F462079

General Info

Members Datasets Scaffolds Average Seq Length
547 273 547 99

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_101347168|Ga0068859_1013471682
Length 107
Sequence MRRAVRALKRIYSSFNLAAVYHARNVLEAEGIRALVKNEMLSSAMGELPPAECQAELWVLRASEAERAARLLKYELWTEGVPWRCAACGESSEPQFTQCWRCGAYRT

Samples

Sample ID Description Type Environment
1 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
146 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
147 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
173 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
174 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
175 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
176 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
177 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
178 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
179 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
180 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
229 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
230 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
248 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
254 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.18
Rhizosphere 99.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1070434 3300002076 Bacteria 540
2 Ga0065707_10004016 3300005295 Bacteria 5740
3 Ga0065707_10014317 3300005295 Bacteria 1722
4 Ga0070690_100000335 3300005330 Bacteria 24144
5 Ga0070690_100112218 3300005330 Bacteria 1820
6 Ga0068869_100001158 3300005334 Bacteria 15429
7 Ga0068869_100659656 3300005334 Bacteria 889
8 Ga0068869_101230353 3300005334 Bacteria 659
9 Ga0070680_100014145 3300005336 Bacteria 6232
10 Ga0070680_100324222 3300005336 Bacteria 1308
11 Ga0070680_100787444 3300005336 Unclassified 819
12 Ga0070680_101676107 3300005336 Bacteria 551
13 Ga0070682_100042183 3300005337 Bacteria 2815
14 Ga0068868_100000378 3300005338 Bacteria 30380
15 Ga0068868_102111502 3300005338 Unclassified 536
16 Ga0070689_100029187 3300005340 Bacteria 4172
17 Ga0070689_100038792 3300005340 Bacteria 3644
18 Ga0070689_100052957 3300005340 Bacteria 3140
19 Ga0070689_100085539 3300005340 Bacteria 2480
20 Ga0070689_101993857 3300005340 Bacteria 531
21 Ga0070691_10010712 3300005341 Bacteria 4186
22 Ga0070691_10046647 3300005341 Bacteria 2059
23 Ga0070687_100000353 3300005343 Bacteria 15629
24 Ga0070687_100851383 3300005343 Bacteria 650
25 Ga0070692_10003721 3300005345 Bacteria 6256
26 Ga0070692_10041072 3300005345 Bacteria 2368
27 Ga0070692_10548474 3300005345 Bacteria 757
28 Ga0070669_100086279 3300005353 Bacteria 2345
29 Ga0070675_100776465 3300005354 Bacteria 875
30 Ga0070671_100657961 3300005355 Unclassified 907
31 Ga0070673_100076315 3300005364 Bacteria 2706
32 Ga0070673_100356585 3300005364 Bacteria 1299
33 Ga0070688_100057770 3300005365 Bacteria 2440
34 Ga0070688_100396158 3300005365 Bacteria 1021
35 Ga0070703_10006589 3300005406 Bacteria 3255
36 Ga0070703_10046014 3300005406 Bacteria 1378
37 Ga0070703_10270622 3300005406 Bacteria 697
38 Ga0070714_100515251 3300005435 Bacteria 1142
39 Ga0070701_10000027 3300005438 Bacteria 38022
40 Ga0070701_10683453 3300005438 Bacteria 689
41 Ga0070711_100230792 3300005439 Bacteria 1443
42 Ga0070705_100000061 3300005440 Bacteria 56772
43 Ga0070705_100312551 3300005440 Bacteria 1131
44 Ga0070705_100993991 3300005440 Bacteria 680
45 Ga0070700_100000386 3300005441 Bacteria 22650
46 Ga0070700_100103049 3300005441 Bacteria 1884
47 Ga0070700_100163653 3300005441 Bacteria 1534
48 Ga0070694_100000096 3300005444 Bacteria 42431
49 Ga0070694_100004187 3300005444 Bacteria 8668
50 Ga0070694_100064216 3300005444 Bacteria 2512
51 Ga0070694_100124419 3300005444 Bacteria 1854
52 Ga0070694_100404432 3300005444 Bacteria 1069
53 Ga0070694_100526049 3300005444 Bacteria 944
54 Ga0070694_101334292 3300005444 Bacteria 604
55 Ga0070708_101410064 3300005445 Bacteria 650
56 Ga0070678_100339582 3300005456 Bacteria 1288
57 Ga0070681_10032716 3300005458 Bacteria 5221
58 Ga0070681_11733851 3300005458 Bacteria 551
59 Ga0068867_100001399 3300005459 Bacteria 16670
60 Ga0068867_100992492 3300005459 Bacteria 761
61 Ga0070706_101343694 3300005467 Bacteria 655
62 Ga0070707_100060346 3300005468 Bacteria 3637
63 Ga0070698_100214935 3300005471 Bacteria 1857
64 Ga0070698_101020568 3300005471 Bacteria 775
65 Ga0070699_100258895 3300005518 Bacteria 1556
66 Ga0070699_100341536 3300005518 Bacteria 1348
67 Ga0070699_100424320 3300005518 Bacteria 1204
68 Ga0070679_100030156 3300005530 Bacteria 5353
69 Ga0070697_100677716 3300005536 Bacteria 909
70 Ga0068853_100032789 3300005539 Bacteria 4403
71 Ga0068853_100739161 3300005539 Unclassified 940
72 Ga0070686_100001578 3300005544 Bacteria 12805
73 Ga0070686_100621417 3300005544 Bacteria 854
74 Ga0070686_101384765 3300005544 Bacteria 590
75 Ga0070695_100000965 3300005545 Bacteria 15608
76 Ga0070695_100010236 3300005545 Bacteria 5595
77 Ga0070695_100038330 3300005545 Bacteria 3024
78 Ga0070695_100338984 3300005545 Bacteria 1123
79 Ga0070695_101352078 3300005545 Bacteria 590
80 Ga0070696_100000560 3300005546 Bacteria 23643
81 Ga0070696_100007068 3300005546 Bacteria 7495
82 Ga0070696_100058464 3300005546 Bacteria 2693
83 Ga0070696_100069113 3300005546 Bacteria 2481
84 Ga0070696_100277018 3300005546 Bacteria 1277
85 Ga0070696_100872946 3300005546 Bacteria 745
86 Ga0070696_101654844 3300005546 Bacteria 551
87 Ga0070693_100000003 3300005547 Bacteria 95793
88 Ga0070693_100325727 3300005547 Bacteria 1044
89 Ga0070693_100815156 3300005547 Bacteria 693
90 Ga0070704_100000504 3300005549 Bacteria 18563
91 Ga0070704_100038185 3300005549 Bacteria 3287
92 Ga0070704_100038276 3300005549 Bacteria 3285
93 Ga0070704_100056791 3300005549 Bacteria 2781
94 Ga0070704_100549860 3300005549 Bacteria 1008
95 Ga0068855_100005492 3300005563 Bacteria 15467
96 Ga0068857_100857972 3300005577 Bacteria 869
97 Ga0068854_100003450 3300005578 Bacteria 9865
98 Ga0068856_100144011 3300005614 Bacteria 2391
99 Ga0068856_100181533 3300005614 Bacteria 2117
100 Ga0070702_100000004 3300005615 Bacteria 70302
101 Ga0070702_100217042 3300005615 Bacteria 1277
102 Ga0070702_100426614 3300005615 Bacteria 956
103 Ga0068852_100068470 3300005616 Bacteria 3107
104 Ga0068852_102334300 3300005616 Unclassified 556
105 Ga0068859_100002292 3300005617 Bacteria 19424
106 Ga0068859_100496457 3300005617 Bacteria 1316
107 Ga0068859_101347168 3300005617 Bacteria 787
108 Ga0068859_102533112 3300005617 Unclassified 565
109 Ga0068864_100318573 3300005618 Unclassified 1460
110 Ga0068866_10000342 3300005718 Bacteria 21994
111 Ga0068861_100001170 3300005719 Bacteria 16343
112 Ga0068861_100926822 3300005719 Bacteria 827
113 Ga0068870_10004636 3300005840 Bacteria 5929
114 Ga0068870_10667036 3300005840 Unclassified 714
115 Ga0068863_100255736 3300005841 Bacteria 1692
116 Ga0068863_102309958 3300005841 Bacteria 547
117 Ga0068858_100002734 3300005842 Bacteria 17741
118 Ga0068860_100002098 3300005843 Bacteria 21009
119 Ga0068862_100001419 3300005844 Bacteria 22189
120 Ga0068862_100209721 3300005844 Bacteria 1760
121 Ga0068862_100223759 3300005844 Bacteria 1704
122 Ga0068862_100631912 3300005844 Bacteria 1031
123 Ga0097621_100000024 3300006237 Bacteria 81390
124 Ga0068871_100002217 3300006358 Bacteria 13190
125 Ga0075428_100004856 3300006844 Bacteria 14915
126 Ga0075428_100101689 3300006844 Bacteria 3133
127 Ga0075428_100552022 3300006844 Bacteria 1231
128 Ga0075428_101802543 3300006844 Bacteria 637
129 Ga0075430_100000969 3300006846 Bacteria 22599
130 Ga0075430_100260665 3300006846 Bacteria 1436
131 Ga0075430_100333374 3300006846 Bacteria 1253
132 Ga0075430_100725297 3300006846 Bacteria 819
133 Ga0075430_101355137 3300006846 Bacteria 585
134 Ga0075431_100152711 3300006847 Bacteria 2377
135 Ga0075431_100215892 3300006847 Bacteria 1958
136 Ga0075431_101950940 3300006847 Bacteria 542
