F462079
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 547 | 273 | 547 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300005617|Ga0068859_101347168|Ga0068859_1013471682 |
| Length | 107 |
| Sequence | MRRAVRALKRIYSSFNLAAVYHARNVLEAEGIRALVKNEMLSSAMGELPPAECQAELWVLRASEAERAARLLKYELWTEGVPWRCAACGESSEPQFTQCWRCGAYRT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 139 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 141 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 142 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 144 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 145 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 146 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 147 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 149 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 150 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 152 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 155 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 156 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 165 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 173 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 174 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 175 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 176 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 177 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 178 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 179 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 180 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 181 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 182 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 183 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 184 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 185 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 186 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 187 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 188 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 229 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 230 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 231 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 248 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 249 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 254 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 255 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 271 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 272 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.18 |
| Rhizosphere | 99.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1070434 | 3300002076 | Bacteria | 540 |
| 2 | Ga0065707_10004016 | 3300005295 | Bacteria | 5740 |
| 3 | Ga0065707_10014317 | 3300005295 | Bacteria | 1722 |
| 4 | Ga0070690_100000335 | 3300005330 | Bacteria | 24144 |
| 5 | Ga0070690_100112218 | 3300005330 | Bacteria | 1820 |
| 6 | Ga0068869_100001158 | 3300005334 | Bacteria | 15429 |
| 7 | Ga0068869_100659656 | 3300005334 | Bacteria | 889 |
| 8 | Ga0068869_101230353 | 3300005334 | Bacteria | 659 |
| 9 | Ga0070680_100014145 | 3300005336 | Bacteria | 6232 |
| 10 | Ga0070680_100324222 | 3300005336 | Bacteria | 1308 |
| 11 | Ga0070680_100787444 | 3300005336 | Unclassified | 819 |
| 12 | Ga0070680_101676107 | 3300005336 | Bacteria | 551 |
| 13 | Ga0070682_100042183 | 3300005337 | Bacteria | 2815 |
| 14 | Ga0068868_100000378 | 3300005338 | Bacteria | 30380 |
| 15 | Ga0068868_102111502 | 3300005338 | Unclassified | 536 |
| 16 | Ga0070689_100029187 | 3300005340 | Bacteria | 4172 |
| 17 | Ga0070689_100038792 | 3300005340 | Bacteria | 3644 |
| 18 | Ga0070689_100052957 | 3300005340 | Bacteria | 3140 |
| 19 | Ga0070689_100085539 | 3300005340 | Bacteria | 2480 |
| 20 | Ga0070689_101993857 | 3300005340 | Bacteria | 531 |
| 21 | Ga0070691_10010712 | 3300005341 | Bacteria | 4186 |
| 22 | Ga0070691_10046647 | 3300005341 | Bacteria | 2059 |
| 23 | Ga0070687_100000353 | 3300005343 | Bacteria | 15629 |
| 24 | Ga0070687_100851383 | 3300005343 | Bacteria | 650 |
| 25 | Ga0070692_10003721 | 3300005345 | Bacteria | 6256 |
| 26 | Ga0070692_10041072 | 3300005345 | Bacteria | 2368 |
| 27 | Ga0070692_10548474 | 3300005345 | Bacteria | 757 |
| 28 | Ga0070669_100086279 | 3300005353 | Bacteria | 2345 |
| 29 | Ga0070675_100776465 | 3300005354 | Bacteria | 875 |
| 30 | Ga0070671_100657961 | 3300005355 | Unclassified | 907 |
| 31 | Ga0070673_100076315 | 3300005364 | Bacteria | 2706 |
| 32 | Ga0070673_100356585 | 3300005364 | Bacteria | 1299 |
| 33 | Ga0070688_100057770 | 3300005365 | Bacteria | 2440 |
| 34 | Ga0070688_100396158 | 3300005365 | Bacteria | 1021 |
| 35 | Ga0070703_10006589 | 3300005406 | Bacteria | 3255 |
| 36 | Ga0070703_10046014 | 3300005406 | Bacteria | 1378 |
