300005295 Bacteria 2312
28 Ga0070658_10010667 3300005327 Bacteria 7363
29 Ga0070658_10172350 3300005327 Bacteria 1818
30 Ga0070676_10074588 3300005328 Bacteria 2044
31 Ga0070676_10202940 3300005328 Bacteria 1301
32 Ga0070683_100077013 3300005329 Bacteria 3118
33 Ga0070683_100134048 3300005329 Bacteria 2345
34 Ga0070683_100167155 3300005329 Bacteria 2087
35 Ga0070690_100087288 3300005330 Unclassified 2048
36 Ga0070690_100144709 3300005330 Bacteria 1616
37 Ga0070670_100006070 3300005331 Bacteria 10217
38 Ga0070670_100155829 3300005331 Bacteria 1978
39 Ga0070677_10091281 3300005333 Bacteria 1325
40 Ga0070666_10034276 3300005335 Bacteria 3365
41 Ga0070666_10035080 3300005335 Bacteria 3325
42 Ga0070680_100069990 3300005336 Bacteria 2882
43 Ga0070680_100292079 3300005336 Bacteria 1382
44 Ga0068868_100023781 3300005338 Bacteria 4640
45 Ga0068868_100038723 3300005338 Bacteria 3701
46 Ga0070689_100023688 3300005340 Bacteria 4599
47 Ga0070689_100036215 3300005340 Bacteria 3773
48 Ga0070689_100078245 3300005340 Bacteria 2593
49 Ga0070687_100073720 3300005343 Unclassified 1841
50 Ga0070661_100000788 3300005344 Bacteria 22747
51 Ga0070661_100008265 3300005344 Bacteria 7184
52 Ga0070661_100181409 3300005344 Bacteria 1602
53 Ga0070668_100001931 3300005347 Bacteria 15135
54 Ga0070668_100052358 3300005347 Bacteria 3146
55 Ga0070669_100036447 3300005353 Bacteria 3564
56 Ga0070669_100045734 3300005353 Bacteria 3190
57 Ga0070669_100104198 3300005353 Bacteria 2144
58 Ga0070669_100175551 3300005353 Bacteria 1673
59 Ga0070675_100001426 3300005354 Bacteria 17559
60 Ga0070675_100303742 3300005354 Bacteria 1406
61 Ga0070675_100437990 3300005354 Bacteria 1171
62 Ga0070671_100010298 3300005355 Bacteria 7502
63 Ga0070671_100024517 3300005355 Bacteria 4939
64 Ga0070671_100175541 3300005355 Unclassified 1813
65 Ga0070674_100011159 3300005356 Bacteria 5457
66 Ga0070674_100011784 3300005356 Bacteria 5337
67 Ga0070673_100005630 3300005364 Bacteria 8040
68 Ga0070688_100005067 3300005365 Bacteria 6906
69 Ga0070688_100031651 3300005365 Bacteria 3184
70 Ga0070688_100079916 3300005365 Bacteria 2114
71 Ga0070659_100006359 3300005366 Bacteria 8531
72 Ga0070659_100311642 3300005366 Unclassified 1314
73 Ga0070709_10113801 3300005434 Bacteria 1822
74 Ga0070714_100219283 3300005435 Bacteria 1747
75 Ga0070714_100223906 3300005435 Bacteria 1730
76 Ga0070714_100229730 3300005435 Unclassified 1709
77 Ga0070713_100002205 3300005436 Bacteria 12619
78 Ga0070713_100010603 3300005436 Bacteria 6666
79 Ga0070710_10020816 3300005437 Bacteria 3409
80 Ga0070710_10068336 3300005437 Unclassified 2041
81 Ga0070711_100009047 3300005439 Bacteria 6116
82 Ga0070711_100081017 3300005439 Bacteria 2312
83 Ga0070705_100014022 3300005440 Bacteria 4113
84 Ga0070705_100098276 3300005440 Bacteria 1842
85 Ga0070705_100209464 3300005440 Bacteria 1343
86 Ga0070700_100003873 3300005441 Bacteria 7768
87 Ga0070708_100013304 3300005445 Bacteria 6734
88 Ga0070708_100016953 3300005445 Bacteria 6060
89 Ga0070708_100021827 3300005445 Bacteria 5421
90 Ga0070708_100101511 3300005445 Unclassified 2635
91 Ga0070708_100131620 3300005445 Bacteria 2315
92 Ga0070708_100253799 3300005445 Bacteria 1652
93 Ga0070663_100013988 3300005455 Bacteria 5138
94 Ga0070678_100054406 3300005456 Bacteria 2916
95 Ga0070678_100078967 3300005456 Bacteria 2487
96 Ga0070678_100080474 3300005456 Bacteria 2467
97 Ga0070678_100089327 3300005456 Bacteria 2358
98 Ga0070662_100117808 3300005457 Bacteria 2032
99 Ga0070681_10055781 3300005458 Bacteria 3933
100 Ga0070681_10152872 3300005458 Bacteria 2234
101 Ga0070681_10379759 3300005458 Bacteria 1324
102 Ga0068867_100075612 3300005459 Unclassified 2527
103 Ga0070685_10062305 3300005466 Bacteria 2187
104 Ga0070706_100000486 3300005467 Bacteria 46746
105 Ga0070706_100000682 3300005467 Bacteria 38464
106 Ga0070706_100020767 3300005467 Bacteria 6047
107 Ga0070706_100050788 3300005467 Bacteria 3827
108 Ga0070706_100055019 3300005467 Bacteria 3673
109 Ga0070706_100057677 3300005467 Bacteria 3584
110 Ga0070706_100081188 3300005467 Bacteria 3003
111 Ga0070706_100083158 3300005467 Bacteria 2965
112 Ga0070706_100089070 3300005467 Bacteria 2861
113 Ga0070706_100204596 3300005467 Bacteria 1844
114 Ga0070706_100235119 3300005467 Unclassified 1711
115 Ga0070707_100000439 3300005468 Bacteria 41289
116 Ga0070707_100016084 3300005468 Bacteria 7019
117 Ga0070707_100027295 3300005468 Bacteria 5432
118 Ga0070707_100042472 3300005468 Bacteria 4353
119 Ga0070707_100061615 3300005468 Bacteria 3599
120 Ga0070707_100085073 3300005468 Bacteria 3056
121 Ga0070707_100125199 3300005468 Bacteria 2496
122 Ga0070707_100150068 3300005468 Bacteria 2269
123 Ga0070698_100001910 3300005471 Bacteria 23223
124 Ga0070698_100001955 3300005471 Bacteria 22884
125 Ga0070698_100002836 3300005471 Bacteria 19067
126 Ga0070698_100015938 3300005471 Bacteria 7936
127 Ga0070698_100071646 3300005471 Bacteria 3475
128 Ga0070698_100101532 3300005471 Bacteria 2848