137 Ga0075433_10030077 3300006852 Bacteria 4632
138 Ga0075433_10269771 3300006852 Bacteria 1508
139 Ga0075433_10414417 3300006852 Bacteria 1188
140 Ga0075433_10724170 3300006852 Bacteria 871
141 Ga0075433_10828727 3300006852 Bacteria 808
142 Ga0075434_100001724 3300006871 Bacteria 18761
143 Ga0075434_100146287 3300006871 Bacteria 2383
144 Ga0075434_100412890 3300006871 Bacteria 1371
145 Ga0075434_100604109 3300006871 Bacteria 1116
146 Ga0075429_100000496 3300006880 Bacteria 29568
147 Ga0075429_100052059 3300006880 Bacteria 3562
148 Ga0075429_100496424 3300006880 Bacteria 1069
149 Ga0075429_100564167 3300006880 Bacteria 998
150 Ga0075429_100980912 3300006880 Unclassified 739
151 Ga0075429_101048655 3300006880 Bacteria 712
152 Ga0068865_100000417 3300006881 Bacteria 23766
153 Ga0075436_100000142 3300006914 Bacteria 43453
154 Ga0075436_100008614 3300006914 Bacteria 6972
155 Ga0075436_100012065 3300006914 Bacteria 5927
156 Ga0097620_100002292 3300006931 Bacteria 19424
157 Ga0097620_100496459 3300006931 Bacteria 1316
158 Ga0097620_101347157 3300006931 Bacteria 787
159 Ga0097620_102533510 3300006931 Unclassified 565
160 Ga0075435_100008441 3300007076 Bacteria 7391
161 Ga0075435_100023958 3300007076 Bacteria 4729
162 Ga0075435_100214664 3300007076 Bacteria 1633
163 Ga0075435_100348670 3300007076 Bacteria 1269
164 Ga0075435_100619590 3300007076 Bacteria 939
165 Ga0099794_10048506 3300007265 Bacteria 2038
166 Ga0099794_10765755 3300007265 Bacteria 516
167 Ga0105240_10289283 3300009093 Bacteria 1879
168 Ga0111539_10028668 3300009094 Bacteria 6790
169 Ga0111539_10096214 3300009094 Bacteria 3478
170 Ga0111539_11087744 3300009094 Bacteria 929
171 Ga0111539_11114271 3300009094 Bacteria 917
172 Ga0111539_11193443 3300009094 Bacteria 884
173 Ga0111539_11840597 3300009094 Bacteria 702
174 Ga0105245_10038220 3300009098 Bacteria 4271
175 Ga0114129_10001872 3300009147 Bacteria 28684
176 Ga0114129_10337806 3300009147 Bacteria 1999
177 Ga0114129_13097735 3300009147 Bacteria 544
178 Ga0105243_10000339 3300009148 Bacteria 51082
179 Ga0105241_10015808 3300009174 Bacteria 5529
180 Ga0105242_10000346 3300009176 Bacteria 37361
181 Ga0105248_10357117 3300009177 Bacteria 1645
182 Ga0105249_10012564 3300009553 Bacteria 7464
183 Ga0105239_10433348 3300010375 Bacteria 1490
184 Ga0105246_10052088 3300011119 Bacteria 2812
185 Ga0105246_10421530 3300011119 Bacteria 1114
186 Ga0157378_10000192 3300013297 Bacteria 59014
187 Ga0157375_10350516 3300013308 Bacteria 1642
188 Ga0157375_11441174 3300013308 Unclassified 812
189 Ga0157380_10007200 3300014326 Bacteria 7882
190 Ga0157380_10746265 3300014326 Bacteria 990
191 Ga0157380_12563027 3300014326 Unclassified 576
192 Ga0157377_10170307 3300014745 Bacteria 1361
193 Ga0157377_11034594 3300014745 Unclassified 624
194 Ga0157379_11367602 3300014968 Bacteria 685
195 Ga0157376_10021789 3300014969 Bacteria 4980
196 Ga0207653_10008181 3300025885 Bacteria 3260
197 Ga0207653_10278474 3300025885 Bacteria 645
198 Ga0207642_10001562 3300025899 Bacteria 7050
199 Ga0207688_10034726 3300025901 Bacteria 2793
200 Ga0207680_10968270 3300025903 Bacteria 610
201 Ga0207643_10022819 3300025908 Bacteria 3448
202 Ga0207643_10562698 3300025908 Bacteria 732
203 Ga0207643_10584830 3300025908 Unclassified 718
204 Ga0207684_10393779 3300025910 Bacteria 1191
205 Ga0207684_10997503 3300025910 Bacteria 701
206 Ga0207654_10068769 3300025911 Bacteria 2096
207 Ga0207707_10026336 3300025912 Bacteria 5083
208 Ga0207695_10908393 3300025913 Bacteria 760
209 Ga0207663_10132078 3300025916 Bacteria 1727
210 Ga0207663_10892900 3300025916 Bacteria 710
211 Ga0207660_10006379 3300025917 Bacteria 7645
212 Ga0207660_10571607 3300025917 Bacteria 920
213 Ga0207662_10000653 3300025918 Bacteria 15703
214 Ga0207662_10159138 3300025918 Bacteria 1442
215 Ga0207652_10017093 3300025921 Bacteria 5934
216 Ga0207646_11102331 3300025922 Bacteria 699
217 Ga0207681_10061208 3300025923 Bacteria 2587
218 Ga0207694_11688766 3300025924 Unclassified 533
219 Ga0207659_10965981 3300025926 Bacteria 733
220 Ga0207687_10000454 3300025927 Bacteria 27910
221 Ga0207686_10000806 3300025934 Bacteria 19237
222 Ga0207709_10000297 3300025935 Bacteria 55386
223 Ga0207670_10000590 3300025936 Bacteria 19930
224 Ga0207670_10204585 3300025936 Bacteria 1502
225 Ga0207670_10582027 3300025936 Bacteria 917
226 Ga0207670_11170261 3300025936 Unclassified 650
227 Ga0207704_10000251 3300025938 Bacteria 26202
228 Ga0207689_10000103 3300025942 Bacteria 69244
229 Ga0207689_10173261 3300025942 Bacteria 1779
230 Ga0207689_10639396 3300025942 Bacteria 896
231 Ga0207689_11352639 3300025942 Bacteria 598
232 Ga0207667_10007221 3300025949 Bacteria 13405
233 Ga0207667_11472842 3300025949 Unclassified 652
234 Ga0207651_10432190 3300025960 Bacteria 1126
235 Ga0207651_10783580 3300025960 Bacteria 844
236 Ga0207712_10007693 3300025961 Bacteria 6813
237 Ga0207640_10002458 3300025981 Bacteria 9915
238 Ga0207677_10000533 3300026023 Bacteria 24049
239 Ga0207703_10000898 3300026035 Bacteria 29129
240 Ga0207639_10255285 3300026041 Bacteria 1531
241 Ga0207639_10935617 3300026041 Unclassified 811
242 Ga0207708_10000048 3300026075 Bacteria 114754
243 Ga0207708_10099345 3300026075 Bacteria 2251
244 Ga0207708_10136212 3300026075 Bacteria 1923
245 Ga0207702_10110494 3300026078 Bacteria 2443
246 Ga0207641_10430228 3300026088 Bacteria 1272
247 Ga0207641_10709501 3300026088 Unclassified 991
248 Ga0207641_11426660 3300026088 Bacteria 693
249 Ga0207648_10001181 3300026089 Bacteria 29231
250 Ga0207676_10151260 3300026095 Bacteria 1999
251 Ga0207674_10783206 3300026116 Bacteria 920
252 Ga0207675_100000593 3300026118 Bacteria 35437
253 Ga0207675_100380909 3300026118 Bacteria 1387
254 Ga0207675_101881946 3300026118 Unclassified 617
255 Ga0207675_102256862 3300026118 Unclassified 559
256 Ga0207683_10296710 3300026121 Bacteria 1479
257 Ga0207698_10130723 3300026142 Bacteria 2145
258 Ga0209969_1000935 3300027360 Bacteria 3952
259 Ga0209967_1000341 3300027364 Bacteria 6208
260 Ga0209967_1008800 3300027364 Bacteria 1394
261 Ga0209967_1063258 3300027364 Bacteria 575
262 Ga0209981_1003509 3300027378 Bacteria 2038
263 Ga0209981_1034749 3300027378 Bacteria 745
264 Ga0209996_1001756 3300027395 Bacteria 2644
265 Ga0209996_1005558 3300027395 Bacteria 1616
266 Ga0210000_1003999 3300027462 Bacteria 2134
267 Ga0210000_1009043 3300027462 Bacteria 1464
268 Ga0210000_1013014 3300027462 Bacteria 1239
269 Ga0210000_1032061 3300027462 Bacteria 823
270 Ga0209995_1012882 3300027471 Bacteria 1367
271 Ga0209968_1007688 3300027526 Bacteria 1633
272 Ga0209968_1023725 3300027526 Bacteria 1004
273 Ga0209968_1039555 3300027526 Bacteria 804
274 Ga0209999_1053645 3300027543 Bacteria 763
275 Ga0209983_1009613 3300027665 Bacteria 1977
276 Ga0209983_1018474 3300027665 Bacteria 1447
277 Ga0209588_1158990 3300027671 Bacteria 714
278 Ga0209966_1001170 3300027695 Bacteria 4683
279 Ga0209966_1005922 3300027695 Bacteria 2111
280 Ga0207428_10001315 3300027907 Bacteria 26451
281 Ga0207428_10466492 3300027907 Bacteria 920
282 Ga0268265_10001097 3300028380 Bacteria 24045
283 Ga0268265_10226154 3300028380 Bacteria 1641
284 Ga0268265_10493241 3300028380 Bacteria 1153
285 Ga0268264_10001229 3300028381 Bacteria 24608
286 Ga0268264_10118907 3300028381 Bacteria 2326
287 Ga0307408_100351273 3300031548 Bacteria 1251
288 Ga0307408_100867652 3300031548 Unclassified 824
289 Ga0307408_101624463 3300031548 Bacteria 614
290 Ga0307408_102018082 3300031548 Bacteria 555
291 Ga0307405_10436012 3300031731 Bacteria 1035
292 Ga0307413_11750810 3300031824 Bacteria 555
293 Ga0307406_10489352 3300031901 Bacteria 995
294 Ga0307406_11218519 3300031901 Bacteria 654
295 Ga0307412_10256369 3300031911 Bacteria 1361
296 Ga0307409_101162890 3300031995 Bacteria 794
297 Ga0307409_102286518 3300031995 Bacteria 570
298 Ga0307416_100234360 3300032002 Bacteria 1772