| 37 | Ga0070703_10270622 | 3300005406 | Bacteria | 697 |
| 38 | Ga0070714_100515251 | 3300005435 | Bacteria | 1142 |
| 39 | Ga0070701_10000027 | 3300005438 | Bacteria | 38022 |
| 40 | Ga0070701_10683453 | 3300005438 | Bacteria | 689 |
| 41 | Ga0070711_100230792 | 3300005439 | Bacteria | 1443 |
| 42 | Ga0070705_100000061 | 3300005440 | Bacteria | 56772 |
| 43 | Ga0070705_100312551 | 3300005440 | Bacteria | 1131 |
| 44 | Ga0070705_100993991 | 3300005440 | Bacteria | 680 |
| 45 | Ga0070700_100000386 | 3300005441 | Bacteria | 22650 |
| 46 | Ga0070700_100103049 | 3300005441 | Bacteria | 1884 |
| 47 | Ga0070700_100163653 | 3300005441 | Bacteria | 1534 |
| 48 | Ga0070694_100000096 | 3300005444 | Bacteria | 42431 |
| 49 | Ga0070694_100004187 | 3300005444 | Bacteria | 8668 |
| 50 | Ga0070694_100064216 | 3300005444 | Bacteria | 2512 |
| 51 | Ga0070694_100124419 | 3300005444 | Bacteria | 1854 |
| 52 | Ga0070694_100404432 | 3300005444 | Bacteria | 1069 |
| 53 | Ga0070694_100526049 | 3300005444 | Bacteria | 944 |
| 54 | Ga0070694_101334292 | 3300005444 | Bacteria | 604 |
| 55 | Ga0070708_101410064 | 3300005445 | Bacteria | 650 |
| 56 | Ga0070678_100339582 | 3300005456 | Bacteria | 1288 |
| 57 | Ga0070681_10032716 | 3300005458 | Bacteria | 5221 |
| 58 | Ga0070681_11733851 | 3300005458 | Bacteria | 551 |
| 59 | Ga0068867_100001399 | 3300005459 | Bacteria | 16670 |
| 60 | Ga0068867_100992492 | 3300005459 | Bacteria | 761 |
| 61 | Ga0070706_101343694 | 3300005467 | Bacteria | 655 |
| 62 | Ga0070707_100060346 | 3300005468 | Bacteria | 3637 |
| 63 | Ga0070698_100214935 | 3300005471 | Bacteria | 1857 |
| 64 | Ga0070698_101020568 | 3300005471 | Bacteria | 775 |
| 65 | Ga0070699_100258895 | 3300005518 | Bacteria | 1556 |
| 66 | Ga0070699_100341536 | 3300005518 | Bacteria | 1348 |
| 67 | Ga0070699_100424320 | 3300005518 | Bacteria | 1204 |
| 68 | Ga0070679_100030156 | 3300005530 | Bacteria | 5353 |
| 69 | Ga0070697_100677716 | 3300005536 | Bacteria | 909 |
| 70 | Ga0068853_100032789 | 3300005539 | Bacteria | 4403 |
| 71 | Ga0068853_100739161 | 3300005539 | Unclassified | 940 |
| 72 | Ga0070686_100001578 | 3300005544 | Bacteria | 12805 |
| 73 | Ga0070686_100621417 | 3300005544 | Bacteria | 854 |
| 74 | Ga0070686_101384765 | 3300005544 | Bacteria | 590 |
| 75 | Ga0070695_100000965 | 3300005545 | Bacteria | 15608 |
| 76 | Ga0070695_100010236 | 3300005545 | Bacteria | 5595 |
| 77 | Ga0070695_100038330 | 3300005545 | Bacteria | 3024 |
| 78 | Ga0070695_100338984 | 3300005545 | Bacteria | 1123 |
| 79 | Ga0070695_101352078 | 3300005545 | Bacteria | 590 |
| 80 | Ga0070696_100000560 | 3300005546 | Bacteria | 23643 |
| 81 | Ga0070696_100007068 | 3300005546 | Bacteria | 7495 |
| 82 | Ga0070696_100058464 | 3300005546 | Bacteria | 2693 |
| 83 | Ga0070696_100069113 | 3300005546 | Bacteria | 2481 |
| 84 | Ga0070696_100277018 | 3300005546 | Bacteria | 1277 |
| 85 | Ga0070696_100872946 | 3300005546 | Bacteria | 745 |
| 86 | Ga0070696_101654844 | 3300005546 | Bacteria | 551 |
| 87 | Ga0070693_100000003 | 3300005547 | Bacteria | 95793 |
| 88 | Ga0070693_100325727 | 3300005547 | Bacteria | 1044 |
| 89 | Ga0070693_100815156 | 3300005547 | Bacteria | 693 |
| 90 | Ga0070704_100000504 | 3300005549 | Bacteria | 18563 |
| 91 | Ga0070704_100038185 | 3300005549 | Bacteria | 3287 |
| 92 | Ga0070704_100038276 | 3300005549 | Bacteria | 3285 |
| 93 | Ga0070704_100056791 | 3300005549 | Bacteria | 2781 |
| 94 | Ga0070704_100549860 | 3300005549 | Bacteria | 1008 |
| 95 | Ga0068855_100005492 | 3300005563 | Bacteria | 15467 |
| 96 | Ga0068857_100857972 | 3300005577 | Bacteria | 869 |
| 97 | Ga0068854_100003450 | 3300005578 | Bacteria | 9865 |
| 98 | Ga0068856_100144011 | 3300005614 | Bacteria | 2391 |
| 99 | Ga0068856_100181533 | 3300005614 | Bacteria | 2117 |
| 100 | Ga0070702_100000004 | 3300005615 | Bacteria | 70302 |
| 101 | Ga0070702_100217042 | 3300005615 | Bacteria | 1277 |
| 102 | Ga0070702_100426614 | 3300005615 | Bacteria | 956 |
| 103 | Ga0068852_100068470 | 3300005616 | Bacteria | 3107 |
| 104 | Ga0068852_102334300 | 3300005616 | Unclassified | 556 |
| 105 | Ga0068859_100002292 | 3300005617 | Bacteria | 19424 |
| 106 | Ga0068859_100496457 | 3300005617 | Bacteria | 1316 |
| 107 | Ga0068859_101347168 | 3300005617 | Bacteria | 787 |
| 108 | Ga0068859_102533112 | 3300005617 | Unclassified | 565 |
| 109 | Ga0068864_100318573 | 3300005618 | Unclassified | 1460 |
| 110 | Ga0068866_10000342 | 3300005718 | Bacteria | 21994 |
| 111 | Ga0068861_100001170 | 3300005719 | Bacteria | 16343 |
| 112 | Ga0068861_100926822 | 3300005719 | Bacteria | 827 |
| 113 | Ga0068870_10004636 | 3300005840 | Bacteria | 5929 |
| 114 | Ga0068870_10667036 | 3300005840 | Unclassified | 714 |
| 115 | Ga0068863_100255736 | 3300005841 | Bacteria | 1692 |
| 116 | Ga0068863_102309958 | 3300005841 | Bacteria | 547 |