129 Ga0070698_100229660 3300005471 Bacteria 1789
130 Ga0070699_100046511 3300005518 Bacteria 3754
131 Ga0070699_100152415 3300005518 Bacteria 2045
132 Ga0070679_100096098 3300005530 Bacteria 2950
133 Ga0070684_100000867 3300005535 Bacteria 21400
134 Ga0070684_100005822 3300005535 Bacteria 9483
135 Ga0070684_100217013 3300005535 Unclassified 1745
136 Ga0070697_100000863 3300005536 Bacteria 22791
137 Ga0070697_100001033 3300005536 Bacteria 21037
138 Ga0070697_100002512 3300005536 Bacteria 14111
139 Ga0070697_100008554 3300005536 Bacteria 7993
140 Ga0070697_100041927 3300005536 Bacteria 3705
141 Ga0070697_100042181 3300005536 Bacteria 3692
142 Ga0070697_100047090 3300005536 Bacteria 3497
143 Ga0070697_100092839 3300005536 Bacteria 2498
144 Ga0070697_100097846 3300005536 Bacteria 2435
145 Ga0070697_100121632 3300005536 Bacteria 2184
146 Ga0070697_100189869 3300005536 Bacteria 1743
147 Ga0070697_100266370 3300005536 Bacteria 1468
148 Ga0068853_100000019 3300005539 Bacteria 163178
149 Ga0070672_100004102 3300005543 Bacteria 9511
150 Ga0070672_100017190 3300005543 Bacteria 5201
151 Ga0070672_100182741 3300005543 Bacteria 1748
152 Ga0070686_100016315 3300005544 Unclassified 4318
153 Ga0070695_100047723 3300005545 Bacteria 2736
154 Ga0070696_100016980 3300005546 Bacteria 4910
155 Ga0070665_100000045 3300005548 Bacteria 275023
156 Ga0070665_100044076 3300005548 Bacteria 4480
157 Ga0070665_100061296 3300005548 Bacteria 3770
158 Ga0070665_100082822 3300005548 Bacteria 3213
159 Ga0070665_100093570 3300005548 Unclassified 3011
160 Ga0070665_100117564 3300005548 Bacteria 2661
161 Ga0070665_100330318 3300005548 Bacteria 1529
162 Ga0070704_100003377 3300005549 Bacteria 9155
163 Ga0070704_100098571 3300005549 Unclassified 2196
164 Ga0070664_100133864 3300005564 Bacteria 2178
165 Ga0070664_100366233 3300005564 Bacteria 1313
166 Ga0068856_100000034 3300005614 Bacteria 124288
167 Ga0068856_100037919 3300005614 Bacteria 4730
168 Ga0070702_100058211 3300005615 Bacteria 2238
169 Ga0068852_100115316 3300005616 Bacteria 2449
170 Ga0068863_100055186 3300005841 Bacteria 3763
171 Ga0068863_100102701 3300005841 Bacteria 2719
172 Ga0068863_100196370 3300005841 Bacteria 1940
173 Ga0068858_100014527 3300005842 Bacteria 7418
174 Ga0068858_100042252 3300005842 Bacteria 4227
175 Ga0068858_100050555 3300005842 Bacteria 3847
176 Ga0068858_100079108 3300005842 Bacteria 3055
177 Ga0068858_100145821 3300005842 Bacteria 2223
178 Ga0068860_100000267 3300005843 Bacteria 76469
179 Ga0068860_100007230 3300005843 Bacteria 11100
180 Ga0068860_100424984 3300005843 Bacteria 1318
181 Ga0081455_10000647 3300005937 Bacteria 45079
182 Ga0081455_10004485 3300005937 Bacteria 15617
183 Ga0081455_10006460 3300005937 Bacteria 12563
184 Ga0081455_10009604 3300005937 Bacteria 9935
185 Ga0081455_10036756 3300005937 Bacteria 4356
186 Ga0081455_10133291 3300005937 Bacteria 1939
187 Ga0081538_10089434 3300005981 Bacteria 1598
188 Ga0081540_1000014 3300005983 Bacteria 179266
189 Ga0081540_1009067 3300005983 Bacteria 6874
190 Ga0081540_1018113 3300005983 Bacteria 4334
191 Ga0081539_10000026 3300005985 Bacteria 330830
192 Ga0081539_10001918 3300005985 Bacteria 32176
193 Ga0081539_10018211 3300005985 Bacteria 4887
194 Ga0081539_10024423 3300005985 Bacteria 3921
195 Ga0070717_10000722 3300006028 Bacteria 21468
196 Ga0070717_10022602 3300006028 Bacteria 4971
197 Ga0070717_10025634 3300006028 Bacteria 4692
198 Ga0070717_10105109 3300006028 Bacteria 2403
199 Ga0070717_10143990 3300006028 Bacteria 2057
200 Ga0070717_10208540 3300006028 Bacteria 1714
201 Ga0070715_10064642 3300006163 Bacteria 1617
202 Ga0070716_100022413 3300006173 Bacteria 3338
203 Ga0070716_100022474 3300006173 Unclassified 3334
204 Ga0070712_100012423 3300006175 Bacteria 5414
205 Ga0070712_100111713 3300006175 Bacteria 2041
206 Ga0070712_100271488 3300006175 Bacteria 1363
207 Ga0097621_100095912 3300006237 Bacteria 2488
208 Ga0097621_100166811 3300006237 Bacteria 1896
209 Ga0068871_100004871 3300006358 Bacteria 9378
210 Ga0068871_100116582 3300006358 Bacteria 2252
211 Ga0075434_100152428 3300006871 Bacteria 2332
212 Ga0075434_100215594 3300006871 Bacteria 1939
213 Ga0068865_100051332 3300006881 Bacteria 2854
214 Ga0068865_100100784 3300006881 Bacteria 2114
215 Ga0075436_100020242 3300006914 Bacteria 4566
216 Ga0099795_10042549 3300007788 Unclassified 1622
217 Ga0105240_10000043 3300009093 Bacteria 254256
218 Ga0105240_10051315 3300009093 Bacteria 5192
219 Ga0111539_10099327 3300009094 Bacteria 3418
220 Ga0105245_10120109 3300009098 Bacteria 2454
221 Ga0105245_10349057 3300009098 Bacteria 1465
222 Ga0105245_10436561 3300009098 Bacteria 1315
223 Ga0105245_10502662 3300009098 Bacteria 1228
224 Ga0105247_10054966 3300009101 Unclassified 2457
225 Ga0114129_10000103 3300009147 Bacteria 83612
226 Ga0114129_10035429 3300009147 Bacteria 7050
227 Ga0114129_10374906 3300009147 Bacteria 1880
228 Ga0105241_10201501 3300009174 Bacteria 1662