299 Ga0307416_100279814 3300032002 Bacteria 1644
300 Ga0307416_100887468 3300032002 Bacteria 991
301 Ga0307416_101527416 3300032002 Bacteria 773
302 Ga0307416_101715366 3300032002 Bacteria 733
303 Ga0373930_0075034 3300034816 Bacteria 774
304 Ga0373930_0076282 3300034816 Bacteria 769
305 Ga0373948_0007555 3300034817 Unclassified 1832
306 Ga0373958_0090307 3300034819 Bacteria 706
307 Ga0373958_0187810 3300034819 Unclassified 535
308 Ga0373926_0001853 3300035083 Bacteria 6583
309 Ga0373928_0218609 3300035084 Bacteria 556
310 Ga0373940_0006129 3300035088 Bacteria 2646
311 Ga0373940_0082640 3300035088 Bacteria 952
312 Ga0373944_0114925 3300035089 Bacteria 922
313 Ga0373923_0046854 3300035111 Bacteria 1800
314 Ga0373932_0005675 3300035112 Bacteria 2936
315 Ga0373932_0208714 3300035112 Bacteria 697
316 Ga0373932_0342170 3300035112 Bacteria 567
317 Ga0373936_0012274 3300035113 Bacteria 3256
318 Ga0373936_0511581 3300035113 Bacteria 559
319 Ga0373939_0003338 3300035114 Bacteria 3768
320 Ga0373941_0094607 3300035115 Unclassified 1031
321 Ga0373941_0128249 3300035115 Bacteria 911
322 Ga0373945_0002027 3300035116 Bacteria 6301
323 Ga0373960_0005276 3300035121 Bacteria 2988
324 Ga0373960_0026206 3300035121 Unclassified 1591
325 Ga0373943_0112843 3300035170 Bacteria 1435
326 Ga0373946_0027343 3300035171 Bacteria 2255
327 Ga0373946_0032062 3300035171 Bacteria 2108
328 Ga0373955_0523840 3300035172 Bacteria 724
329 Ga0373942_0045506 3300035207 Unclassified 1212
330 Ga0373942_0145007 3300035207 Bacteria 759
331 Ga0373961_0356179 3300035241 Bacteria 553
332 Ga0373962_0005654 3300035242 Bacteria 3018
333 Ga0373924_0078045 3300035410 Bacteria 1405
334 Ga0373931_0001701 3300035691 Bacteria 9534
335 Ga0373931_0005942 3300035691 Bacteria 5676
336 Ga0373931_0251719 3300035691 Bacteria 1074
337 Ga0373931_0309791 3300035691 Unclassified 977
338 Ga0373935_0037106 3300035692 Bacteria 3049
339 Ga0373927_0224957 3300035695 Bacteria 1232
340 Ga0373947_0151792 3300035725 Bacteria 1492
341 Ga0373937_0027675 3300036401 Bacteria 5129
342 Ga0373925_0140207 3300037068 Bacteria 1891
343 Ga0373925_0227750 3300037068 Bacteria 1489
344 Ga0242420_041902 3300038996 Bacteria 876
345 Ga0439439_0162324 3300041406 Bacteria 638
346 Ga0439453_0063056 3300041408 Bacteria 771
347 Ga0439453_0081833 3300041408 Bacteria 697
348 Ga0439461_0002609 3300041410 Bacteria 2901
349 Ga0439465_0210171 3300041413 Bacteria 711
350 Ga0439441_001833 3300042001 Bacteria 2886
351 Ga0439441_020394 3300042001 Bacteria 1214
352 Ga0450888_045601 3300042126 Unclassified 619
353 Ga0450898_104048 3300042134 Unclassified 595
354 Ga0439434_0000327 3300042435 Bacteria 13478
355 Ga0439434_0065614 3300042435 Bacteria 1139
356 Ga0439435_0000043 3300042436 Bacteria 14055
357 Ga0439435_0000831 3300042436 Bacteria 5270
358 Ga0439435_0042707 3300042436 Bacteria 1273
359 Ga0439444_0000510 3300042437 Bacteria 4365
360 Ga0439444_0002926 3300042437 Bacteria 2376
361 Ga0439460_0001357 3300042461 Bacteria 5755
362 Ga0451577_0436653 3300042876 Bacteria 1189
363 Ga0453683_0241345 3300044673 Bacteria 1151
364 Ga0453684_0419155 3300044712 Bacteria 1496
365 Ga0451576_0007423 3300045051 Bacteria 13110
366 Ga0451576_0094232 3300045051 Bacteria 3113
367 Ga0451576_0103711 3300045051 Bacteria 2958
368 Ga0451576_0111760 3300045051 Bacteria 2843
369 Ga0451576_0859020 3300045051 Bacteria 952
370 Ga0495592_0144972 3300046454 Bacteria 1647
371 Ga0495653_0088878 3300046463 Bacteria 2265
372 Ga0495580_0064097 3300046472 Bacteria 2576
373 Ga0495582_0030860 3300046473 Bacteria 2945
374 Ga0495639_0024781 3300046475 Bacteria 2642
375 Ga0495662_0010692 3300046476 Bacteria 4488
376 Ga0495608_0004174 3300046511 Bacteria 10362
377 Ga0495618_0007803 3300046514 Bacteria 6478
378 Ga0495628_0015350 3300046516 Bacteria 6396
379 Ga0495630_0053374 3300046517 Bacteria 3026
380 Ga0495630_0229142 3300046517 Bacteria 1419
381 Ga0495644_0158588 3300046523 Unclassified 867
382 Ga0495666_0037729 3300046526 Bacteria 2350
383 Ga0495642_0066310 3300046528 Bacteria 1504
384 Ga0495652_0400760 3300046529 Bacteria 971
385 Ga0495665_0025372 3300046531 Bacteria 3184
386 Ga0495640_0006542 3300046533 Bacteria 9205
387 Ga0495586_0001122 3300046535 Bacteria 15063
388 Ga0495586_0003090 3300046535 Bacteria 8973
389 Ga0495587_0182562 3300046536 Bacteria 1189
390 Ga0495621_0015137 3300046539 Bacteria 2455
391 Ga0495645_0043321 3300046543 Bacteria 3283
392 Ga0495667_0006793 3300046559 Bacteria 7766
393 Ga0495656_0016860 3300046615 Bacteria 2777
394 Ga0495634_0016497 3300046642 Bacteria 5283
395 Ga0495635_0065769 3300046663 Bacteria 2487
396 Ga0495659_0028236 3300046664 Bacteria 1941
397 Ga0495659_0156507 3300046664 Bacteria 918
398 Ga0495599_0004175 3300046678 Bacteria 8526
399 Ga0495658_0002217 3300046683 Bacteria 9820
400 Ga0495658_0046663 3300046683 Bacteria 2436
401 Ga0495658_0328829 3300046683 Bacteria 970
402 Ga0495658_0982454 3300046683 Bacteria 539
403 Ga0495613_0008754 3300046689 Bacteria 7505
404 Ga0495624_0251646 3300046690 Bacteria 1068
405 Ga0495600_0016281 3300046809 Bacteria 4716
406 Ga0495581_0521541 3300047315 Bacteria 690
407 Ga0495604_0003608 3300047317 Bacteria 12336
408 Ga0495636_0005309 3300047318 Bacteria 5061
409 Ga0495636_0160047 3300047318 Unclassified 1014
410 Ga0495674_1077781 3300047319 Unclassified 612
411 Ga0495680_0004943 3300047322 Bacteria 12613
412 Ga0495685_154116 3300047447 Bacteria 746
413 Ga0495593_0054403 3300047673 Bacteria 2110
414 Ga0495602_0721738 3300048088 Bacteria 675
415 Ga0495614_0550505 3300048089 Bacteria 552
416 Ga0496114_0244555 3300048917 Bacteria 1578
417 Ga0501291_073751 3300049514 Bacteria 666
418 Ga0501291_145365 3300049514 Bacteria 532
419 Ga0501298_032279 3300049521 Bacteria 1033
420 Ga0501301_014980 3300049524 Bacteria 687
421 Ga0501031_0335901 3300049568 Bacteria 978
422 Ga0501031_0906632 3300049568 Bacteria 564
423 Ga0501033_0235638 3300049570 Bacteria 1299
424 Ga0501036_0109864 3300049572 Bacteria 2330
425 Ga0501036_0175905 3300049572 Bacteria 1802
426 Ga0501036_1181214 3300049572 Bacteria 624
427 Ga0501038_0163217 3300049574 Bacteria 1809
428 Ga0501038_0390191 3300049574 Bacteria 1079
429 Ga0501039_0032224 3300049575 Bacteria 4040
430 Ga0501039_0074075 3300049575 Bacteria 2646
431 Ga0501039_0096349 3300049575 Bacteria 2307
432 Ga0501039_0236417 3300049575 Bacteria 1437
433 Ga0501039_0322384 3300049575 Bacteria 1214
434 Ga0501039_0629093 3300049575 Bacteria 841
435 Ga0501040_0072651 3300049576 Bacteria 2376
436 Ga0501040_0257837 3300049576 Bacteria 1244
437 Ga0501040_0281278 3300049576 Bacteria 1188
438 Ga0501040_0309663 3300049576 Bacteria 1129
439 Ga0501040_0771604 3300049576 Bacteria 695
440 Ga0501041_0052281 3300049577 Bacteria 2490
441 Ga0501041_0753993 3300049577 Bacteria 624
442 Ga0501041_0783338 3300049577 Bacteria 611
443 Ga0501042_0078476 3300049578 Bacteria 2365
444 Ga0501042_0373827 3300049578 Bacteria 1031
445 Ga0501042_0597798 3300049578 Bacteria 802
446 Ga0501043_0073068 3300049579 Bacteria 2694
447 Ga0501043_0365420 3300049579 Bacteria 1095
448 Ga0501043_0389956 3300049579 Bacteria 1053
449 Ga0501046_0247179 3300049580 Bacteria 1314
450 Ga0501048_0044897 3300049582 Bacteria 3157
451 Ga0501048_0214866 3300049582 Bacteria 1364
452 Ga0501071_0370798 3300049587 Bacteria 1091
453 Ga0501071_0540988 3300049587 Bacteria 894
454 Ga0501071_0541405 3300049587 Bacteria 894
455 Ga0501071_0582484 3300049587 Bacteria 860
456 Ga0501072_0043357 3300049588 Bacteria 3536
457 Ga0501072_0053110 3300049588 Bacteria 3191
458 Ga0501072_0175799 3300049588 Bacteria 1708
459 Ga0501072_0233396 3300049588 Bacteria 1465
460 Ga0501072_0916982 3300049588 Bacteria 684
461 Ga0501072_1343029 3300049588 Bacteria 554
462 Ga0501075_0023147 3300049591 Bacteria 4546
463 Ga0501075_0050733 3300049591 Bacteria 3119
464 Ga0501075_0832096 3300049591 Bacteria 702