| 117 | Ga0068858_100002734 | 3300005842 | Bacteria | 17741 |
| 118 | Ga0068860_100002098 | 3300005843 | Bacteria | 21009 |
| 119 | Ga0068862_100001419 | 3300005844 | Bacteria | 22189 |
| 120 | Ga0068862_100209721 | 3300005844 | Bacteria | 1760 |
| 121 | Ga0068862_100223759 | 3300005844 | Bacteria | 1704 |
| 122 | Ga0068862_100631912 | 3300005844 | Bacteria | 1031 |
| 123 | Ga0097621_100000024 | 3300006237 | Bacteria | 81390 |
| 124 | Ga0068871_100002217 | 3300006358 | Bacteria | 13190 |
| 125 | Ga0075428_100004856 | 3300006844 | Bacteria | 14915 |
| 126 | Ga0075428_100101689 | 3300006844 | Bacteria | 3133 |
| 127 | Ga0075428_100552022 | 3300006844 | Bacteria | 1231 |
| 128 | Ga0075428_101802543 | 3300006844 | Bacteria | 637 |
| 129 | Ga0075430_100000969 | 3300006846 | Bacteria | 22599 |
| 130 | Ga0075430_100260665 | 3300006846 | Bacteria | 1436 |
| 131 | Ga0075430_100333374 | 3300006846 | Bacteria | 1253 |
| 132 | Ga0075430_100725297 | 3300006846 | Bacteria | 819 |
| 133 | Ga0075430_101355137 | 3300006846 | Bacteria | 585 |
| 134 | Ga0075431_100152711 | 3300006847 | Bacteria | 2377 |
| 135 | Ga0075431_100215892 | 3300006847 | Bacteria | 1958 |
| 136 | Ga0075431_101950940 | 3300006847 | Bacteria | 542 |
| 137 | Ga0075433_10030077 | 3300006852 | Bacteria | 4632 |
| 138 | Ga0075433_10269771 | 3300006852 | Bacteria | 1508 |
| 139 | Ga0075433_10414417 | 3300006852 | Bacteria | 1188 |
| 140 | Ga0075433_10724170 | 3300006852 | Bacteria | 871 |
| 141 | Ga0075433_10828727 | 3300006852 | Bacteria | 808 |
| 142 | Ga0075434_100001724 | 3300006871 | Bacteria | 18761 |
| 143 | Ga0075434_100146287 | 3300006871 | Bacteria | 2383 |
| 144 | Ga0075434_100412890 | 3300006871 | Bacteria | 1371 |
| 145 | Ga0075434_100604109 | 3300006871 | Bacteria | 1116 |
| 146 | Ga0075429_100000496 | 3300006880 | Bacteria | 29568 |
| 147 | Ga0075429_100052059 | 3300006880 | Bacteria | 3562 |
| 148 | Ga0075429_100496424 | 3300006880 | Bacteria | 1069 |
| 149 | Ga0075429_100564167 | 3300006880 | Bacteria | 998 |
| 150 | Ga0075429_100980912 | 3300006880 | Unclassified | 739 |
| 151 | Ga0075429_101048655 | 3300006880 | Bacteria | 712 |
| 152 | Ga0068865_100000417 | 3300006881 | Bacteria | 23766 |
| 153 | Ga0075436_100000142 | 3300006914 | Bacteria | 43453 |
| 154 | Ga0075436_100008614 | 3300006914 | Bacteria | 6972 |
| 155 | Ga0075436_100012065 | 3300006914 | Bacteria | 5927 |
| 156 | Ga0097620_100002292 | 3300006931 | Bacteria | 19424 |
| 157 | Ga0097620_100496459 | 3300006931 | Bacteria | 1316 |
| 158 | Ga0097620_101347157 | 3300006931 | Bacteria | 787 |
| 159 | Ga0097620_102533510 | 3300006931 | Unclassified | 565 |
| 160 | Ga0075435_100008441 | 3300007076 | Bacteria | 7391 |
| 161 | Ga0075435_100023958 | 3300007076 | Bacteria | 4729 |
| 162 | Ga0075435_100214664 | 3300007076 | Bacteria | 1633 |
| 163 | Ga0075435_100348670 | 3300007076 | Bacteria | 1269 |
| 164 | Ga0075435_100619590 | 3300007076 | Bacteria | 939 |
| 165 | Ga0099794_10048506 | 3300007265 | Bacteria | 2038 |
| 166 | Ga0099794_10765755 | 3300007265 | Bacteria | 516 |
| 167 | Ga0105240_10289283 | 3300009093 | Bacteria | 1879 |
| 168 | Ga0111539_10028668 | 3300009094 | Bacteria | 6790 |
| 169 | Ga0111539_10096214 | 3300009094 | Bacteria | 3478 |
| 170 | Ga0111539_11087744 | 3300009094 | Bacteria | 929 |
| 171 | Ga0111539_11114271 | 3300009094 | Bacteria | 917 |
| 172 | Ga0111539_11193443 | 3300009094 | Bacteria | 884 |
| 173 | Ga0111539_11840597 | 3300009094 | Bacteria | 702 |
| 174 | Ga0105245_10038220 | 3300009098 | Bacteria | 4271 |
| 175 | Ga0114129_10001872 | 3300009147 | Bacteria | 28684 |
| 176 | Ga0114129_10337806 | 3300009147 | Bacteria | 1999 |
| 177 | Ga0114129_13097735 | 3300009147 | Bacteria | 544 |
| 178 | Ga0105243_10000339 | 3300009148 | Bacteria | 51082 |
| 179 | Ga0105241_10015808 | 3300009174 | Bacteria | 5529 |
| 180 | Ga0105242_10000346 | 3300009176 | Bacteria | 37361 |
| 181 | Ga0105248_10357117 | 3300009177 | Bacteria | 1645 |
| 182 | Ga0105249_10012564 | 3300009553 | Bacteria | 7464 |
| 183 | Ga0105239_10433348 | 3300010375 | Bacteria | 1490 |
| 184 | Ga0105246_10052088 | 3300011119 | Bacteria | 2812 |
| 185 | Ga0105246_10421530 | 3300011119 | Bacteria | 1114 |
| 186 | Ga0157378_10000192 | 3300013297 | Bacteria | 59014 |
| 187 | Ga0157375_10350516 | 3300013308 | Bacteria | 1642 |
| 188 | Ga0157375_11441174 | 3300013308 | Unclassified | 812 |
| 189 | Ga0157380_10007200 | 3300014326 | Bacteria | 7882 |
| 190 | Ga0157380_10746265 | 3300014326 | Bacteria | 990 |
| 191 | Ga0157380_12563027 | 3300014326 | Unclassified | 576 |
| 192 | Ga0157377_10170307 | 3300014745 | Bacteria | 1361 |
| 193 | Ga0157377_11034594 | 3300014745 | Unclassified | 624 |
| 194 | Ga0157379_11367602 | 3300014968 | Bacteria | 685 |
| 195 | Ga0157376_10021789 | 3300014969 | Bacteria | 4980 |