229 Ga0105242_10029291 3300009176 Bacteria 4390
230 Ga0105248_10333253 3300009177 Bacteria 1709
231 Ga0105237_10001748 3300009545 Bacteria 28071
232 Ga0105237_10188280 3300009545 Bacteria 2064
233 Ga0105237_10288777 3300009545 Bacteria 1643
234 Ga0105238_10044916 3300009551 Bacteria 4465
235 Ga0105249_10024448 3300009553 Bacteria 5429
236 Ga0105249_10237894 3300009553 Bacteria 1799
237 Ga0105239_10551247 3300010375 Bacteria 1313
238 Ga0157371_10038347 3300013102 Bacteria 3429
239 Ga0157374_10000057 3300013296 Bacteria 117036
240 Ga0157374_10004496 3300013296 Bacteria 11716
241 Ga0157374_10007233 3300013296 Bacteria 9458
242 Ga0157374_10037911 3300013296 Bacteria 4428
243 Ga0157374_10044145 3300013296 Bacteria 4120
244 Ga0157374_10081132 3300013296 Bacteria 3078
245 Ga0157374_10087899 3300013296 Bacteria 2959
246 Ga0157374_10176713 3300013296 Bacteria 2084
247 Ga0157374_10201975 3300013296 Unclassified 1947
248 Ga0157378_10018503 3300013297 Bacteria 6122
249 Ga0157378_10024006 3300013297 Bacteria 5364
250 Ga0157378_10054393 3300013297 Bacteria 3564
251 Ga0157378_10068364 3300013297 Bacteria 3186
252 Ga0157378_10071172 3300013297 Bacteria 3123
253 Ga0157378_10078171 3300013297 Bacteria 2984
254 Ga0157378_10112062 3300013297 Bacteria 2502
255 Ga0157378_10229860 3300013297 Bacteria 1767
256 Ga0163162_10025378 3300013306 Bacteria 5855
257 Ga0163162_10047251 3300013306 Bacteria 4314
258 Ga0163162_10060882 3300013306 Bacteria 3812
259 Ga0163162_10144190 3300013306 Unclassified 2496
260 Ga0163162_10602761 3300013306 Bacteria 1224
261 Ga0157372_10057724 3300013307 Bacteria 4339
262 Ga0157372_10112022 3300013307 Bacteria 3126
263 Ga0157375_10008603 3300013308 Bacteria 8936
264 Ga0157375_10010745 3300013308 Bacteria 8068
265 Ga0157375_10023425 3300013308 Bacteria 5697
266 Ga0157375_10064562 3300013308 Bacteria 3645
267 Ga0157375_10176708 3300013308 Unclassified 2285
268 Ga0157375_10179016 3300013308 Bacteria 2271
269 Ga0157375_10297905 3300013308 Bacteria 1776
270 Ga0157375_10719957 3300013308 Bacteria 1151
271 Ga0157377_10028407 3300014745 Bacteria 3010
272 Ga0157379_10000955 3300014968 Bacteria 23432
273 Ga0157376_10000167 3300014969 Bacteria 45629
274 Ga0157376_10023967 3300014969 Bacteria 4787
275 Ga0157376_10321217 3300014969 Bacteria 1472
276 Ga0163161_10001720 3300017792 Bacteria 16042
277 Ga0213872_10003443 3300021361 Bacteria 8796
278 Ga0213872_10016774 3300021361 Unclassified 3396
279 Ga0213872_10040464 3300021361 Unclassified 2128
280 Ga0213872_10071725 3300021361 Bacteria 1561
281 Ga0213872_10072238 3300021361 Bacteria 1554
282 Ga0213876_10000436 3300021384 Bacteria 34060
283 Ga0213876_10015249 3300021384 Bacteria 4070
284 Ga0213876_10033943 3300021384 Bacteria 2690
285 Ga0207666_1000551 3300025271 Bacteria 4547
286 Ga0207673_1001689 3300025290 Bacteria 2440
287 Ga0209050_1001026 3300025298 Bacteria 34801
288 Ga0207697_10000711 3300025315 Bacteria 18972
289 Ga0207697_10001019 3300025315 Bacteria 15693
290 Ga0207697_10001026 3300025315 Bacteria 15584
291 Ga0207697_10002216 3300025315 Bacteria 10156
292 Ga0207697_10006343 3300025315 Bacteria 5362
293 Ga0207697_10011392 3300025315 Bacteria 3762
294 Ga0207697_10035311 3300025315 Bacteria 2046
295 Ga0207697_10038616 3300025315 Bacteria 1958
296 Ga0207697_10057290 3300025315 Unclassified 1617
297 Ga0207647_10022787 3300025904 Bacteria 4154
298 Ga0207699_10006262 3300025906 Bacteria 5749
299 Ga0207645_10007467 3300025907 Bacteria 7718
300 Ga0207645_10025105 3300025907 Bacteria 3859
301 Ga0207705_10010015 3300025909 Bacteria 6900
302 Ga0207684_10000732 3300025910 Bacteria 38532
303 Ga0207684_10000736 3300025910 Bacteria 38478
304 Ga0207684_10022277 3300025910 Bacteria 5409
305 Ga0207684_10023202 3300025910 Bacteria 5299
306 Ga0207684_10030132 3300025910 Bacteria 4620
307 Ga0207684_10034250 3300025910 Bacteria 4316
308 Ga0207684_10056115 3300025910 Bacteria 3341
309 Ga0207684_10078986 3300025910 Bacteria 2799
310 Ga0207684_10086660 3300025910 Bacteria 2667
311 Ga0207684_10289926 3300025910 Bacteria 1411
312 Ga0207707_10441752 3300025912 Bacteria 1114
313 Ga0207695_10000181 3300025913 Bacteria 185042
314 Ga0207695_10037840 3300025913 Bacteria 5202
315 Ga0207671_10101182 3300025914 Bacteria 2183
316 Ga0207693_10000519 3300025915 Bacteria 34790
317 Ga0207693_10012437 3300025915 Bacteria 6877
318 Ga0207693_10041825 3300025915 Unclassified 3607
319 Ga0207693_10061905 3300025915 Bacteria 2931
320 Ga0207693_10358224 3300025915 Bacteria 1141
321 Ga0207663_10017524 3300025916 Bacteria 3993
322 Ga0207663_10156417 3300025916 Unclassified 1604
323 Ga0207657_10059524 3300025919 Bacteria 3281
324 Ga0207649_10001293 3300025920 Bacteria 14940
325 Ga0207649_10118906 3300025920 Bacteria 1778
326 Ga0207652_10124191 3300025921 Bacteria 2298
327 Ga0207652_10141814 3300025921 Bacteria 2149
328 Ga0207652_10508632 3300025921 Bacteria 1084
329 Ga0207646_10000358 3300025922 Bacteria 61519
330 Ga0207646_10000504 3300025922 Bacteria 52235