465 Ga0501075_0834800 3300049591 Bacteria 701
466 Ga0501076_0006798 3300049592 Bacteria 8299
467 Ga0501076_0116029 3300049592 Bacteria 2167
468 Ga0501076_0357659 3300049592 Bacteria 1199
469 Ga0501076_0529820 3300049592 Bacteria 971
470 Ga0501076_0855321 3300049592 Bacteria 750
471 Ga0501077_0022870 3300049593 Bacteria 3962
472 Ga0501077_0095478 3300049593 Bacteria 1885
473 Ga0501230_112797 3300049667 Bacteria 596
474 Ga0501236_143625 3300049670 Bacteria 501
475 Ga0501079_0002756 3300049741 Bacteria 12808
476 Ga0501079_0495286 3300049741 Bacteria 961
477 Ga0501079_0860283 3300049741 Bacteria 714
478 Ga0501080_0042805 3300049742 Bacteria 4216
479 Ga0501080_0550268 3300049742 Bacteria 1028
480 Ga0501081_0031542 3300049743 Bacteria 3591
481 Ga0501081_0039707 3300049743 Bacteria 3222
482 Ga0501081_0088566 3300049743 Bacteria 2174
483 Ga0501081_0747566 3300049743 Bacteria 735
484 Ga0501083_0384832 3300049744 Bacteria 912
485 Ga0501279_020951 3300049775 Bacteria 932
486 Ga0501283_024134 3300049779 Bacteria 990
487 Ga0501283_060895 3300049779 Bacteria 682
488 Ga0501035_0505709 3300049822 Bacteria 994
489 Ga0501044_0396778 3300049823 Bacteria 1293
490 Ga0501045_0018274 3300049824 Bacteria 4986
491 Ga0501045_0518628 3300049824 Bacteria 885
492 nmdc:mga05p37_219245_c1 3300050507 Bacteria 2296
493 nmdc:mga05p37_46362_c1 3300050507 Bacteria 5345
494 nmdc:mga05p37_991921_c1 3300050507 Bacteria 893
495 nmdc:mga09592_1179955_c1 3300050508 Bacteria 634
496 nmdc:mga09592_2325_c1 3300050508 Bacteria 15340
497 nmdc:mga09592_255722_c1 3300050508 Bacteria 1518
498 nmdc:mga09592_57568_c1 3300050508 Bacteria 3286
499 nmdc:mga09592_576209_c1 3300050508 Bacteria 966
500 nmdc:mga09592_979780_c1 3300050508 Bacteria 708
501 nmdc:mga0qj67_1303402_c1 3300050509 Bacteria 563
502 nmdc:mga0qj67_311960_c1 3300050509 Unclassified 1274
503 nmdc:mga0qj67_342752_c1 3300050509 Bacteria 1209
504 nmdc:mga0qj67_443978_c1 3300050509 Bacteria 1045
505 nmdc:mga06r32_1449446_c1 3300050510 Bacteria 628
506 nmdc:mga06r32_28844_c1 3300050510 Bacteria 5195
507 nmdc:mga06r32_726388_c1 3300050510 Bacteria 958
508 nmdc:mga06r32_750982_c1 3300050510 Bacteria 939
509 nmdc:mga06r32_942060_c1 3300050510 Bacteria 818
510 nmdc:mga08y16_1040937_c1 3300050511 Bacteria 796
511 nmdc:mga08y16_1707_c1 3300050511 Bacteria 22276
512 nmdc:mga08y16_32909_c1 3300050511 Bacteria 5449
513 nmdc:mga08y16_97110_c1 3300050511 Bacteria 3068
514 nmdc:mga0n895_148448_c1 3300050512 Bacteria 2374
515 nmdc:mga0n895_282651_c1 3300050512 Bacteria 1682
516 nmdc:mga0n895_333_c1 3300050512 Bacteria 31507
517 nmdc:mga0n895_615667_c1 3300050512 Bacteria 1087
518 nmdc:mga0rr50_218122_c1 3300050513 Bacteria 1574
519 nmdc:mga0rr50_348457_c1 3300050513 Bacteria 1245
520 nmdc:mga0rr50_529407_c1 3300050513 Bacteria 1003
521 nmdc:mga0rr50_569_c1 3300050513 Bacteria 19810
522 nmdc:mga0rr50_774922_c1 3300050513 Bacteria 819
523 nmdc:mga0rr50_77938_c1 3300050513 Bacteria 2548
524 nmdc:mga08x19_1063969_c1 3300050514 Bacteria 574
525 nmdc:mga08x19_1192_c1 3300050514 Bacteria 16244
526 nmdc:mga08x19_196081_c1 3300050514 Bacteria 1383
527 nmdc:mga08x19_28528_c1 3300050514 Bacteria 3496
528 nmdc:mga08x19_990611_c1 3300050514 Bacteria 597
529 nmdc:mga0a205_261260_c1 3300050515 Bacteria 1609
530 nmdc:mga0a205_32720_c1 3300050515 Bacteria 4985
531 nmdc:mga0a205_377382_c1 3300050515 Bacteria 1283
532 nmdc:mga0a205_713731_c1 3300050515 Bacteria 852
533 nmdc:mga0a205_757585_c1 3300050515 Bacteria 819
534 nmdc:mga0a205_880840_c1 3300050515 Bacteria 742
535 Ga0495601_0023412 3300053077 Bacteria 3794
536 Ga0495619_0084370 3300053085 Bacteria 2144
537 Ga0501084_0195116 3300054114 Bacteria 1708
538 Ga0501084_0233717 3300054114 Bacteria 1552
539 Ga0501084_1330324 3300054114 Bacteria 602
540 Ga0501084_1749792 3300054114 Bacteria 519
541 Ga0590071_042090 3300059421 Unclassified 1100
542 Ga0590077_006009 3300059426 Bacteria 2487
543 Ga0501082_0269995 3300060353 Bacteria 1480
544 Ga0501082_0930367 3300060353 Bacteria 760
545 Ga0501082_1121804 3300060353 Bacteria 687
546 Ga0501082_1383089 3300060353 Bacteria 615
547 Ga0530510_0004302 3300061734 Bacteria 9853

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047318 Ga0495636_0005309 Ga0495636_0005309_1311_1592 86
2 3300048088 Ga0495602_0721738 Ga0495602_0721738_399_665 86
3 3300006914 Ga0075436_100000142 Ga0075436_10000014229 87
4 3300034819 Ga0373958_0187810 Ga0373958_0187810_18_296 92
5 3300045051 Ga0451576_0103711 Ga0451576_0103711_532_831 93
6 3300032002 Ga0307416_100279814 Ga0307416_1002798142 94
7 3300005545 Ga0070695_100338984 Ga0070695_1003389842 95
8 3300031548 Ga0307408_102018082 Ga0307408_1020180822 95
9 3300032002 Ga0307416_101715366 Ga0307416_1017153662 95
10 3300041406 Ga0439439_0162324 Ga0439439_0162324_246_542 95
11 3300041408 Ga0439453_0063056 Ga0439453_0063056_402_698 95
12 3300041410 Ga0439461_0002609 Ga0439461_0002609_428_724 95
13 3300042435 Ga0439434_0000327 Ga0439434_0000327_9332_9628 95
14 3300042436 Ga0439435_0000043 Ga0439435_0000043_5641_5937 95
15 3300007265 Ga0099794_10048506 Ga0099794_100485062 96
16 3300027462 Ga0210000_1009043 Ga0210000_10090432 96
17 3300005441 Ga0070700_100163653 Ga0070700_1001636532 97
18 3300005458 Ga0070681_11733851 Ga0070681_117338511 97
19 3300005459 Ga0068867_100992492 Ga0068867_1009924923 97
20 3300005577 Ga0068857_100857972 Ga0068857_1008579722 97
21 3300005615 Ga0070702_100426614 Ga0070702_1004266141 97
22 3300005719 Ga0068861_100926822 Ga0068861_1009268222 97
23 3300006844 Ga0075428_101802543 Ga0075428_1018025432 97
24 3300006852 Ga0075433_10828727 Ga0075433_108287272 97
25 3300006871 Ga0075434_100146287 Ga0075434_1001462873 97
26 3300006880 Ga0075429_100052059 Ga0075429_1000520594 97
27 3300007076 Ga0075435_100214664 Ga0075435_1002146643 97
28 3300009094 Ga0111539_10096214 Ga0111539_100962143 97
29 3300009147 Ga0114129_13097735 Ga0114129_130977352 97
30 3300014326 Ga0157380_12563027 Ga0157380_125630271 97
31 3300026075 Ga0207708_10099345 Ga0207708_100993454 97
32 3300026116 Ga0207674_10783206 Ga0207674_107832062 97
33 3300026118 Ga0207675_100380909 Ga0207675_1003809092 97
34 3300027360 Ga0209969_1000935 Ga0209969_10009352 97
35 3300027364 Ga0209967_1000341 Ga0209967_10003418 97
36 3300027378 Ga0209981_1003509 Ga0209981_10035093 97
37 3300027395 Ga0209996_1005558 Ga0209996_10055583 97
38 3300027462 Ga0210000_1003999 Ga0210000_10039992 97
39 3300027471 Ga0209995_1012882 Ga0209995_10128822 97
40 3300027526 Ga0209968_1007688 Ga0209968_10076882 97
41 3300027665 Ga0209983_1009613 Ga0209983_10096133 97
42 3300027695 Ga0209966_1005922 Ga0209966_10059222 97
43 3300027907 Ga0207428_10466492 Ga0207428_104664922 97
44 3300031901 Ga0307406_10489352 Ga0307406_104893523 97
45 3300035241 Ga0373961_0356179 Ga0373961_0356179_68_367 97
46 3300049514 Ga0501291_145365 Ga0501291_145365_140_436 97
47 3300049568 Ga0501031_0906632 Ga0501031_0906632_27_323 97
48 3300049670 Ga0501236_143625 Ga0501236_143625_195_491 97
49 3300049775 Ga0501279_020951 Ga0501279_020951_340_636 97
50 3300049779 Ga0501283_060895 Ga0501283_060895_71_367 97
51 3300050511 nmdc:mga08y16_97110_c1 nmdc:mga08y16_97110_c1_1156_1455 97
52 3300050512 nmdc:mga0n895_148448_c1 nmdc:mga0n895_148448_c1_499_798 97
53 3300050513 nmdc:mga0rr50_218122_c1 nmdc:mga0rr50_218122_c1_289_588 97
54 3300050515 nmdc:mga0a205_757585_c1 nmdc:mga0a205_757585_c1_104_403 97
55 3300054114 Ga0501084_1330324 Ga0501084_1330324_67_363 97
56 3300059421 Ga0590071_042090 Ga0590071_042090_118_411 97
57 3300059426 Ga0590077_006009 Ga0590077_006009_758_1051 97
58 3300060353 Ga0501082_0930367 Ga0501082_0930367_292_588 97
59 3300005334 Ga0068869_100659656 Ga0068869_1006596562 98
60 3300005336 Ga0070680_100324222 Ga0070680_1003242222 98
61 3300005340 Ga0070689_100052957 Ga0070689_1000529572 98
62 3300005340 Ga0070689_100085539 Ga0070689_1000855393 98