| 196 | Ga0207653_10008181 | 3300025885 | Bacteria | 3260 |
| 197 | Ga0207653_10278474 | 3300025885 | Bacteria | 645 |
| 198 | Ga0207642_10001562 | 3300025899 | Bacteria | 7050 |
| 199 | Ga0207688_10034726 | 3300025901 | Bacteria | 2793 |
| 200 | Ga0207680_10968270 | 3300025903 | Bacteria | 610 |
| 201 | Ga0207643_10022819 | 3300025908 | Bacteria | 3448 |
| 202 | Ga0207643_10562698 | 3300025908 | Bacteria | 732 |
| 203 | Ga0207643_10584830 | 3300025908 | Unclassified | 718 |
| 204 | Ga0207684_10393779 | 3300025910 | Bacteria | 1191 |
| 205 | Ga0207684_10997503 | 3300025910 | Bacteria | 701 |
| 206 | Ga0207654_10068769 | 3300025911 | Bacteria | 2096 |
| 207 | Ga0207707_10026336 | 3300025912 | Bacteria | 5083 |
| 208 | Ga0207695_10908393 | 3300025913 | Bacteria | 760 |
| 209 | Ga0207663_10132078 | 3300025916 | Bacteria | 1727 |
| 210 | Ga0207663_10892900 | 3300025916 | Bacteria | 710 |
| 211 | Ga0207660_10006379 | 3300025917 | Bacteria | 7645 |
| 212 | Ga0207660_10571607 | 3300025917 | Bacteria | 920 |
| 213 | Ga0207662_10000653 | 3300025918 | Bacteria | 15703 |
| 214 | Ga0207662_10159138 | 3300025918 | Bacteria | 1442 |
| 215 | Ga0207652_10017093 | 3300025921 | Bacteria | 5934 |
| 216 | Ga0207646_11102331 | 3300025922 | Bacteria | 699 |
| 217 | Ga0207681_10061208 | 3300025923 | Bacteria | 2587 |
| 218 | Ga0207694_11688766 | 3300025924 | Unclassified | 533 |
| 219 | Ga0207659_10965981 | 3300025926 | Bacteria | 733 |
| 220 | Ga0207687_10000454 | 3300025927 | Bacteria | 27910 |
| 221 | Ga0207686_10000806 | 3300025934 | Bacteria | 19237 |
| 222 | Ga0207709_10000297 | 3300025935 | Bacteria | 55386 |
| 223 | Ga0207670_10000590 | 3300025936 | Bacteria | 19930 |
| 224 | Ga0207670_10204585 | 3300025936 | Bacteria | 1502 |
| 225 | Ga0207670_10582027 | 3300025936 | Bacteria | 917 |
| 226 | Ga0207670_11170261 | 3300025936 | Unclassified | 650 |
| 227 | Ga0207704_10000251 | 3300025938 | Bacteria | 26202 |
| 228 | Ga0207689_10000103 | 3300025942 | Bacteria | 69244 |
| 229 | Ga0207689_10173261 | 3300025942 | Bacteria | 1779 |
| 230 | Ga0207689_10639396 | 3300025942 | Bacteria | 896 |
| 231 | Ga0207689_11352639 | 3300025942 | Bacteria | 598 |
| 232 | Ga0207667_10007221 | 3300025949 | Bacteria | 13405 |
| 233 | Ga0207667_11472842 | 3300025949 | Unclassified | 652 |
| 234 | Ga0207651_10432190 | 3300025960 | Bacteria | 1126 |
| 235 | Ga0207651_10783580 | 3300025960 | Bacteria | 844 |
| 236 | Ga0207712_10007693 | 3300025961 | Bacteria | 6813 |
| 237 | Ga0207640_10002458 | 3300025981 | Bacteria | 9915 |
| 238 | Ga0207677_10000533 | 3300026023 | Bacteria | 24049 |
| 239 | Ga0207703_10000898 | 3300026035 | Bacteria | 29129 |
| 240 | Ga0207639_10255285 | 3300026041 | Bacteria | 1531 |
| 241 | Ga0207639_10935617 | 3300026041 | Unclassified | 811 |
| 242 | Ga0207708_10000048 | 3300026075 | Bacteria | 114754 |
| 243 | Ga0207708_10099345 | 3300026075 | Bacteria | 2251 |
| 244 | Ga0207708_10136212 | 3300026075 | Bacteria | 1923 |
| 245 | Ga0207702_10110494 | 3300026078 | Bacteria | 2443 |
| 246 | Ga0207641_10430228 | 3300026088 | Bacteria | 1272 |
| 247 | Ga0207641_10709501 | 3300026088 | Unclassified | 991 |
| 248 | Ga0207641_11426660 | 3300026088 | Bacteria | 693 |
| 249 | Ga0207648_10001181 | 3300026089 | Bacteria | 29231 |
| 250 | Ga0207676_10151260 | 3300026095 | Bacteria | 1999 |
| 251 | Ga0207674_10783206 | 3300026116 | Bacteria | 920 |
| 252 | Ga0207675_100000593 | 3300026118 | Bacteria | 35437 |
| 253 | Ga0207675_100380909 | 3300026118 | Bacteria | 1387 |
| 254 | Ga0207675_101881946 | 3300026118 | Unclassified | 617 |
| 255 | Ga0207675_102256862 | 3300026118 | Unclassified | 559 |
| 256 | Ga0207683_10296710 | 3300026121 | Bacteria | 1479 |
| 257 | Ga0207698_10130723 | 3300026142 | Bacteria | 2145 |
| 258 | Ga0209969_1000935 | 3300027360 | Bacteria | 3952 |
| 259 | Ga0209967_1000341 | 3300027364 | Bacteria | 6208 |
| 260 | Ga0209967_1008800 | 3300027364 | Bacteria | 1394 |
| 261 | Ga0209967_1063258 | 3300027364 | Bacteria | 575 |
| 262 | Ga0209981_1003509 | 3300027378 | Bacteria | 2038 |
| 263 | Ga0209981_1034749 | 3300027378 | Bacteria | 745 |
| 264 | Ga0209996_1001756 | 3300027395 | Bacteria | 2644 |
| 265 | Ga0209996_1005558 | 3300027395 | Bacteria | 1616 |
| 266 | Ga0210000_1003999 | 3300027462 | Bacteria | 2134 |
| 267 | Ga0210000_1009043 | 3300027462 | Bacteria | 1464 |
| 268 | Ga0210000_1013014 | 3300027462 | Bacteria | 1239 |
| 269 | Ga0210000_1032061 | 3300027462 | Bacteria | 823 |
| 270 | Ga0209995_1012882 | 3300027471 | Bacteria | 1367 |
| 271 | Ga0209968_1007688 | 3300027526 | Bacteria | 1633 |
| 272 | Ga0209968_1023725 | 3300027526 | Bacteria | 1004 |
| 273 | Ga0209968_1039555 | 3300027526 | Bacteria | 804 |
| 274 | Ga0209999_1053645 | 3300027543 | Bacteria | 763 |
| 275 | Ga0209983_1009613 | 3300027665 | Bacteria | 1977 |