331 Ga0207646_10019070 3300025922 Bacteria 6382
332 Ga0207646_10069243 3300025922 Bacteria 3151
333 Ga0207646_10080185 3300025922 Bacteria 2919
334 Ga0207646_10113637 3300025922 Bacteria 2431
335 Ga0207646_10117084 3300025922 Bacteria 2393
336 Ga0207646_10157121 3300025922 Bacteria 2051
337 Ga0207646_10164142 3300025922 Bacteria 2005
338 Ga0207646_10199480 3300025922 Bacteria 1807
339 Ga0207646_10348454 3300025922 Bacteria 1338
340 Ga0207681_10036357 3300025923 Bacteria 3249
341 Ga0207681_10185972 3300025923 Bacteria 1586
342 Ga0207659_10006886 3300025926 Bacteria 6990
343 Ga0207659_10023427 3300025926 Bacteria 4120
344 Ga0207659_10039321 3300025926 Bacteria 3298
345 Ga0207659_10095941 3300025926 Bacteria 2225
346 Ga0207659_10113072 3300025926 Bacteria 2067
347 Ga0207659_10301977 3300025926 Bacteria 1315
348 Ga0207687_10166765 3300025927 Bacteria 1695
349 Ga0207700_10039694 3300025928 Bacteria 3429
350 Ga0207700_10219714 3300025928 Unclassified 1610
351 Ga0207664_10194683 3300025929 Bacteria 1747
352 Ga0207644_10029901 3300025931 Bacteria 3782
353 Ga0207644_10032104 3300025931 Bacteria 3661
354 Ga0207644_10091874 3300025931 Bacteria 2264
355 Ga0207644_10093635 3300025931 Unclassified 2243
356 Ga0207644_10310470 3300025931 Bacteria 1273
357 Ga0207644_10402378 3300025931 Bacteria 1119
358 Ga0207706_10008411 3300025933 Bacteria 9522
359 Ga0207706_10012445 3300025933 Bacteria 7752
360 Ga0207706_10025875 3300025933 Bacteria 5255
361 Ga0207706_10157172 3300025933 Bacteria 1999
362 Ga0207670_10033258 3300025936 Bacteria 3321
363 Ga0207670_10158742 3300025936 Unclassified 1686
364 Ga0207669_10013374 3300025937 Bacteria 4072
365 Ga0207669_10020170 3300025937 Bacteria 3488
366 Ga0207669_10186104 3300025937 Bacteria 1493
367 Ga0207704_10041027 3300025938 Bacteria 2710
368 Ga0207665_10002889 3300025939 Bacteria 11524
369 Ga0207665_10076280 3300025939 Bacteria 2298
370 Ga0207665_10120287 3300025939 Bacteria 1854
371 Ga0207665_10304853 3300025939 Bacteria 1191
372 Ga0207691_10010431 3300025940 Bacteria 8914
373 Ga0207691_10028541 3300025940 Bacteria 5224
374 Ga0207691_10153220 3300025940 Bacteria 2026
375 Ga0207691_10228090 3300025940 Bacteria 1613
376 Ga0207691_10421093 3300025940 Bacteria 1138
377 Ga0207711_10310151 3300025941 Bacteria 1457
378 Ga0207661_10086125 3300025944 Bacteria 2606
379 Ga0207661_10090864 3300025944 Bacteria 2543
380 Ga0207679_10121424 3300025945 Bacteria 2081
381 Ga0207651_10030013 3300025960 Bacteria 3455
382 Ga0207651_10062025 3300025960 Bacteria 2603
383 Ga0207651_10273957 3300025960 Bacteria 1391
384 Ga0207712_10082106 3300025961 Bacteria 2349
385 Ga0207668_10021116 3300025972 Bacteria 4149
386 Ga0207677_10038703 3300026023 Bacteria 3129
387 Ga0207677_10214718 3300026023 Bacteria 1539
388 Ga0207677_10239180 3300026023 Bacteria 1468
389 Ga0207677_10290301 3300026023 Bacteria 1347
390 Ga0207703_10003475 3300026035 Bacteria 13192
391 Ga0207703_10021358 3300026035 Bacteria 5068
392 Ga0207703_10042374 3300026035 Bacteria 3651
393 Ga0207703_10092542 3300026035 Bacteria 2545
394 Ga0207639_10000032 3300026041 Bacteria 163200
395 Ga0207678_10009556 3300026067 Bacteria 8530
396 Ga0207678_10260615 3300026067 Bacteria 1486
397 Ga0207708_10003639 3300026075 Bacteria 11369
398 Ga0207702_10001213 3300026078 Bacteria 26152
399 Ga0207641_10025943 3300026088 Bacteria 4835
400 Ga0207641_10044372 3300026088 Bacteria 3739
401 Ga0207648_10046947 3300026089 Bacteria 3786
402 Ga0207675_100042959 3300026118 Bacteria 4221
403 Ga0207683_10002403 3300026121 Bacteria 16353
404 Ga0207683_10006136 3300026121 Bacteria 10295
405 Ga0207683_10010617 3300026121 Bacteria 7854
406 Ga0207683_10034825 3300026121 Bacteria 4378
407 Ga0207683_10039296 3300026121 Bacteria 4128
408 Ga0207683_10087370 3300026121 Bacteria 2773
409 Ga0268266_10000035 3300028379 Bacteria 351632
410 Ga0268266_10005284 3300028379 Bacteria 12125
411 Ga0268266_10104972 3300028379 Bacteria 2495
412 Ga0268264_10000357 3300028381 Bacteria 68576
413 Ga0268264_10015640 3300028381 Bacteria 6214
414 Ga0307405_10000705 3300031731 Bacteria 12985
415 Ga0307410_10005922 3300031852 Bacteria 6536
416 Ga0307406_10004526 3300031901 Bacteria 7572
417 Ga0307407_10000488 3300031903 Bacteria 12215
418 Ga0307412_10012198 3300031911 Bacteria 4997
419 Ga0307409_100002090 3300031995 Bacteria 10270
420 Ga0307409_100045942 3300031995 Bacteria 3302
421 Ga0307409_100085208 3300031995 Bacteria 2568
422 Ga0307416_100001096 3300032002 Bacteria 14491
423 Ga0307414_10003838 3300032004 Bacteria 8088
424 Ga0307411_10000856 3300032005 Bacteria 11439
425 Ga0307415_100038346 3300032126 Bacteria 3157
426 Ga0373936_0029733 3300035113 Bacteria 2152
427 Ga0373957_0042064 3300035120 Bacteria 1723
428 Ga0373946_0030606 3300035171 Bacteria 2150
429 Ga0373955_0013148 3300035172 Bacteria 3993
430 Ga0373935_0029415 3300035692 Unclassified 3401
431 Ga0373937_0356522 3300036401 Bacteria 1386
432 Ga0373925_0145570 3300037068 Bacteria 1857