63 3300005340 Ga0070689_101993857 Ga0070689_1019938572 98
64 3300005341 Ga0070691_10046647 Ga0070691_100466473 98
65 3300005343 Ga0070687_100851383 Ga0070687_1008513832 98
66 3300005345 Ga0070692_10041072 Ga0070692_100410722 98
67 3300005365 Ga0070688_100057770 Ga0070688_1000577702 98
68 3300005365 Ga0070688_100396158 Ga0070688_1003961582 98
69 3300005406 Ga0070703_10046014 Ga0070703_100460142 98
70 3300005406 Ga0070703_10270622 Ga0070703_102706222 98
71 3300005438 Ga0070701_10683453 Ga0070701_106834532 98
72 3300005440 Ga0070705_100312551 Ga0070705_1003125513 98
73 3300005440 Ga0070705_100993991 Ga0070705_1009939912 98
74 3300005441 Ga0070700_100103049 Ga0070700_1001030493 98
75 3300005444 Ga0070694_100004187 Ga0070694_1000041879 98
76 3300005444 Ga0070694_100124419 Ga0070694_1001244192 98
77 3300005444 Ga0070694_100404432 Ga0070694_1004044322 98
78 3300005444 Ga0070694_100526049 Ga0070694_1005260492 98
79 3300005444 Ga0070694_101334292 Ga0070694_1013342921 98
80 3300005445 Ga0070708_101410064 Ga0070708_1014100641 98
81 3300005467 Ga0070706_101343694 Ga0070706_1013436941 98
82 3300005468 Ga0070707_100060346 Ga0070707_1000603464 98
83 3300005471 Ga0070698_100214935 Ga0070698_1002149353 98
84 3300005518 Ga0070699_100341536 Ga0070699_1003415362 98
85 3300005544 Ga0070686_100621417 Ga0070686_1006214172 98
86 3300005544 Ga0070686_101384765 Ga0070686_1013847652 98
87 3300005545 Ga0070695_100010236 Ga0070695_1000102362 98
88 3300005545 Ga0070695_100038330 Ga0070695_1000383303 98
89 3300005545 Ga0070695_101352078 Ga0070695_1013520781 98
90 3300005546 Ga0070696_100007068 Ga0070696_10000706812 98
91 3300005546 Ga0070696_100058464 Ga0070696_1000584645 98
92 3300005546 Ga0070696_100069113 Ga0070696_1000691134 98
93 3300005546 Ga0070696_100277018 Ga0070696_1002770182 98
94 3300005546 Ga0070696_101654844 Ga0070696_1016548442 98
95 3300005547 Ga0070693_100325727 Ga0070693_1003257272 98
96 3300005549 Ga0070704_100038185 Ga0070704_1000381851 98
97 3300005549 Ga0070704_100038276 Ga0070704_1000382764 98
98 3300005549 Ga0070704_100056791 Ga0070704_1000567912 98
99 3300005549 Ga0070704_100549860 Ga0070704_1005498602 98
100 3300005615 Ga0070702_100217042 Ga0070702_1002170422 98
101 3300005617 Ga0068859_100496457 Ga0068859_1004964572 98
102 3300005617 Ga0068859_101347168 Ga0068859_1013471682 98
103 3300005844 Ga0068862_100209721 Ga0068862_1002097212 98
104 3300005844 Ga0068862_100631912 Ga0068862_1006319122 98
105 3300006844 Ga0075428_100101689 Ga0075428_1001016894 98
106 3300006852 Ga0075433_10269771 Ga0075433_102697713 98
107 3300006852 Ga0075433_10414417 Ga0075433_104144173 98
108 3300006871 Ga0075434_100604109 Ga0075434_1006041093 98
109 3300006880 Ga0075429_100980912 Ga0075429_1009809122 98
110 3300006914 Ga0075436_100008614 Ga0075436_1000086146 98
111 3300006931 Ga0097620_100496459 Ga0097620_1004964592 98
112 3300006931 Ga0097620_101347157 Ga0097620_1013471572 98
113 3300007076 Ga0075435_100023958 Ga0075435_1000239587 98
114 3300007076 Ga0075435_100348670 Ga0075435_1003486702 98
115 3300007076 Ga0075435_100619590 Ga0075435_1006195902 98
116 3300009094 Ga0111539_11087744 Ga0111539_110877443 98
117 3300009147 Ga0114129_10337806 Ga0114129_103378062 98
118 3300014326 Ga0157380_10746265 Ga0157380_107462651 98
119 3300025885 Ga0207653_10278474 Ga0207653_102784742 98
120 3300025908 Ga0207643_10562698 Ga0207643_105626981 98
121 3300025910 Ga0207684_10393779 Ga0207684_103937791 98
122 3300025910 Ga0207684_10997503 Ga0207684_109975031 98
123 3300025917 Ga0207660_10571607 Ga0207660_105716072 98
124 3300025918 Ga0207662_10159138 Ga0207662_101591382 98
125 3300025922 Ga0207646_11102331 Ga0207646_111023312 98
126 3300025936 Ga0207670_10204585 Ga0207670_102045853 98
127 3300025936 Ga0207670_10582027 Ga0207670_105820272 98
128 3300025942 Ga0207689_10173261 Ga0207689_101732613 98
129 3300025942 Ga0207689_11352639 Ga0207689_113526391 98
130 3300026075 Ga0207708_10136212 Ga0207708_101362123 98
131 3300026118 Ga0207675_101881946 Ga0207675_1018819462 98
132 3300026118 Ga0207675_102256862 Ga0207675_1022568622 98
133 3300027364 Ga0209967_1008800 Ga0209967_10088002 98
134 3300027364 Ga0209967_1063258 Ga0209967_10632582 98
135 3300027378 Ga0209981_1034749 Ga0209981_10347492 98
136 3300027395 Ga0209996_1001756 Ga0209996_10017563 98
137 3300027462 Ga0210000_1013014 Ga0210000_10130143 98
138 3300027526 Ga0209968_1023725 Ga0209968_10237252 98
139 3300027526 Ga0209968_1039555 Ga0209968_10395552 98
140 3300027543 Ga0209999_1053645 Ga0209999_10536452 98
141 3300027665 Ga0209983_1018474 Ga0209983_10184742 98
142 3300027695 Ga0209966_1001170 Ga0209966_10011702 98
143 3300028380 Ga0268265_10226154 Ga0268265_102261542 98
144 3300028380 Ga0268265_10493241 Ga0268265_104932413 98
145 3300031548 Ga0307408_100351273 Ga0307408_1003512732 98
146 3300031548 Ga0307408_100867652 Ga0307408_1008676522 98
147 3300031548 Ga0307408_101624463 Ga0307408_1016244632 98
148 3300031731 Ga0307405_10436012 Ga0307405_104360122 98
149 3300031824 Ga0307413_11750810 Ga0307413_117508101 98
150 3300031901 Ga0307406_11218519 Ga0307406_112185192 98
151 3300031911 Ga0307412_10256369 Ga0307412_102563693 98
152 3300031995 Ga0307409_101162890 Ga0307409_1011628902 98
153 3300032002 Ga0307416_100234360 Ga0307416_1002343603 98
154 3300032002 Ga0307416_100887468 Ga0307416_1008874682 98
155 3300035111 Ga0373923_0046854 Ga0373923_0046854_1382_1684 98
156 3300035112 Ga0373932_0342170 Ga0373932_0342170_111_413 98
157 3300035113 Ga0373936_0511581 Ga0373936_0511581_54_356 98
158 3300035172 Ga0373955_0523840 Ga0373955_0523840_402_704 98
159 3300036401 Ga0373937_0027675 Ga0373937_0027675_2986_3288 98
160 3300038996 Ga0242420_041902 Ga0242420_041902_450_749 98
161 3300041408 Ga0439453_0081833 Ga0439453_0081833_34_342 98
162 3300042001 Ga0439441_001833 Ga0439441_001833_743_1039 98
163 3300042001 Ga0439441_020394 Ga0439441_020394_675_983 98
164 3300042126 Ga0450888_045601 Ga0450888_045601_25_324 98
165 3300042134 Ga0450898_104048 Ga0450898_104048_21_317 98
166 3300042435 Ga0439434_0065614 Ga0439434_0065614_589_897 98
167 3300042436 Ga0439435_0000831 Ga0439435_0000831_2881_3177 98
168 3300042436 Ga0439435_0042707 Ga0439435_0042707_152_460 98
169 3300042437 Ga0439444_0000510 Ga0439444_0000510_2158_2466 98
170 3300042437 Ga0439444_0002926 Ga0439444_0002926_397_693 98
171 3300042461 Ga0439460_0001357 Ga0439460_0001357_830_1126 98
172 3300042876 Ga0451577_0436653 Ga0451577_0436653_519_824 98
173 3300045051 Ga0451576_0111760 Ga0451576_0111760_1886_2191 98
174 3300046454 Ga0495592_0144972 Ga0495592_0144972_675_977 98
175 3300046463 Ga0495653_0088878 Ga0495653_0088878_1900_2202 98
176 3300046476 Ga0495662_0010692 Ga0495662_0010692_2763_3065 98
177 3300046511 Ga0495608_0004174 Ga0495608_0004174_8786_9088 98
178 3300046514 Ga0495618_0007803 Ga0495618_0007803_1358_1660 98
179 3300046516 Ga0495628_0015350 Ga0495628_0015350_3006_3308 98
180 3300046517 Ga0495630_0053374 Ga0495630_0053374_1410_1712 98
181 3300046526 Ga0495666_0037729 Ga0495666_0037729_1039_1341 98
182 3300046528 Ga0495642_0066310 Ga0495642_0066310_1120_1416 98
183 3300046529 Ga0495652_0400760 Ga0495652_0400760_140_442 98
184 3300046533 Ga0495640_0006542 Ga0495640_0006542_2399_2701 98
185 3300046535 Ga0495586_0003090 Ga0495586_0003090_4325_4627 98
186 3300046536 Ga0495587_0182562 Ga0495587_0182562_295_597 98
187 3300046539 Ga0495621_0015137 Ga0495621_0015137_1036_1332 98
188 3300046543 Ga0495645_0043321 Ga0495645_0043321_2121_2423 98
189 3300046559 Ga0495667_0006793 Ga0495667_0006793_2816_3118 98
190 3300046642 Ga0495634_0016497 Ga0495634_0016497_283_585 98
191 3300046663 Ga0495635_0065769 Ga0495635_0065769_565_867 98
192 3300046664 Ga0495659_0028236 Ga0495659_0028236_281_577 98
193 3300046678 Ga0495599_0004175 Ga0495599_0004175_2913_3215 98
194 3300046683 Ga0495658_0046663 Ga0495658_0046663_196_498 98