| 276 | Ga0209983_1018474 | 3300027665 | Bacteria | 1447 |
| 277 | Ga0209588_1158990 | 3300027671 | Bacteria | 714 |
| 278 | Ga0209966_1001170 | 3300027695 | Bacteria | 4683 |
| 279 | Ga0209966_1005922 | 3300027695 | Bacteria | 2111 |
| 280 | Ga0207428_10001315 | 3300027907 | Bacteria | 26451 |
| 281 | Ga0207428_10466492 | 3300027907 | Bacteria | 920 |
| 282 | Ga0268265_10001097 | 3300028380 | Bacteria | 24045 |
| 283 | Ga0268265_10226154 | 3300028380 | Bacteria | 1641 |
| 284 | Ga0268265_10493241 | 3300028380 | Bacteria | 1153 |
| 285 | Ga0268264_10001229 | 3300028381 | Bacteria | 24608 |
| 286 | Ga0268264_10118907 | 3300028381 | Bacteria | 2326 |
| 287 | Ga0307408_100351273 | 3300031548 | Bacteria | 1251 |
| 288 | Ga0307408_100867652 | 3300031548 | Unclassified | 824 |
| 289 | Ga0307408_101624463 | 3300031548 | Bacteria | 614 |
| 290 | Ga0307408_102018082 | 3300031548 | Bacteria | 555 |
| 291 | Ga0307405_10436012 | 3300031731 | Bacteria | 1035 |
| 292 | Ga0307413_11750810 | 3300031824 | Bacteria | 555 |
| 293 | Ga0307406_10489352 | 3300031901 | Bacteria | 995 |
| 294 | Ga0307406_11218519 | 3300031901 | Bacteria | 654 |
| 295 | Ga0307412_10256369 | 3300031911 | Bacteria | 1361 |
| 296 | Ga0307409_101162890 | 3300031995 | Bacteria | 794 |
| 297 | Ga0307409_102286518 | 3300031995 | Bacteria | 570 |
| 298 | Ga0307416_100234360 | 3300032002 | Bacteria | 1772 |
| 299 | Ga0307416_100279814 | 3300032002 | Bacteria | 1644 |
| 300 | Ga0307416_100887468 | 3300032002 | Bacteria | 991 |
| 301 | Ga0307416_101527416 | 3300032002 | Bacteria | 773 |
| 302 | Ga0307416_101715366 | 3300032002 | Bacteria | 733 |
| 303 | Ga0373930_0075034 | 3300034816 | Bacteria | 774 |
| 304 | Ga0373930_0076282 | 3300034816 | Bacteria | 769 |
| 305 | Ga0373948_0007555 | 3300034817 | Unclassified | 1832 |
| 306 | Ga0373958_0090307 | 3300034819 | Bacteria | 706 |
| 307 | Ga0373958_0187810 | 3300034819 | Unclassified | 535 |
| 308 | Ga0373926_0001853 | 3300035083 | Bacteria | 6583 |
| 309 | Ga0373928_0218609 | 3300035084 | Bacteria | 556 |
| 310 | Ga0373940_0006129 | 3300035088 | Bacteria | 2646 |
| 311 | Ga0373940_0082640 | 3300035088 | Bacteria | 952 |
| 312 | Ga0373944_0114925 | 3300035089 | Bacteria | 922 |
| 313 | Ga0373923_0046854 | 3300035111 | Bacteria | 1800 |
| 314 | Ga0373932_0005675 | 3300035112 | Bacteria | 2936 |
| 315 | Ga0373932_0208714 | 3300035112 | Bacteria | 697 |
| 316 | Ga0373932_0342170 | 3300035112 | Bacteria | 567 |
| 317 | Ga0373936_0012274 | 3300035113 | Bacteria | 3256 |
| 318 | Ga0373936_0511581 | 3300035113 | Bacteria | 559 |
| 319 | Ga0373939_0003338 | 3300035114 | Bacteria | 3768 |
| 320 | Ga0373941_0094607 | 3300035115 | Unclassified | 1031 |
| 321 | Ga0373941_0128249 | 3300035115 | Bacteria | 911 |
| 322 | Ga0373945_0002027 | 3300035116 | Bacteria | 6301 |
| 323 | Ga0373960_0005276 | 3300035121 | Bacteria | 2988 |
| 324 | Ga0373960_0026206 | 3300035121 | Unclassified | 1591 |
| 325 | Ga0373943_0112843 | 3300035170 | Bacteria | 1435 |
| 326 | Ga0373946_0027343 | 3300035171 | Bacteria | 2255 |
| 327 | Ga0373946_0032062 | 3300035171 | Bacteria | 2108 |
| 328 | Ga0373955_0523840 | 3300035172 | Bacteria | 724 |
| 329 | Ga0373942_0045506 | 3300035207 | Unclassified | 1212 |
| 330 | Ga0373942_0145007 | 3300035207 | Bacteria | 759 |
| 331 | Ga0373961_0356179 | 3300035241 | Bacteria | 553 |
| 332 | Ga0373962_0005654 | 3300035242 | Bacteria | 3018 |
| 333 | Ga0373924_0078045 | 3300035410 | Bacteria | 1405 |
| 334 | Ga0373931_0001701 | 3300035691 | Bacteria | 9534 |
| 335 | Ga0373931_0005942 | 3300035691 | Bacteria | 5676 |
| 336 | Ga0373931_0251719 | 3300035691 | Bacteria | 1074 |
| 337 | Ga0373931_0309791 | 3300035691 | Unclassified | 977 |
| 338 | Ga0373935_0037106 | 3300035692 | Bacteria | 3049 |
| 339 | Ga0373927_0224957 | 3300035695 | Bacteria | 1232 |
| 340 | Ga0373947_0151792 | 3300035725 | Bacteria | 1492 |
| 341 | Ga0373937_0027675 | 3300036401 | Bacteria | 5129 |
| 342 | Ga0373925_0140207 | 3300037068 | Bacteria | 1891 |
| 343 | Ga0373925_0227750 | 3300037068 | Bacteria | 1489 |
| 344 | Ga0242420_041902 | 3300038996 | Bacteria | 876 |
| 345 | Ga0439439_0162324 | 3300041406 | Bacteria | 638 |
| 346 | Ga0439453_0063056 | 3300041408 | Bacteria | 771 |
| 347 | Ga0439453_0081833 | 3300041408 | Bacteria | 697 |
| 348 | Ga0439461_0002609 | 3300041410 | Bacteria | 2901 |
| 349 | Ga0439465_0210171 | 3300041413 | Bacteria | 711 |
| 350 | Ga0439441_001833 | 3300042001 | Bacteria | 2886 |
| 351 | Ga0439441_020394 | 3300042001 | Bacteria | 1214 |
| 352 | Ga0450888_045601 | 3300042126 | Unclassified | 619 |
| 353 | Ga0450898_104048 | 3300042134 | Unclassified | 595 |
| 354 | Ga0439434_0000327 | 3300042435 | Bacteria | 13478 |
| 355 | Ga0439434_0065614 | 3300042435 | Bacteria | 1139 |
| 356 | Ga0439435_0000043 | 3300042436 | Bacteria | 14055 |