433 Ga0373925_0155570 3300037068 Unclassified 1798
434 Ga0395899_0000032 3300037312 Bacteria 312705
435 Ga0395899_0063447 3300037312 Bacteria 2718
436 Ga0395900_0021221 3300037418 Bacteria 6641
437 Ga0395900_0093654 3300037418 Bacteria 3086
438 Ga0395900_0177328 3300037418 Bacteria 2167
439 Ga0395898_0000562 3300037466 Bacteria 69459
440 Ga0395898_0009649 3300037466 Bacteria 10134
441 Ga0395905_0047592 3300037471 Bacteria 4018
442 Ga0436364_0757601 3300037853 Bacteria 2902
443 Ga0395901_0023212 3300038443 Bacteria 6359
444 Ga0395901_0078520 3300038443 Bacteria 3447
445 Ga0436365_0273579 3300039437 Bacteria 2609
446 Ga0436365_0331687 3300039437 Bacteria 2289
447 Ga0436365_0341737 3300039437 Bacteria 3888
448 Ga0436365_1611898 3300039437 Bacteria 31421
449 Ga0436365_1670361 3300039437 Bacteria 34125
450 Ga0436360_0112463 3300039438 Bacteria 3054
451 Ga0436360_0805228 3300039438 Bacteria 7230
452 Ga0436360_1368532 3300039438 Bacteria 2039
453 Ga0436361_0185988 3300039447 Bacteria 4222
454 Ga0436361_0370321 3300039447 Bacteria 2993
455 Ga0436361_0379036 3300039447 Bacteria 3414
456 Ga0436361_0913064 3300039447 Bacteria 4625
457 Ga0436361_0981302 3300039447 Bacteria 4385
458 Ga0436361_1022396 3300039447 Unclassified 1271
459 Ga0436363_0385326 3300039450 Bacteria 21920
460 Ga0436363_0452248 3300039450 Bacteria 2644
461 Ga0439451_013534 3300042009 Bacteria 1649
462 Ga0451577_0001850 3300042876 Bacteria 26973
463 Ga0466965_0002850 3300044683 Bacteria 7459
464 Ga0466964_0074513 3300044706 Bacteria 1443
465 Ga0466971_0000487 3300044719 Bacteria 15562
466 Ga0466957_0009885 3300044842 Bacteria 5456
467 Ga0466957_0024527 3300044842 Bacteria 3569
468 Ga0451576_0025966 3300045051 Bacteria 6305
469 Ga0466967_0065309 3300045976 Bacteria 3239
470 Ga0495592_0002133 3300046454 Bacteria 13918
471 Ga0495603_0154795 3300046455 Bacteria 1331
472 Ga0495651_0198775 3300046462 Bacteria 1405
473 Ga0495628_0001627 3300046516 Bacteria 20557
474 Ga0495643_0000191 3300046522 Bacteria 97250
475 Ga0495652_0010248 3300046529 Bacteria 8498
476 Ga0495652_0169736 3300046529 Bacteria 1685
477 Ga0495586_0082222 3300046535 Bacteria 1771
478 Ga0495645_0035622 3300046543 Unclassified 3627
479 Ga0495588_0041340 3300046674 Bacteria 2354
480 Ga0495599_0018811 3300046678 Unclassified 4305
481 Ga0495623_0020374 3300046679 Bacteria 4285
482 Ga0495658_0140495 3300046683 Unclassified 1477
483 Ga0495669_0010184 3300046684 Bacteria 3970
484 Ga0495613_0112788 3300046689 Unclassified 1958
485 Ga0495674_0190222 3300047319 Bacteria 1706
486 Ga0495675_0003717 3300047444 Bacteria 9221
487 Ga0495684_0014707 3300047471 Bacteria 6024
488 Ga0495602_0032833 3300048088 Unclassified 4881
489 Ga0496100_0054692 3300048903 Unclassified 2604
490 Ga0496101_0003972 3300048904 Bacteria 9255
491 Ga0496101_0116185 3300048904 Bacteria 2019
492 Ga0496101_0223513 3300048904 Bacteria 1462
493 Ga0496103_0008787 3300048906 Bacteria 5994
494 Ga0496104_0024302 3300048907 Bacteria 5574
495 Ga0496105_0021269 3300048908 Bacteria 5250
496 Ga0496105_0042228 3300048908 Bacteria 3759
497 Ga0496106_0023644 3300048909 Bacteria 4565
498 Ga0496106_0133490 3300048909 Bacteria 1948
499 Ga0496107_0004082 3300048910 Bacteria 9836
500 Ga0496107_0181093 3300048910 Unclassified 1565
501 Ga0496109_0055227 3300048912 Bacteria 3623
502 Ga0496109_0114042 3300048912 Bacteria 2514
503 Ga0496109_0117764 3300048912 Bacteria 2473
504 Ga0496109_0208225 3300048912 Bacteria 1839
505 Ga0496109_0292020 3300048912 Bacteria 1537
506 Ga0496110_0068757 3300048913 Bacteria 3135
507 Ga0496110_0275593 3300048913 Bacteria 1532
508 Ga0496112_0007814 3300048915 Bacteria 9520
509 Ga0496112_0042702 3300048915 Bacteria 4437
510 Ga0496112_0058570 3300048915 Bacteria 3794
511 Ga0496112_0077685 3300048915 Bacteria 3283
512 Ga0496112_0108381 3300048915 Bacteria 2748
513 Ga0496114_0012098 3300048917 Bacteria 6905
514 Ga0496114_0123450 3300048917 Bacteria 2229
515 Ga0496115_0004994 3300048918 Bacteria 9635
516 Ga0496115_0007640 3300048918 Bacteria 7965
517 Ga0496115_0088217 3300048918 Bacteria 2532
518 Ga0496115_0095108 3300048918 Bacteria 2438
519 Ga0496115_0155598 3300048918 Bacteria 1889
520 Ga0501031_0004941 3300049568 Bacteria 8667
521 Ga0501032_0003948 3300049569 Bacteria 11255
522 Ga0501033_0000131 3300049570 Bacteria 72998
523 Ga0501033_0000235 3300049570 Bacteria 53367
524 Ga0501036_0123665 3300049572 Bacteria 2185
525 Ga0501037_0000022 3300049573 Bacteria 147056
526 Ga0501038_0013985 3300049574 Bacteria 7313
527 Ga0501038_0032147 3300049574 Bacteria 4631
528 Ga0501043_0001901 3300049579 Bacteria 17895
529 Ga0501043_0009488 3300049579 Bacteria 7632
530 Ga0501047_0028502 3300049581 Bacteria 5384
531 Ga0501070_0000394 3300049586 Bacteria 40082
532 Ga0501075_0356289 3300049591 Bacteria 1115
533 Ga0501081_0158189 3300049743 Bacteria 1631
534 Ga0501035_0000003 3300049822 Bacteria 557461
535 Ga0501044_0000669 3300049823 Bacteria 41390