195 3300046683 Ga0495658_0982454 Ga0495658_0982454_88_390 98
196 3300046689 Ga0495613_0008754 Ga0495613_0008754_4441_4743 98
197 3300046690 Ga0495624_0251646 Ga0495624_0251646_419_721 98
198 3300046809 Ga0495600_0016281 Ga0495600_0016281_2024_2326 98
199 3300047315 Ga0495581_0521541 Ga0495581_0521541_140_442 98
200 3300047317 Ga0495604_0003608 Ga0495604_0003608_7705_8007 98
201 3300047319 Ga0495674_1077781 Ga0495674_1077781_19_321 98
202 3300047322 Ga0495680_0004943 Ga0495680_0004943_9229_9531 98
203 3300047447 Ga0495685_154116 Ga0495685_154116_412_708 98
204 3300047673 Ga0495593_0054403 Ga0495593_0054403_1409_1711 98
205 3300048089 Ga0495614_0550505 Ga0495614_0550505_215_517 98
206 3300049514 Ga0501291_073751 Ga0501291_073751_152_451 98
207 3300049524 Ga0501301_014980 Ga0501301_014980_160_459 98
208 3300049570 Ga0501033_0235638 Ga0501033_0235638_47_343 98
209 3300049572 Ga0501036_0175905 Ga0501036_0175905_1158_1454 98
210 3300049572 Ga0501036_1181214 Ga0501036_1181214_146_442 98
211 3300049574 Ga0501038_0163217 Ga0501038_0163217_882_1178 98
212 3300049575 Ga0501039_0032224 Ga0501039_0032224_1627_1923 98
213 3300049575 Ga0501039_0074075 Ga0501039_0074075_2144_2440 98
214 3300049575 Ga0501039_0322384 Ga0501039_0322384_164_460 98
215 3300049575 Ga0501039_0629093 Ga0501039_0629093_241_537 98
216 3300049576 Ga0501040_0072651 Ga0501040_0072651_1421_1717 98
217 3300049576 Ga0501040_0257837 Ga0501040_0257837_645_941 98
218 3300049576 Ga0501040_0281278 Ga0501040_0281278_469_765 98
219 3300049577 Ga0501041_0052281 Ga0501041_0052281_1361_1657 98
220 3300049577 Ga0501041_0753993 Ga0501041_0753993_124_420 98
221 3300049578 Ga0501042_0078476 Ga0501042_0078476_313_609 98
222 3300049578 Ga0501042_0373827 Ga0501042_0373827_666_962 98
223 3300049579 Ga0501043_0073068 Ga0501043_0073068_1573_1869 98
224 3300049579 Ga0501043_0389956 Ga0501043_0389956_710_1006 98
225 3300049580 Ga0501046_0247179 Ga0501046_0247179_882_1178 98
226 3300049582 Ga0501048_0044897 Ga0501048_0044897_131_427 98
227 3300049587 Ga0501071_0370798 Ga0501071_0370798_501_797 98
228 3300049587 Ga0501071_0540988 Ga0501071_0540988_472_768 98
229 3300049587 Ga0501071_0541405 Ga0501071_0541405_518_820 98
230 3300049587 Ga0501071_0582484 Ga0501071_0582484_170_472 98
231 3300049588 Ga0501072_0043357 Ga0501072_0043357_2700_2996 98
232 3300049588 Ga0501072_0233396 Ga0501072_0233396_528_824 98
233 3300049588 Ga0501072_1343029 Ga0501072_1343029_149_457 98
234 3300049591 Ga0501075_0023147 Ga0501075_0023147_57_353 98
235 3300049591 Ga0501075_0050733 Ga0501075_0050733_2384_2680 98
236 3300049591 Ga0501075_0832096 Ga0501075_0832096_349_651 98
237 3300049591 Ga0501075_0834800 Ga0501075_0834800_251_547 98
238 3300049592 Ga0501076_0006798 Ga0501076_0006798_683_979 98
239 3300049592 Ga0501076_0116029 Ga0501076_0116029_844_1140 98
240 3300049592 Ga0501076_0529820 Ga0501076_0529820_283_585 98
241 3300049592 Ga0501076_0855321 Ga0501076_0855321_123_419 98
242 3300049593 Ga0501077_0022870 Ga0501077_0022870_1584_1880 98
243 3300049593 Ga0501077_0095478 Ga0501077_0095478_1420_1716 98
244 3300049667 Ga0501230_112797 Ga0501230_112797_255_551 98
245 3300049741 Ga0501079_0002756 Ga0501079_0002756_7037_7333 98
246 3300049741 Ga0501079_0495286 Ga0501079_0495286_429_725 98
247 3300049741 Ga0501079_0860283 Ga0501079_0860283_105_401 98
248 3300049742 Ga0501080_0042805 Ga0501080_0042805_1699_1995 98
249 3300049742 Ga0501080_0550268 Ga0501080_0550268_151_447 98
250 3300049743 Ga0501081_0031542 Ga0501081_0031542_1701_1997 98
251 3300049743 Ga0501081_0039707 Ga0501081_0039707_254_550 98
252 3300049743 Ga0501081_0088566 Ga0501081_0088566_244_540 98
253 3300049743 Ga0501081_0747566 Ga0501081_0747566_14_316 98
254 3300049744 Ga0501083_0384832 Ga0501083_0384832_38_334 98
255 3300049779 Ga0501283_024134 Ga0501283_024134_511_810 98
256 3300049822 Ga0501035_0505709 Ga0501035_0505709_337_633 98
257 3300049823 Ga0501044_0396778 Ga0501044_0396778_914_1210 98
258 3300049824 Ga0501045_0018274 Ga0501045_0018274_3146_3442 98
259 3300049824 Ga0501045_0518628 Ga0501045_0518628_368_664 98
260 3300050507 nmdc:mga05p37_219245_c1 nmdc:mga05p37_219245_c1_488_790 98
261 3300050508 nmdc:mga09592_1179955_c1 nmdc:mga09592_1179955_c1_145_453 98
262 3300050508 nmdc:mga09592_57568_c1 nmdc:mga09592_57568_c1_1087_1392 98
263 3300050509 nmdc:mga0qj67_311960_c1 nmdc:mga0qj67_311960_c1_33_341 98
264 3300050509 nmdc:mga0qj67_342752_c1 nmdc:mga0qj67_342752_c1_723_1028 98
265 3300050510 nmdc:mga06r32_726388_c1 nmdc:mga06r32_726388_c1_256_564 98
266 3300050511 nmdc:mga08y16_1040937_c1 nmdc:mga08y16_1040937_c1_270_575 98
267 3300050512 nmdc:mga0n895_615667_c1 nmdc:mga0n895_615667_c1_372_674 98
268 3300050513 nmdc:mga0rr50_348457_c1 nmdc:mga0rr50_348457_c1_279_575 98
269 3300050513 nmdc:mga0rr50_529407_c1 nmdc:mga0rr50_529407_c1_191_487 98
270 3300050513 nmdc:mga0rr50_774922_c1 nmdc:mga0rr50_774922_c1_287_589 98
271 3300050513 nmdc:mga0rr50_77938_c1 nmdc:mga0rr50_77938_c1_1941_2246 98
272 3300050514 nmdc:mga08x19_1063969_c1 nmdc:mga08x19_1063969_c1_124_420 98
273 3300050514 nmdc:mga08x19_196081_c1 nmdc:mga08x19_196081_c1_361_657 98
274 3300050515 nmdc:mga0a205_261260_c1 nmdc:mga0a205_261260_c1_80_382 98
275 3300050515 nmdc:mga0a205_713731_c1 nmdc:mga0a205_713731_c1_51_347 98
276 3300053077 Ga0495601_0023412 Ga0495601_0023412_1976_2278 98
277 3300053085 Ga0495619_0084370 Ga0495619_0084370_1813_2115 98
278 3300054114 Ga0501084_0195116 Ga0501084_0195116_1379_1675 98
279 3300054114 Ga0501084_0233717 Ga0501084_0233717_479_775 98
280 3300054114 Ga0501084_1749792 Ga0501084_1749792_141_437 98
281 3300060353 Ga0501082_0269995 Ga0501082_0269995_18_314 98
282 3300060353 Ga0501082_1121804 Ga0501082_1121804_208_504 98
283 3300060353 Ga0501082_1383089 Ga0501082_1383089_109_405 98
284 3300061734 Ga0530510_0004302 Ga0530510_0004302_2384_2680 98
285 3300002076 JGI24749J21850_1070434 JGI24749J21850_10704341 99
286 3300005295 Ga0065707_10004016 Ga0065707_100040167 99
287 3300005295 Ga0065707_10014317 Ga0065707_100143172 99
288 3300005330 Ga0070690_100000335 Ga0070690_1000003357 99
289 3300005330 Ga0070690_100112218 Ga0070690_1001122182 99
290 3300005334 Ga0068869_100001158 Ga0068869_1000011587 99
291 3300005334 Ga0068869_101230353 Ga0068869_1012303531 99
292 3300005336 Ga0070680_100014145 Ga0070680_1000141452 99
293 3300005336 Ga0070680_100787444 Ga0070680_1007874442 99
294 3300005336 Ga0070680_101676107 Ga0070680_1016761071 99
295 3300005337 Ga0070682_100042183 Ga0070682_1000421833 99
296 3300005338 Ga0068868_100000378 Ga0068868_1000003787 99
297 3300005338 Ga0068868_102111502 Ga0068868_1021115021 99
298 3300005340 Ga0070689_100029187 Ga0070689_1000291873 99
299 3300005340 Ga0070689_100038792 Ga0070689_1000387926 99
300 3300005341 Ga0070691_10010712 Ga0070691_100107125 99
301 3300005343 Ga0070687_100000353 Ga0070687_10000035311 99
302 3300005345 Ga0070692_10003721 Ga0070692_100037217 99
303 3300005345 Ga0070692_10548474 Ga0070692_105484742 99
304 3300005353 Ga0070669_100086279 Ga0070669_1000862792 99
305 3300005354 Ga0070675_100776465 Ga0070675_1007764652 99
306 3300005355 Ga0070671_100657961 Ga0070671_1006579612 99
307 3300005364 Ga0070673_100076315 Ga0070673_1000763155 99
308 3300005364 Ga0070673_100356585 Ga0070673_1003565853 99
309 3300005406 Ga0070703_10006589 Ga0070703_100065894 99
310 3300005435 Ga0070714_100515251 Ga0070714_1005152512 99
311 3300005438 Ga0070701_10000027 Ga0070701_1000002712 99
312 3300005439 Ga0070711_100230792 Ga0070711_1002307922 99
313 3300005440 Ga0070705_100000061 Ga0070705_10000006123 99
314 3300005441 Ga0070700_100000386 Ga0070700_1000003867 99
315 3300005444 Ga0070694_100000096 Ga0070694_10000009612 99
316 3300005444 Ga0070694_100064216 Ga0070694_1000642161 99
317 3300005456 Ga0070678_100339582 Ga0070678_1003395822 99
318 3300005458 Ga0070681_10032716 Ga0070681_100327165 99