| 357 | Ga0439435_0000831 | 3300042436 | Bacteria | 5270 |
| 358 | Ga0439435_0042707 | 3300042436 | Bacteria | 1273 |
| 359 | Ga0439444_0000510 | 3300042437 | Bacteria | 4365 |
| 360 | Ga0439444_0002926 | 3300042437 | Bacteria | 2376 |
| 361 | Ga0439460_0001357 | 3300042461 | Bacteria | 5755 |
| 362 | Ga0451577_0436653 | 3300042876 | Bacteria | 1189 |
| 363 | Ga0453683_0241345 | 3300044673 | Bacteria | 1151 |
| 364 | Ga0453684_0419155 | 3300044712 | Bacteria | 1496 |
| 365 | Ga0451576_0007423 | 3300045051 | Bacteria | 13110 |
| 366 | Ga0451576_0094232 | 3300045051 | Bacteria | 3113 |
| 367 | Ga0451576_0103711 | 3300045051 | Bacteria | 2958 |
| 368 | Ga0451576_0111760 | 3300045051 | Bacteria | 2843 |
| 369 | Ga0451576_0859020 | 3300045051 | Bacteria | 952 |
| 370 | Ga0495592_0144972 | 3300046454 | Bacteria | 1647 |
| 371 | Ga0495653_0088878 | 3300046463 | Bacteria | 2265 |
| 372 | Ga0495580_0064097 | 3300046472 | Bacteria | 2576 |
| 373 | Ga0495582_0030860 | 3300046473 | Bacteria | 2945 |
| 374 | Ga0495639_0024781 | 3300046475 | Bacteria | 2642 |
| 375 | Ga0495662_0010692 | 3300046476 | Bacteria | 4488 |
| 376 | Ga0495608_0004174 | 3300046511 | Bacteria | 10362 |
| 377 | Ga0495618_0007803 | 3300046514 | Bacteria | 6478 |
| 378 | Ga0495628_0015350 | 3300046516 | Bacteria | 6396 |
| 379 | Ga0495630_0053374 | 3300046517 | Bacteria | 3026 |
| 380 | Ga0495630_0229142 | 3300046517 | Bacteria | 1419 |
| 381 | Ga0495644_0158588 | 3300046523 | Unclassified | 867 |
| 382 | Ga0495666_0037729 | 3300046526 | Bacteria | 2350 |
| 383 | Ga0495642_0066310 | 3300046528 | Bacteria | 1504 |
| 384 | Ga0495652_0400760 | 3300046529 | Bacteria | 971 |
| 385 | Ga0495665_0025372 | 3300046531 | Bacteria | 3184 |
| 386 | Ga0495640_0006542 | 3300046533 | Bacteria | 9205 |
| 387 | Ga0495586_0001122 | 3300046535 | Bacteria | 15063 |
| 388 | Ga0495586_0003090 | 3300046535 | Bacteria | 8973 |
| 389 | Ga0495587_0182562 | 3300046536 | Bacteria | 1189 |
| 390 | Ga0495621_0015137 | 3300046539 | Bacteria | 2455 |
| 391 | Ga0495645_0043321 | 3300046543 | Bacteria | 3283 |
| 392 | Ga0495667_0006793 | 3300046559 | Bacteria | 7766 |
| 393 | Ga0495656_0016860 | 3300046615 | Bacteria | 2777 |
| 394 | Ga0495634_0016497 | 3300046642 | Bacteria | 5283 |
| 395 | Ga0495635_0065769 | 3300046663 | Bacteria | 2487 |
| 396 | Ga0495659_0028236 | 3300046664 | Bacteria | 1941 |
| 397 | Ga0495659_0156507 | 3300046664 | Bacteria | 918 |
| 398 | Ga0495599_0004175 | 3300046678 | Bacteria | 8526 |
| 399 | Ga0495658_0002217 | 3300046683 | Bacteria | 9820 |
| 400 | Ga0495658_0046663 | 3300046683 | Bacteria | 2436 |
| 401 | Ga0495658_0328829 | 3300046683 | Bacteria | 970 |
| 402 | Ga0495658_0982454 | 3300046683 | Bacteria | 539 |
| 403 | Ga0495613_0008754 | 3300046689 | Bacteria | 7505 |
| 404 | Ga0495624_0251646 | 3300046690 | Bacteria | 1068 |
| 405 | Ga0495600_0016281 | 3300046809 | Bacteria | 4716 |
| 406 | Ga0495581_0521541 | 3300047315 | Bacteria | 690 |
| 407 | Ga0495604_0003608 | 3300047317 | Bacteria | 12336 |
| 408 | Ga0495636_0005309 | 3300047318 | Bacteria | 5061 |
| 409 | Ga0495636_0160047 | 3300047318 | Unclassified | 1014 |
| 410 | Ga0495674_1077781 | 3300047319 | Unclassified | 612 |
| 411 | Ga0495680_0004943 | 3300047322 | Bacteria | 12613 |
| 412 | Ga0495685_154116 | 3300047447 | Bacteria | 746 |
| 413 | Ga0495593_0054403 | 3300047673 | Bacteria | 2110 |
| 414 | Ga0495602_0721738 | 3300048088 | Bacteria | 675 |
| 415 | Ga0495614_0550505 | 3300048089 | Bacteria | 552 |
| 416 | Ga0496114_0244555 | 3300048917 | Bacteria | 1578 |
| 417 | Ga0501291_073751 | 3300049514 | Bacteria | 666 |
| 418 | Ga0501291_145365 | 3300049514 | Bacteria | 532 |
| 419 | Ga0501298_032279 | 3300049521 | Bacteria | 1033 |
| 420 | Ga0501301_014980 | 3300049524 | Bacteria | 687 |
| 421 | Ga0501031_0335901 | 3300049568 | Bacteria | 978 |
| 422 | Ga0501031_0906632 | 3300049568 | Bacteria | 564 |
| 423 | Ga0501033_0235638 | 3300049570 | Bacteria | 1299 |
| 424 | Ga0501036_0109864 | 3300049572 | Bacteria | 2330 |
| 425 | Ga0501036_0175905 | 3300049572 | Bacteria | 1802 |
| 426 | Ga0501036_1181214 | 3300049572 | Bacteria | 624 |
| 427 | Ga0501038_0163217 | 3300049574 | Bacteria | 1809 |
| 428 | Ga0501038_0390191 | 3300049574 | Bacteria | 1079 |
| 429 | Ga0501039_0032224 | 3300049575 | Bacteria | 4040 |
| 430 | Ga0501039_0074075 | 3300049575 | Bacteria | 2646 |
| 431 | Ga0501039_0096349 | 3300049575 | Bacteria | 2307 |
| 432 | Ga0501039_0236417 | 3300049575 | Bacteria | 1437 |
| 433 | Ga0501039_0322384 | 3300049575 | Bacteria | 1214 |
| 434 | Ga0501039_0629093 | 3300049575 | Bacteria | 841 |
| 435 | Ga0501040_0072651 | 3300049576 | Bacteria | 2376 |
| 436 | Ga0501040_0257837 | 3300049576 | Bacteria | 1244 |
| 437 | Ga0501040_0281278 | 3300049576 | Bacteria | 1188 |
| 438 | Ga0501040_0309663 | 3300049576 | Bacteria | 1129 |