536 nmdc:mga05p37_192038_c2 3300050507 Bacteria 1314
537 nmdc:mga05p37_3050_c2 3300050507 Bacteria 9900
538 nmdc:mga0n895_236461_c1 3300050512 Bacteria 1854
539 nmdc:mga08x19_8867_c1 3300050514 Bacteria 5999
540 Ga0495601_0001627 3300053077 Bacteria 12367
541 Ga0500556_0002370 3300053104 Bacteria 6116
542 Ga0500594_0031548 3300053118 Bacteria 1398
543 Ga0500642_0042127 3300053130 Bacteria 1978
544 Ga0500616_0004329 3300053153 Bacteria 10170
545 Ga0466962_0000021 3300061719 Bacteria 89078
546 2787508637 2786546548 Bacteria 4745694
547 Ga0207428_10201979
548 CNXas_1000009
549 JGI24737J22298_10050373
550 JGI24743J22301_10001127
551 JGI24033J26618_1000063
552 rootH2_10005428
553 rootH2_10006650
554 rootH2_10016401
555 rootL2_10043152
556 rootH1_10025348
557 JGI25404J52841_10001788
558 Ga0055530_10010894
559 Ga0065704_10005956
560 Ga0065704_10018270
561 Ga0065704_10110450
562 Ga0065704_10209150
563 Ga0065712_10002047
564 Ga0065712_10004529
565 Ga0065712_10089630
566 Ga0065712_10092062
567 Ga0065712_10110450
568 Ga0065715_10008361
569 Ga0065715_10091931
570 Ga0065715_10099155
571 Ga0065715_10127476
572 Ga0065715_10159950
573 Ga0065707_10113797
574 Ga0070658_10010667
575 Ga0070658_10172350
576 Ga0070676_10074588
577 Ga0070676_10202940
578 Ga0070683_100077013
579 Ga0070683_100134048
580 Ga0070683_100167155
581 Ga0070690_100087288
582 Ga0070690_100144709
583 Ga0070670_100006070
584 Ga0070670_100155829
585 Ga0070677_10091281
586 Ga0070666_10034276
587 Ga0070666_10035080
588 Ga0070680_100069990
589 Ga0070680_100292079
590 Ga0068868_100023781
591 Ga0068868_100038723
592 Ga0070689_100023688
593 Ga0070689_100036215
594 Ga0070689_100078245
595 Ga0070687_100073720
596 Ga0070661_100000788
597 Ga0070661_100008265
598 Ga0070661_100181409
599 Ga0070668_100001931
600 Ga0070668_100052358
601 Ga0070669_100036447
602 Ga0070669_100045734
603 Ga0070669_100104198
604 Ga0070669_100175551
605 Ga0070675_100001426
606 Ga0070675_100303742
607 Ga0070675_100437990
608 Ga0070671_100010298
609 Ga0070671_100024517
610 Ga0070671_100175541
611 Ga0070674_100011159
612 Ga0070674_100011784
613 Ga0070673_100005630
614 Ga0070688_100005067
615 Ga0070688_100031651
616 Ga0070688_100079916
617 Ga0070659_100006359
618 Ga0070659_100311642
619 Ga0070709_10113801
620 Ga0070714_100219283
621 Ga0070714_100223906
622 Ga0070714_100229730
623 Ga0070713_100002205
624 Ga0070713_100010603
625 Ga0070710_10020816
626 Ga0070710_10068336
627 Ga0070711_100009047
628 Ga0070711_100081017
629 Ga0070705_100014022
630 Ga0070705_100098276
631 Ga0070705_100209464
632 Ga0070700_100003873
633 Ga0070708_100013304
634 Ga0070708_100016953
635 Ga0070708_100021827
636 Ga0070708_100101511
637 Ga0070708_100131620
638 Ga0070708_100253799
639 Ga0070663_100013988
640 Ga0070678_100054406
641 Ga0070678_100078967
642 Ga0070678_100080474
643 Ga0070678_100089327
644 Ga0070662_100117808
645 Ga0070681_10055781
646 Ga0070681_10152872
647 Ga0070681_10379759
648 Ga0068867_100075612
649 Ga0070685_10062305
650 Ga0070706_100000486
651 Ga0070706_100000682
652 Ga0070706_100020767
653 Ga0070706_100050788
654 Ga0070706_100055019
655 Ga0070706_100057677
656 Ga0070706_100081188
657 Ga0070706_100083158
658 Ga0070706_100089070
659 Ga0070706_100204596
660 Ga0070706_100235119
661 Ga0070707_100000439
662 Ga0070707_100016084
663 Ga0070707_100027295
664 Ga0070707_100042472
665 Ga0070707_100061615
666 Ga0070707_100085073
667 Ga0070707_100125199
668 Ga0070707_100150068
669 Ga0070698_100001910
670 Ga0070698_100001955
671 Ga0070698_100002836
672 Ga0070698_100015938
673 Ga0070698_100071646
674 Ga0070698_100101532
675 Ga0070698_100229660
676 Ga0070699_100046511
677 Ga0070699_100152415
678 Ga0070679_100096098
679 Ga0070684_100000867
680 Ga0070684_100005822
681 Ga0070684_100217013
682 Ga0070697_100000863
683 Ga0070697_100001033
684 Ga0070697_100002512
685 Ga0070697_100008554
686 Ga0070697_100041927
687 Ga0070697_100042181
688 Ga0070697_100047090
689 Ga0070697_100092839
690 Ga0070697_100097846
691 Ga0070697_100121632
692 Ga0070697_100189869
693 Ga0070697_100266370
694 Ga0068853_100000019
695 Ga0070672_100004102
696 Ga0070672_100017190
697 Ga0070672_100182741
698 Ga0070686_100016315
699 Ga0070695_100047723
700 Ga0070696_100016980
701 Ga0070665_100000045
702 Ga0070665_100044076
703 Ga0070665_100061296
704 Ga0070665_100082822
705 Ga0070665_100093570
706 Ga0070665_100117564
707 Ga0070665_100330318
708 Ga0070704_100003377
709 Ga0070704_100098571
710 Ga0070664_100133864
711 Ga0070664_100366233
712 Ga0068856_100000034
713 Ga0068856_100037919
714 Ga0070702_100058211
715 Ga0068852_100115316
716 Ga0068863_100055186
717 Ga0068863_100102701
718 Ga0068863_100196370
719 Ga0068858_100014527
720 Ga0068858_100042252
721 Ga0068858_100050555
722 Ga0068858_100079108
723 Ga0068858_100145821
724 Ga0068860_100000267
725 Ga0068860_100007230
726 Ga0068860_100424984
727 Ga0081455_10000647
728 Ga0081455_10004485
729 Ga0081455_10006460
730 Ga0081455_10009604
731 Ga0081455_10036756