319 3300005459 Ga0068867_100001399 Ga0068867_1000013996 99
320 3300005471 Ga0070698_101020568 Ga0070698_1010205682 99
321 3300005518 Ga0070699_100258895 Ga0070699_1002588953 99
322 3300005518 Ga0070699_100424320 Ga0070699_1004243202 99
323 3300005530 Ga0070679_100030156 Ga0070679_1000301565 99
324 3300005536 Ga0070697_100677716 Ga0070697_1006777162 99
325 3300005539 Ga0068853_100032789 Ga0068853_1000327895 99
326 3300005539 Ga0068853_100739161 Ga0068853_1007391612 99
327 3300005544 Ga0070686_100001578 Ga0070686_1000015783 99
328 3300005545 Ga0070695_100000965 Ga0070695_10000096513 99
329 3300005546 Ga0070696_100000560 Ga0070696_10000056012 99
330 3300005546 Ga0070696_100872946 Ga0070696_1008729461 99
331 3300005547 Ga0070693_100000003 Ga0070693_10000000361 99
332 3300005547 Ga0070693_100815156 Ga0070693_1008151562 99
333 3300005549 Ga0070704_100000504 Ga0070704_10000050410 99
334 3300005563 Ga0068855_100005492 Ga0068855_1000054928 99
335 3300005578 Ga0068854_100003450 Ga0068854_10000345011 99
336 3300005614 Ga0068856_100144011 Ga0068856_1001440114 99
337 3300005614 Ga0068856_100181533 Ga0068856_1001815333 99
338 3300005615 Ga0070702_100000004 Ga0070702_10000000457 99
339 3300005616 Ga0068852_100068470 Ga0068852_1000684702 99
340 3300005616 Ga0068852_102334300 Ga0068852_1023343002 99
341 3300005617 Ga0068859_100002292 Ga0068859_10000229218 99
342 3300005617 Ga0068859_102533112 Ga0068859_1025331122 99
343 3300005618 Ga0068864_100318573 Ga0068864_1003185732 99
344 3300005718 Ga0068866_10000342 Ga0068866_1000034217 99
345 3300005719 Ga0068861_100001170 Ga0068861_1000011707 99
346 3300005840 Ga0068870_10004636 Ga0068870_100046364 99
347 3300005840 Ga0068870_10667036 Ga0068870_106670362 99
348 3300005841 Ga0068863_100255736 Ga0068863_1002557362 99
349 3300005841 Ga0068863_102309958 Ga0068863_1023099582 99
350 3300005842 Ga0068858_100002734 Ga0068858_10000273416 99
351 3300005843 Ga0068860_100002098 Ga0068860_1000020987 99
352 3300005844 Ga0068862_100001419 Ga0068862_1000014193 99
353 3300005844 Ga0068862_100223759 Ga0068862_1002237592 99
354 3300006237 Ga0097621_100000024 Ga0097621_1000000245 99
355 3300006358 Ga0068871_100002217 Ga0068871_10000221710 99
356 3300006844 Ga0075428_100004856 Ga0075428_10000485615 99
357 3300006844 Ga0075428_100552022 Ga0075428_1005520222 99
358 3300006846 Ga0075430_100000969 Ga0075430_10000096915 99
359 3300006846 Ga0075430_100260665 Ga0075430_1002606652 99
360 3300006846 Ga0075430_100333374 Ga0075430_1003333743 99
361 3300006846 Ga0075430_100725297 Ga0075430_1007252971 99
362 3300006846 Ga0075430_101355137 Ga0075430_1013551372 99
363 3300006847 Ga0075431_100152711 Ga0075431_1001527112 99
364 3300006847 Ga0075431_100215892 Ga0075431_1002158922 99
365 3300006847 Ga0075431_101950940 Ga0075431_1019509402 99
366 3300006852 Ga0075433_10030077 Ga0075433_100300774 99
367 3300006852 Ga0075433_10724170 Ga0075433_107241702 99
368 3300006871 Ga0075434_100001724 Ga0075434_10000172417 99
369 3300006871 Ga0075434_100412890 Ga0075434_1004128903 99
370 3300006880 Ga0075429_100000496 Ga0075429_1000004966 99
371 3300006880 Ga0075429_100496424 Ga0075429_1004964242 99
372 3300006880 Ga0075429_100564167 Ga0075429_1005641672 99
373 3300006880 Ga0075429_101048655 Ga0075429_1010486552 99
374 3300006881 Ga0068865_100000417 Ga0068865_1000004176 99
375 3300006914 Ga0075436_100012065 Ga0075436_1000120653 99
376 3300006931 Ga0097620_100002292 Ga0097620_10000229218 99
377 3300006931 Ga0097620_102533510 Ga0097620_1025335102 99
378 3300007076 Ga0075435_100008441 Ga0075435_1000084416 99
379 3300007265 Ga0099794_10765755 Ga0099794_107657552 99
380 3300009093 Ga0105240_10289283 Ga0105240_102892833 99
381 3300009094 Ga0111539_10028668 Ga0111539_100286686 99
382 3300009094 Ga0111539_11114271 Ga0111539_111142713 99
383 3300009094 Ga0111539_11193443 Ga0111539_111934433 99
384 3300009094 Ga0111539_11840597 Ga0111539_118405972 99
385 3300009098 Ga0105245_10038220 Ga0105245_100382202 99
386 3300009147 Ga0114129_10001872 Ga0114129_1000187217 99
387 3300009148 Ga0105243_10000339 Ga0105243_1000033916 99
388 3300009174 Ga0105241_10015808 Ga0105241_100158086 99
389 3300009176 Ga0105242_10000346 Ga0105242_1000034623 99
390 3300009177 Ga0105248_10357117 Ga0105248_103571172 99
391 3300009553 Ga0105249_10012564 Ga0105249_100125645 99
392 3300010375 Ga0105239_10433348 Ga0105239_104333482 99
393 3300011119 Ga0105246_10052088 Ga0105246_100520885 99
394 3300011119 Ga0105246_10421530 Ga0105246_104215303 99
395 3300013297 Ga0157378_10000192 Ga0157378_1000019257 99
396 3300013308 Ga0157375_10350516 Ga0157375_103505162 99
397 3300013308 Ga0157375_11441174 Ga0157375_114411742 99
398 3300014326 Ga0157380_10007200 Ga0157380_100072003 99
399 3300014745 Ga0157377_10170307 Ga0157377_101703072 99
400 3300014745 Ga0157377_11034594 Ga0157377_110345942 99
401 3300014968 Ga0157379_11367602 Ga0157379_113676022 99
402 3300014969 Ga0157376_10021789 Ga0157376_100217895 99
403 3300025885 Ga0207653_10008181 Ga0207653_100081813 99
404 3300025899 Ga0207642_10001562 Ga0207642_100015627 99
405 3300025901 Ga0207688_10034726 Ga0207688_100347263 99
406 3300025903 Ga0207680_10968270 Ga0207680_109682702 99
407 3300025908 Ga0207643_10022819 Ga0207643_100228195 99
408 3300025908 Ga0207643_10584830 Ga0207643_105848302 99
409 3300025911 Ga0207654_10068769 Ga0207654_100687693 99
410 3300025912 Ga0207707_10026336 Ga0207707_100263364 99
411 3300025913 Ga0207695_10908393 Ga0207695_109083932 99
412 3300025916 Ga0207663_10132078 Ga0207663_101320783 99
413 3300025916 Ga0207663_10892900 Ga0207663_108929002 99
414 3300025917 Ga0207660_10006379 Ga0207660_100063795 99
415 3300025918 Ga0207662_10000653 Ga0207662_1000065311 99
416 3300025921 Ga0207652_10017093 Ga0207652_100170935 99
417 3300025923 Ga0207681_10061208 Ga0207681_100612082 99
418 3300025924 Ga0207694_11688766 Ga0207694_116887662 99
419 3300025926 Ga0207659_10965981 Ga0207659_109659812 99
420 3300025927 Ga0207687_10000454 Ga0207687_100004547 99
421 3300025934 Ga0207686_10000806 Ga0207686_100008067 99
422 3300025935 Ga0207709_10000297 Ga0207709_1000029724 99
423 3300025936 Ga0207670_10000590 Ga0207670_1000059014 99
424 3300025936 Ga0207670_11170261 Ga0207670_111702612 99
425 3300025938 Ga0207704_10000251 Ga0207704_100002515 99
426 3300025942 Ga0207689_10000103 Ga0207689_1000010317 99
427 3300025942 Ga0207689_10639396 Ga0207689_106393961 99
428 3300025949 Ga0207667_10007221 Ga0207667_1000722110 99
429 3300025949 Ga0207667_11472842 Ga0207667_114728421 99
430 3300025960 Ga0207651_10432190 Ga0207651_104321901 99
431 3300025960 Ga0207651_10783580 Ga0207651_107835802 99
432 3300025961 Ga0207712_10007693 Ga0207712_100076937 99
433 3300025981 Ga0207640_10002458 Ga0207640_1000245811 99
434 3300026023 Ga0207677_10000533 Ga0207677_1000053311 99
435 3300026035 Ga0207703_10000898 Ga0207703_1000089819 99
436 3300026041 Ga0207639_10255285 Ga0207639_102552852 99
437 3300026041 Ga0207639_10935617 Ga0207639_109356172 99
438 3300026075 Ga0207708_10000048 Ga0207708_1000004875 99
439 3300026078 Ga0207702_10110494 Ga0207702_101104943 99
440 3300026088 Ga0207641_10430228 Ga0207641_104302282 99
441 3300026088 Ga0207641_10709501 Ga0207641_107095012 99
442 3300026088 Ga0207641_11426660 Ga0207641_114266601 99
443 3300026089 Ga0207648_10001181 Ga0207648_1000118117 99
444 3300026095 Ga0207676_10151260 Ga0207676_101512602 99
445 3300026118 Ga0207675_100000593 Ga0207675_10000059334 99
446 3300026121 Ga0207683_10296710 Ga0207683_102967102 99
447 3300026142 Ga0207698_10130723 Ga0207698_101307234 99
448 3300027462 Ga0210000_1032061 Ga0210000_10320612 99
449 3300027671 Ga0209588_1158990 Ga0209588_11589902 99
450 3300027907 Ga0207428_10001315 Ga0207428_1000131523 99
451 3300028380 Ga0268265_10001097 Ga0268265_1000109713 99
452 3300028381 Ga0268264_10001229 Ga0268264_1000122923 99
453 3300028381 Ga0268264_10118907 Ga0268264_101189073 99