| 439 | Ga0501040_0771604 | 3300049576 | Bacteria | 695 |
| 440 | Ga0501041_0052281 | 3300049577 | Bacteria | 2490 |
| 441 | Ga0501041_0753993 | 3300049577 | Bacteria | 624 |
| 442 | Ga0501041_0783338 | 3300049577 | Bacteria | 611 |
| 443 | Ga0501042_0078476 | 3300049578 | Bacteria | 2365 |
| 444 | Ga0501042_0373827 | 3300049578 | Bacteria | 1031 |
| 445 | Ga0501042_0597798 | 3300049578 | Bacteria | 802 |
| 446 | Ga0501043_0073068 | 3300049579 | Bacteria | 2694 |
| 447 | Ga0501043_0365420 | 3300049579 | Bacteria | 1095 |
| 448 | Ga0501043_0389956 | 3300049579 | Bacteria | 1053 |
| 449 | Ga0501046_0247179 | 3300049580 | Bacteria | 1314 |
| 450 | Ga0501048_0044897 | 3300049582 | Bacteria | 3157 |
| 451 | Ga0501048_0214866 | 3300049582 | Bacteria | 1364 |
| 452 | Ga0501071_0370798 | 3300049587 | Bacteria | 1091 |
| 453 | Ga0501071_0540988 | 3300049587 | Bacteria | 894 |
| 454 | Ga0501071_0541405 | 3300049587 | Bacteria | 894 |
| 455 | Ga0501071_0582484 | 3300049587 | Bacteria | 860 |
| 456 | Ga0501072_0043357 | 3300049588 | Bacteria | 3536 |
| 457 | Ga0501072_0053110 | 3300049588 | Bacteria | 3191 |
| 458 | Ga0501072_0175799 | 3300049588 | Bacteria | 1708 |
| 459 | Ga0501072_0233396 | 3300049588 | Bacteria | 1465 |
| 460 | Ga0501072_0916982 | 3300049588 | Bacteria | 684 |
| 461 | Ga0501072_1343029 | 3300049588 | Bacteria | 554 |
| 462 | Ga0501075_0023147 | 3300049591 | Bacteria | 4546 |
| 463 | Ga0501075_0050733 | 3300049591 | Bacteria | 3119 |
| 464 | Ga0501075_0832096 | 3300049591 | Bacteria | 702 |
| 465 | Ga0501075_0834800 | 3300049591 | Bacteria | 701 |
| 466 | Ga0501076_0006798 | 3300049592 | Bacteria | 8299 |
| 467 | Ga0501076_0116029 | 3300049592 | Bacteria | 2167 |
| 468 | Ga0501076_0357659 | 3300049592 | Bacteria | 1199 |
| 469 | Ga0501076_0529820 | 3300049592 | Bacteria | 971 |
| 470 | Ga0501076_0855321 | 3300049592 | Bacteria | 750 |
| 471 | Ga0501077_0022870 | 3300049593 | Bacteria | 3962 |
| 472 | Ga0501077_0095478 | 3300049593 | Bacteria | 1885 |
| 473 | Ga0501230_112797 | 3300049667 | Bacteria | 596 |
| 474 | Ga0501236_143625 | 3300049670 | Bacteria | 501 |
| 475 | Ga0501079_0002756 | 3300049741 | Bacteria | 12808 |
| 476 | Ga0501079_0495286 | 3300049741 | Bacteria | 961 |
| 477 | Ga0501079_0860283 | 3300049741 | Bacteria | 714 |
| 478 | Ga0501080_0042805 | 3300049742 | Bacteria | 4216 |
| 479 | Ga0501080_0550268 | 3300049742 | Bacteria | 1028 |
| 480 | Ga0501081_0031542 | 3300049743 | Bacteria | 3591 |
| 481 | Ga0501081_0039707 | 3300049743 | Bacteria | 3222 |
| 482 | Ga0501081_0088566 | 3300049743 | Bacteria | 2174 |
| 483 | Ga0501081_0747566 | 3300049743 | Bacteria | 735 |
| 484 | Ga0501083_0384832 | 3300049744 | Bacteria | 912 |
| 485 | Ga0501279_020951 | 3300049775 | Bacteria | 932 |
| 486 | Ga0501283_024134 | 3300049779 | Bacteria | 990 |
| 487 | Ga0501283_060895 | 3300049779 | Bacteria | 682 |
| 488 | Ga0501035_0505709 | 3300049822 | Bacteria | 994 |
| 489 | Ga0501044_0396778 | 3300049823 | Bacteria | 1293 |
| 490 | Ga0501045_0018274 | 3300049824 | Bacteria | 4986 |
| 491 | Ga0501045_0518628 | 3300049824 | Bacteria | 885 |
| 492 | nmdc:mga05p37_219245_c1 | 3300050507 | Bacteria | 2296 |
| 493 | nmdc:mga05p37_46362_c1 | 3300050507 | Bacteria | 5345 |
| 494 | nmdc:mga05p37_991921_c1 | 3300050507 | Bacteria | 893 |
| 495 | nmdc:mga09592_1179955_c1 | 3300050508 | Bacteria | 634 |
| 496 | nmdc:mga09592_2325_c1 | 3300050508 | Bacteria | 15340 |
| 497 | nmdc:mga09592_255722_c1 | 3300050508 | Bacteria | 1518 |
| 498 | nmdc:mga09592_57568_c1 | 3300050508 | Bacteria | 3286 |
| 499 | nmdc:mga09592_576209_c1 | 3300050508 | Bacteria | 966 |
| 500 | nmdc:mga09592_979780_c1 | 3300050508 | Bacteria | 708 |
| 501 | nmdc:mga0qj67_1303402_c1 | 3300050509 | Bacteria | 563 |
| 502 | nmdc:mga0qj67_311960_c1 | 3300050509 | Unclassified | 1274 |
| 503 | nmdc:mga0qj67_342752_c1 | 3300050509 | Bacteria | 1209 |
| 504 | nmdc:mga0qj67_443978_c1 | 3300050509 | Bacteria | 1045 |
| 505 | nmdc:mga06r32_1449446_c1 | 3300050510 | Bacteria | 628 |
| 506 | nmdc:mga06r32_28844_c1 | 3300050510 | Bacteria | 5195 |
| 507 | nmdc:mga06r32_726388_c1 | 3300050510 | Bacteria | 958 |
| 508 | nmdc:mga06r32_750982_c1 | 3300050510 | Bacteria | 939 |
| 509 | nmdc:mga06r32_942060_c1 | 3300050510 | Bacteria | 818 |
| 510 | nmdc:mga08y16_1040937_c1 | 3300050511 | Bacteria | 796 |
| 511 | nmdc:mga08y16_1707_c1 | 3300050511 | Bacteria | 22276 |
| 512 | nmdc:mga08y16_32909_c1 | 3300050511 | Bacteria | 5449 |
| 513 | nmdc:mga08y16_97110_c1 | 3300050511 | Bacteria | 3068 |
| 514 | nmdc:mga0n895_148448_c1 | 3300050512 | Bacteria | 2374 |
| 515 | nmdc:mga0n895_282651_c1 | 3300050512 | Bacteria | 1682 |
| 516 | nmdc:mga0n895_333_c1 | 3300050512 | Bacteria | 31507 |
| 517 | nmdc:mga0n895_615667_c1 | 3300050512 | Bacteria | 1087 |