732 Ga0081455_10133291
733 Ga0081538_10089434
734 Ga0081540_1000014
735 Ga0081540_1009067
736 Ga0081540_1018113
737 Ga0081539_10000026
738 Ga0081539_10001918
739 Ga0081539_10018211
740 Ga0081539_10024423
741 Ga0070717_10000722
742 Ga0070717_10022602
743 Ga0070717_10025634
744 Ga0070717_10105109
745 Ga0070717_10143990
746 Ga0070717_10208540
747 Ga0070715_10064642
748 Ga0070716_100022413
749 Ga0070716_100022474
750 Ga0070712_100012423
751 Ga0070712_100111713
752 Ga0070712_100271488
753 Ga0097621_100095912
754 Ga0097621_100166811
755 Ga0068871_100004871
756 Ga0068871_100116582
757 Ga0075434_100152428
758 Ga0075434_100215594
759 Ga0068865_100051332
760 Ga0068865_100100784
761 Ga0075436_100020242
762 Ga0099795_10042549
763 Ga0105240_10000043
764 Ga0105240_10051315
765 Ga0111539_10099327
766 Ga0105245_10120109
767 Ga0105245_10349057
768 Ga0105245_10436561
769 Ga0105245_10502662
770 Ga0105247_10054966
771 Ga0114129_10000103
772 Ga0114129_10035429
773 Ga0114129_10374906
774 Ga0105241_10201501
775 Ga0105242_10029291
776 Ga0105248_10333253
777 Ga0105237_10001748
778 Ga0105237_10188280
779 Ga0105237_10288777
780 Ga0105238_10044916
781 Ga0105249_10024448
782 Ga0105249_10237894
783 Ga0105239_10551247
784 Ga0157371_10038347
785 Ga0157374_10000057
786 Ga0157374_10004496
787 Ga0157374_10007233
788 Ga0157374_10037911
789 Ga0157374_10044145
790 Ga0157374_10081132
791 Ga0157374_10087899
792 Ga0157374_10176713
793 Ga0157374_10201975
794 Ga0157378_10018503
795 Ga0157378_10024006
796 Ga0157378_10054393
797 Ga0157378_10068364
798 Ga0157378_10071172
799 Ga0157378_10078171
800 Ga0157378_10112062
801 Ga0157378_10229860
802 Ga0163162_10025378
803 Ga0163162_10047251
804 Ga0163162_10060882
805 Ga0163162_10144190
806 Ga0163162_10602761
807 Ga0157372_10057724
808 Ga0157372_10112022
809 Ga0157375_10008603
810 Ga0157375_10010745
811 Ga0157375_10023425
812 Ga0157375_10064562
813 Ga0157375_10176708
814 Ga0157375_10179016
815 Ga0157375_10297905
816 Ga0157375_10719957
817 Ga0157377_10028407
818 Ga0157379_10000955
819 Ga0157376_10000167
820 Ga0157376_10023967
821 Ga0157376_10321217
822 Ga0163161_10001720
823 Ga0213872_10003443
824 Ga0213872_10016774
825 Ga0213872_10040464
826 Ga0213872_10071725
827 Ga0213872_10072238
828 Ga0213876_10000436
829 Ga0213876_10015249
830 Ga0213876_10033943
831 Ga0207666_1000551
832 Ga0207673_1001689
833 Ga0209050_1001026
834 Ga0207697_10000711
835 Ga0207697_10001019
836 Ga0207697_10001026
837 Ga0207697_10002216
838 Ga0207697_10006343
839 Ga0207697_10011392
840 Ga0207697_10035311
841 Ga0207697_10038616
842 Ga0207697_10057290
843 Ga0207647_10022787
844 Ga0207699_10006262
845 Ga0207645_10007467
846 Ga0207645_10025105
847 Ga0207705_10010015
848 Ga0207684_10000732
849 Ga0207684_10000736
850 Ga0207684_10022277
851 Ga0207684_10023202
852 Ga0207684_10030132
853 Ga0207684_10034250
854 Ga0207684_10056115
855 Ga0207684_10078986
856 Ga0207684_10086660
857 Ga0207684_10289926
858 Ga0207707_10441752
859 Ga0207695_10000181
860 Ga0207695_10037840
861 Ga0207671_10101182
862 Ga0207693_10000519
863 Ga0207693_10012437
864 Ga0207693_10041825
865 Ga0207693_10061905
866 Ga0207693_10358224
867 Ga0207663_10017524
868 Ga0207663_10156417
869 Ga0207657_10059524
870 Ga0207649_10001293
871 Ga0207649_10118906
872 Ga0207652_10124191
873 Ga0207652_10141814
874 Ga0207652_10508632
875 Ga0207646_10000358
876 Ga0207646_10000504
877 Ga0207646_10019070
878 Ga0207646_10069243
879 Ga0207646_10080185
880 Ga0207646_10113637
881 Ga0207646_10117084
882 Ga0207646_10157121
883 Ga0207646_10164142
884 Ga0207646_10199480
885 Ga0207646_10348454
886 Ga0207681_10036357
887 Ga0207681_10185972
888 Ga0207659_10006886
889 Ga0207659_10023427
890 Ga0207659_10039321
891 Ga0207659_10095941
892 Ga0207659_10113072
893 Ga0207659_10301977
894 Ga0207687_10166765
895 Ga0207700_10039694
896 Ga0207700_10219714
897 Ga0207664_10194683
898 Ga0207644_10029901
899 Ga0207644_10032104
900 Ga0207644_10091874
901 Ga0207644_10093635
902 Ga0207644_10310470
903 Ga0207644_10402378
904 Ga0207706_10008411
905 Ga0207706_10012445
906 Ga0207706_10025875
907 Ga0207706_10157172
908 Ga0207670_10033258
909 Ga0207670_10158742
910 Ga0207669_10013374
911 Ga0207669_10020170
912 Ga0207669_10186104
913 Ga0207704_10041027
914 Ga0207665_10002889
915 Ga0207665_10076280
916 Ga0207665_10120287
917 Ga0207665_10304853
918 Ga0207691_10010431
919 Ga0207691_10028541
920 Ga0207691_10153220
921 Ga0207691_10228090
922 Ga0207691_10421093
923 Ga0207711_10310151
924 Ga0207661_10086125
925 Ga0207661_10090864
926 Ga0207679_10121424
927 Ga0207651_10030013
928 Ga0207651_10062025
929 Ga0207651_10273957
930 Ga0207712_10082106
931 Ga0207668_10021116
932 Ga0207677_10038703
933 Ga0207677_10214718
934 Ga0207677_10239180
935 Ga0207677_10290301
936 Ga0207703_10003475
937 Ga0207703_10021358
938 Ga0207703_10042374
939 Ga0207703_10092542
940 Ga0207639_10000032
941 Ga0207678_10009556
942 Ga0207678_10260615
943 Ga0207708_10003639
944 Ga0207702_10001213
945 Ga0207641_10025943