454 3300031995 Ga0307409_102286518 Ga0307409_1022865181 99
455 3300032002 Ga0307416_101527416 Ga0307416_1015274162 99
456 3300034816 Ga0373930_0075034 Ga0373930_0075034_166_465 99
457 3300034816 Ga0373930_0076282 Ga0373930_0076282_169_468 99
458 3300034817 Ga0373948_0007555 Ga0373948_0007555_356_655 99
459 3300034819 Ga0373958_0090307 Ga0373958_0090307_274_573 99
460 3300035083 Ga0373926_0001853 Ga0373926_0001853_3377_3676 99
461 3300035084 Ga0373928_0218609 Ga0373928_0218609_95_394 99
462 3300035088 Ga0373940_0006129 Ga0373940_0006129_2177_2476 99
463 3300035088 Ga0373940_0082640 Ga0373940_0082640_79_378 99
464 3300035089 Ga0373944_0114925 Ga0373944_0114925_143_442 99
465 3300035112 Ga0373932_0005675 Ga0373932_0005675_1987_2286 99
466 3300035112 Ga0373932_0208714 Ga0373932_0208714_72_371 99
467 3300035113 Ga0373936_0012274 Ga0373936_0012274_711_1010 99
468 3300035114 Ga0373939_0003338 Ga0373939_0003338_283_582 99
469 3300035115 Ga0373941_0094607 Ga0373941_0094607_314_613 99
470 3300035115 Ga0373941_0128249 Ga0373941_0128249_343_642 99
471 3300035116 Ga0373945_0002027 Ga0373945_0002027_5384_5683 99
472 3300035121 Ga0373960_0005276 Ga0373960_0005276_762_1061 99
473 3300035121 Ga0373960_0026206 Ga0373960_0026206_637_936 99
474 3300035170 Ga0373943_0112843 Ga0373943_0112843_706_1005 99
475 3300035171 Ga0373946_0027343 Ga0373946_0027343_575_874 99
476 3300035171 Ga0373946_0032062 Ga0373946_0032062_1105_1404 99
477 3300035207 Ga0373942_0045506 Ga0373942_0045506_632_931 99
478 3300035207 Ga0373942_0145007 Ga0373942_0145007_122_421 99
479 3300035242 Ga0373962_0005654 Ga0373962_0005654_2347_2646 99
480 3300035410 Ga0373924_0078045 Ga0373924_0078045_203_502 99
481 3300035691 Ga0373931_0001701 Ga0373931_0001701_1882_2181 99
482 3300035691 Ga0373931_0005942 Ga0373931_0005942_5027_5326 99
483 3300035691 Ga0373931_0251719 Ga0373931_0251719_134_433 99
484 3300035691 Ga0373931_0309791 Ga0373931_0309791_246_545 99
485 3300035692 Ga0373935_0037106 Ga0373935_0037106_1642_1941 99
486 3300035695 Ga0373927_0224957 Ga0373927_0224957_331_630 99
487 3300035725 Ga0373947_0151792 Ga0373947_0151792_647_946 99
488 3300037068 Ga0373925_0140207 Ga0373925_0140207_860_1159 99
489 3300037068 Ga0373925_0227750 Ga0373925_0227750_331_630 99
490 3300041413 Ga0439465_0210171 Ga0439465_0210171_148_447 99
491 3300044673 Ga0453683_0241345 Ga0453683_0241345_614_913 99
492 3300044712 Ga0453684_0419155 Ga0453684_0419155_367_666 99
493 3300045051 Ga0451576_0007423 Ga0451576_0007423_12181_12480 99
494 3300045051 Ga0451576_0094232 Ga0451576_0094232_456_755 99
495 3300045051 Ga0451576_0859020 Ga0451576_0859020_530_829 99
496 3300046472 Ga0495580_0064097 Ga0495580_0064097_2106_2405 99
497 3300046473 Ga0495582_0030860 Ga0495582_0030860_1800_2099 99
498 3300046475 Ga0495639_0024781 Ga0495639_0024781_1755_2054 99
499 3300046517 Ga0495630_0229142 Ga0495630_0229142_184_483 99
500 3300046523 Ga0495644_0158588 Ga0495644_0158588_368_667 99
501 3300046531 Ga0495665_0025372 Ga0495665_0025372_1885_2184 99
502 3300046535 Ga0495586_0001122 Ga0495586_0001122_2603_2902 99
503 3300046615 Ga0495656_0016860 Ga0495656_0016860_1526_1825 99
504 3300046664 Ga0495659_0156507 Ga0495659_0156507_241_543 99
505 3300046683 Ga0495658_0002217 Ga0495658_0002217_2393_2692 99
506 3300046683 Ga0495658_0328829 Ga0495658_0328829_618_923 99
507 3300047318 Ga0495636_0160047 Ga0495636_0160047_405_704 99
508 3300048917 Ga0496114_0244555 Ga0496114_0244555_685_984 99
509 3300049521 Ga0501298_032279 Ga0501298_032279_238_549 99
510 3300049568 Ga0501031_0335901 Ga0501031_0335901_558_869 99
511 3300049572 Ga0501036_0109864 Ga0501036_0109864_260_571 99
512 3300049574 Ga0501038_0390191 Ga0501038_0390191_641_952 99
513 3300049575 Ga0501039_0096349 Ga0501039_0096349_951_1262 99
514 3300049575 Ga0501039_0236417 Ga0501039_0236417_1015_1323 99
515 3300049576 Ga0501040_0309663 Ga0501040_0309663_482_790 99
516 3300049576 Ga0501040_0771604 Ga0501040_0771604_191_502 99
517 3300049577 Ga0501041_0783338 Ga0501041_0783338_266_577 99
518 3300049578 Ga0501042_0597798 Ga0501042_0597798_255_563 99
519 3300049579 Ga0501043_0365420 Ga0501043_0365420_531_842 99
520 3300049582 Ga0501048_0214866 Ga0501048_0214866_869_1180 99
521 3300049588 Ga0501072_0053110 Ga0501072_0053110_485_793 99
522 3300049588 Ga0501072_0175799 Ga0501072_0175799_1192_1491 99
523 3300049588 Ga0501072_0916982 Ga0501072_0916982_132_431 99
524 3300049592 Ga0501076_0357659 Ga0501076_0357659_161_469 99
525 3300050507 nmdc:mga05p37_46362_c1 nmdc:mga05p37_46362_c1_5011_5310 99
526 3300050507 nmdc:mga05p37_991921_c1 nmdc:mga05p37_991921_c1_517_816 99
527 3300050508 nmdc:mga09592_2325_c1 nmdc:mga09592_2325_c1_15031_15330 99
528 3300050508 nmdc:mga09592_255722_c1 nmdc:mga09592_255722_c1_317_616 99
529 3300050508 nmdc:mga09592_576209_c1 nmdc:mga09592_576209_c1_556_855 99
530 3300050508 nmdc:mga09592_979780_c1 nmdc:mga09592_979780_c1_302_601 99
531 3300050509 nmdc:mga0qj67_1303402_c1 nmdc:mga0qj67_1303402_c1_239_538 99
532 3300050509 nmdc:mga0qj67_443978_c1 nmdc:mga0qj67_443978_c1_46_345 99
533 3300050510 nmdc:mga06r32_1449446_c1 nmdc:mga06r32_1449446_c1_255_554 99
534 3300050510 nmdc:mga06r32_28844_c1 nmdc:mga06r32_28844_c1_4573_4872 99
535 3300050510 nmdc:mga06r32_750982_c1 nmdc:mga06r32_750982_c1_129_428 99
536 3300050510 nmdc:mga06r32_942060_c1 nmdc:mga06r32_942060_c1_462_761 99
537 3300050511 nmdc:mga08y16_1707_c1 nmdc:mga08y16_1707_c1_5710_6009 99
538 3300050511 nmdc:mga08y16_32909_c1 nmdc:mga08y16_32909_c1_1062_1361 99
539 3300050512 nmdc:mga0n895_282651_c1 nmdc:mga0n895_282651_c1_274_573 99
540 3300050512 nmdc:mga0n895_333_c1 nmdc:mga0n895_333_c1_21205_21504 99
541 3300050513 nmdc:mga0rr50_569_c1 nmdc:mga0rr50_569_c1_15148_15447 99
542 3300050514 nmdc:mga08x19_1192_c1 nmdc:mga08x19_1192_c1_1342_1641 99
543 3300050514 nmdc:mga08x19_28528_c1 nmdc:mga08x19_28528_c1_398_697 99
544 3300050514 nmdc:mga08x19_990611_c1 nmdc:mga08x19_990611_c1_210_512 99
545 3300050515 nmdc:mga0a205_32720_c1 nmdc:mga0a205_32720_c1_3670_3969 99
546 3300050515 nmdc:mga0a205_377382_c1 nmdc:mga0a205_377382_c1_501_800 99
547 3300050515 nmdc:mga0a205_880840_c1 nmdc:mga0a205_880840_c1_51_350 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09413

DUF2007

Putative prokaryotic signal transducing protein

8

75

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mnr-assembly1.cif.gz_B crystal structure of the znf3 of nucleoporin nup358/ranbp2 in complex with ran-gdp 0.9514 74 98
7mnv-assembly1.cif.gz_B crystal structure of the znf8 of nucleoporin nup358/ranbp2 in complex with ran-gdp 0.9468 74 98
3gj8-assembly1.cif.gz_B crystal structure of human rangdp-nup153znf34 complex 0.9453 73 98
3gj5-assembly2.cif.gz_D crystal structure of human rangdp-nup153znf4 complex 0.933 73 97
3gj4-assembly1.cif.gz_B crystal structure of human rangdp-nup153znf3 complex 0.9264 73 98
ID Description Score Start End Superfamily
af_Q55EN0_237_398_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.913 73 98 3.30.70.330
af_P09391_1_67_3.30.70.2350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8915 1 66 3.30.70.2350
af_Q4DHR8_1_892_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8761 74 98 1.25.10.10
1yj7B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 0.8526 1 66 3.30.70.1530
af_Q4DTI5_457_613_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8155 76 97 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7C2AEB9-F1-model_v4 DUF2007 domain-containing protein 0.8837 2 66
AF-A0A2H6AB27-F1-model_v4 DUF2007 domain-containing protein 0.8722 3 66
AF-A0A829YHJ1-F1-model_v4 DUF2007 domain-containing protein 0.8704 1 66
AF-A0A7C5C5T0-F1-model_v4 DUF2007 domain-containing protein 0.8679 3 66
AF-A0A2E0E796-F1-model_v4 deleted 0.858 1 66

Feature Viewer

pLDDT pTM Quality
86.47 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map