946 Ga0207641_10044372
947 Ga0207648_10046947
948 Ga0207675_100042959
949 Ga0207683_10002403
950 Ga0207683_10006136
951 Ga0207683_10010617
952 Ga0207683_10034825
953 Ga0207683_10039296
954 Ga0207683_10087370
955 Ga0268266_10000035
956 Ga0268266_10005284
957 Ga0268266_10104972
958 Ga0268264_10000357
959 Ga0268264_10015640
960 Ga0307405_10000705
961 Ga0307410_10005922
962 Ga0307406_10004526
963 Ga0307407_10000488
964 Ga0307412_10012198
965 Ga0307409_100002090
966 Ga0307409_100045942
967 Ga0307409_100085208
968 Ga0307416_100001096
969 Ga0307414_10003838
970 Ga0307411_10000856
971 Ga0307415_100038346
972 Ga0373936_0029733
973 Ga0373957_0042064
974 Ga0373946_0030606
975 Ga0373955_0013148
976 Ga0373935_0029415
977 Ga0373937_0356522
978 Ga0373925_0145570
979 Ga0373925_0155570
980 Ga0395899_0000032
981 Ga0395899_0063447
982 Ga0395900_0021221
983 Ga0395900_0093654
984 Ga0395900_0177328
985 Ga0395898_0000562
986 Ga0395898_0009649
987 Ga0395905_0047592
988 Ga0436364_0757601
989 Ga0395901_0023212
990 Ga0395901_0078520
991 Ga0436365_0273579
992 Ga0436365_0331687
993 Ga0436365_0341737
994 Ga0436365_1611898
995 Ga0436365_1670361
996 Ga0436360_0112463
997 Ga0436360_0805228
998 Ga0436360_1368532
999 Ga0436361_0185988
1000 Ga0436361_0370321
1001 Ga0436361_0379036
1002 Ga0436361_0913064
1003 Ga0436361_0981302
1004 Ga0436361_1022396
1005 Ga0436363_0385326
1006 Ga0436363_0452248
1007 Ga0439451_013534
1008 Ga0451577_0001850
1009 Ga0466965_0002850
1010 Ga0466964_0074513
1011 Ga0466971_0000487
1012 Ga0466957_0009885
1013 Ga0466957_0024527
1014 Ga0451576_0025966
1015 Ga0466967_0065309
1016 Ga0495592_0002133
1017 Ga0495603_0154795
1018 Ga0495651_0198775
1019 Ga0495628_0001627
1020 Ga0495643_0000191
1021 Ga0495652_0010248
1022 Ga0495652_0169736
1023 Ga0495586_0082222
1024 Ga0495645_0035622
1025 Ga0495588_0041340
1026 Ga0495599_0018811
1027 Ga0495623_0020374
1028 Ga0495658_0140495
1029 Ga0495669_0010184
1030 Ga0495613_0112788
1031 Ga0495674_0190222
1032 Ga0495675_0003717
1033 Ga0495684_0014707
1034 Ga0495602_0032833
1035 Ga0496100_0054692
1036 Ga0496101_0003972
1037 Ga0496101_0116185
1038 Ga0496101_0223513
1039 Ga0496103_0008787
1040 Ga0496104_0024302
1041 Ga0496105_0021269
1042 Ga0496105_0042228
1043 Ga0496106_0023644
1044 Ga0496106_0133490
1045 Ga0496107_0004082
1046 Ga0496107_0181093
1047 Ga0496109_0055227
1048 Ga0496109_0114042
1049 Ga0496109_0117764
1050 Ga0496109_0208225
1051 Ga0496109_0292020
1052 Ga0496110_0068757
1053 Ga0496110_0275593
1054 Ga0496112_0007814
1055 Ga0496112_0042702
1056 Ga0496112_0058570
1057 Ga0496112_0077685
1058 Ga0496112_0108381
1059 Ga0496114_0012098
1060 Ga0496114_0123450
1061 Ga0496115_0004994
1062 Ga0496115_0007640
1063 Ga0496115_0088217
1064 Ga0496115_0095108
1065 Ga0496115_0155598
1066 Ga0501031_0004941
1067 Ga0501032_0003948
1068 Ga0501033_0000131
1069 Ga0501033_0000235
1070 Ga0501036_0123665
1071 Ga0501037_0000022
1072 Ga0501038_0013985
1073 Ga0501038_0032147
1074 Ga0501043_0001901
1075 Ga0501043_0009488
1076 Ga0501047_0028502
1077 Ga0501070_0000394
1078 Ga0501075_0356289
1079 Ga0501081_0158189
1080 Ga0501035_0000003
1081 Ga0501044_0000669
1082 nmdc:mga05p37_192038_c2
1083 nmdc:mga05p37_3050_c2
1084 nmdc:mga0n895_236461_c1
1085 nmdc:mga08x19_8867_c1
1086 Ga0495601_0001627
1087 Ga0500556_0002370
1088 Ga0500594_0031548
1089 Ga0500642_0042127
1090 Ga0500616_0004329
1091 Ga0466962_0000021
1092 2787508637

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

40

176

0.83

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

112

209

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3puy-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state 0.9003 4 250
7nnt-assembly1.cif.gz_B cryo-em structure of the folate-specific ecf transporter complex in ddm micelles 0.8951 40 244
6xgz-assembly3.cif.gz_E crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.8946 2 245
6xgz-assembly2.cif.gz_C crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.8898 2 244
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.8881 1 240
ID Description Score Start End Superfamily
af_Q9XW49_440_685_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9302 1 248 3.40.50.300
af_Q2FVS3_1_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9273 1 243 3.40.50.300
af_A4HV32_726_961_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9254 2 246 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9226 1 245 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9208 4 248 3.40.50.300
ID Description Score Start End GO Terms
AF-T1AL51-F1-model_v4 ABC transporter, ATP binding/permease protein 0.9308 1 247 GO:0005524
GO:0016887
AF-A0A6G2UJN6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9298 2 217 GO:0005524
GO:0016887
GO:0046677
AF-A0A7I7SA04-F1-model_v4 deleted 0.9297 38 248
AF-A0A511X0H7-F1-model_v4 ABC transporter domain-containing protein 0.9297 1 205 GO:0005524
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9292 1 246 GO:0005524
GO:0016887

Map