| 518 | nmdc:mga0rr50_218122_c1 | 3300050513 | Bacteria | 1574 |
| 519 | nmdc:mga0rr50_348457_c1 | 3300050513 | Bacteria | 1245 |
| 520 | nmdc:mga0rr50_529407_c1 | 3300050513 | Bacteria | 1003 |
| 521 | nmdc:mga0rr50_569_c1 | 3300050513 | Bacteria | 19810 |
| 522 | nmdc:mga0rr50_774922_c1 | 3300050513 | Bacteria | 819 |
| 523 | nmdc:mga0rr50_77938_c1 | 3300050513 | Bacteria | 2548 |
| 524 | nmdc:mga08x19_1063969_c1 | 3300050514 | Bacteria | 574 |
| 525 | nmdc:mga08x19_1192_c1 | 3300050514 | Bacteria | 16244 |
| 526 | nmdc:mga08x19_196081_c1 | 3300050514 | Bacteria | 1383 |
| 527 | nmdc:mga08x19_28528_c1 | 3300050514 | Bacteria | 3496 |
| 528 | nmdc:mga08x19_990611_c1 | 3300050514 | Bacteria | 597 |
| 529 | nmdc:mga0a205_261260_c1 | 3300050515 | Bacteria | 1609 |
| 530 | nmdc:mga0a205_32720_c1 | 3300050515 | Bacteria | 4985 |
| 531 | nmdc:mga0a205_377382_c1 | 3300050515 | Bacteria | 1283 |
| 532 | nmdc:mga0a205_713731_c1 | 3300050515 | Bacteria | 852 |
| 533 | nmdc:mga0a205_757585_c1 | 3300050515 | Bacteria | 819 |
| 534 | nmdc:mga0a205_880840_c1 | 3300050515 | Bacteria | 742 |
| 535 | Ga0495601_0023412 | 3300053077 | Bacteria | 3794 |
| 536 | Ga0495619_0084370 | 3300053085 | Bacteria | 2144 |
| 537 | Ga0501084_0195116 | 3300054114 | Bacteria | 1708 |
| 538 | Ga0501084_0233717 | 3300054114 | Bacteria | 1552 |
| 539 | Ga0501084_1330324 | 3300054114 | Bacteria | 602 |
| 540 | Ga0501084_1749792 | 3300054114 | Bacteria | 519 |
| 541 | Ga0590071_042090 | 3300059421 | Unclassified | 1100 |
| 542 | Ga0590077_006009 | 3300059426 | Bacteria | 2487 |
| 543 | Ga0501082_0269995 | 3300060353 | Bacteria | 1480 |
| 544 | Ga0501082_0930367 | 3300060353 | Bacteria | 760 |
| 545 | Ga0501082_1121804 | 3300060353 | Bacteria | 687 |
| 546 | Ga0501082_1383089 | 3300060353 | Bacteria | 615 |
| 547 | Ga0530510_0004302 | 3300061734 | Bacteria | 9853 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047318 | Ga0495636_0005309 | Ga0495636_0005309_1311_1592 | 86 |
| 2 | 3300048088 | Ga0495602_0721738 | Ga0495602_0721738_399_665 | 86 |
| 3 | 3300006914 | Ga0075436_100000142 | Ga0075436_10000014229 | 87 |
| 4 | 3300034819 | Ga0373958_0187810 | Ga0373958_0187810_18_296 | 92 |
| 5 | 3300045051 | Ga0451576_0103711 | Ga0451576_0103711_532_831 | 93 |
| 6 | 3300032002 | Ga0307416_100279814 | Ga0307416_1002798142 | 94 |
| 7 | 3300005545 | Ga0070695_100338984 | Ga0070695_1003389842 | 95 |
| 8 | 3300031548 | Ga0307408_102018082 | Ga0307408_1020180822 | 95 |
| 9 | 3300032002 | Ga0307416_101715366 | Ga0307416_1017153662 | 95 |
| 10 | 3300041406 | Ga0439439_0162324 | Ga0439439_0162324_246_542 | 95 |
| 11 | 3300041408 | Ga0439453_0063056 | Ga0439453_0063056_402_698 | 95 |
| 12 | 3300041410 | Ga0439461_0002609 | Ga0439461_0002609_428_724 | 95 |
| 13 | 3300042435 | Ga0439434_0000327 | Ga0439434_0000327_9332_9628 | 95 |
| 14 | 3300042436 | Ga0439435_0000043 | Ga0439435_0000043_5641_5937 | 95 |
| 15 | 3300007265 | Ga0099794_10048506 | Ga0099794_100485062 | 96 |
| 16 | 3300027462 | Ga0210000_1009043 | Ga0210000_10090432 | 96 |
| 17 | 3300005441 | Ga0070700_100163653 | Ga0070700_1001636532 | 97 |
| 18 | 3300005458 | Ga0070681_11733851 | Ga0070681_117338511 | 97 |
| 19 | 3300005459 | Ga0068867_100992492 | Ga0068867_1009924923 | 97 |
| 20 | 3300005577 | Ga0068857_100857972 | Ga0068857_1008579722 | 97 |
| 21 | 3300005615 | Ga0070702_100426614 | Ga0070702_1004266141 | 97 |
| 22 | 3300005719 | Ga0068861_100926822 | Ga0068861_1009268222 | 97 |
| 23 | 3300006844 | Ga0075428_101802543 | Ga0075428_1018025432 | 97 |
| 24 | 3300006852 | Ga0075433_10828727 | Ga0075433_108287272 | 97 |
| 25 | 3300006871 | Ga0075434_100146287 | Ga0075434_1001462873 | 97 |
| 26 | 3300006880 | Ga0075429_100052059 | Ga0075429_1000520594 | 97 |
| 27 | 3300007076 | Ga0075435_100214664 | Ga0075435_1002146643 | 97 |
| 28 | 3300009094 | Ga0111539_10096214 | Ga0111539_100962143 | 97 |
| 29 | 3300009147 | Ga0114129_13097735 | Ga0114129_130977352 | 97 |
| 30 | 3300014326 | Ga0157380_12563027 | Ga0157380_125630271 | 97 |
| 31 | 3300026075 | Ga0207708_10099345 | Ga0207708_100993454 | 97 |
| 32 | 3300026116 | Ga0207674_10783206 | Ga0207674_107832062 | 97 |
| 33 | 3300026118 | Ga0207675_100380909 | Ga0207675_1003809092 | 97 |
| 34 | 3300027360 | Ga0209969_1000935 | Ga0209969_10009352 | 97 |
| 35 | 3300027364 | Ga0209967_1000341 | Ga0209967_10003418 | 97 |
| 36 | 3300027378 | Ga0209981_1003509 | Ga0209981_10035093 | 97 |
| 37 | 3300027395 | Ga0209996_1005558 | Ga0209996_10055583 | 97 |
| 38 | 3300027462 | Ga0210000_1003999 | Ga0210000_10039992 | 97 |
| 39 | 3300027471 | Ga0209995_1012882 | Ga0209995_10128822 | 97 |
| 40 | 3300027526 | Ga0209968_1007688 | Ga0209968_10076882 | 97 |
| 41 | 3300027665 | Ga0209983_1009613 | Ga0209983_10096133 | 97 |
| 42 | 3300027695 | Ga0209966_1005922 | Ga0209966_10059222 | 97 |
| 43 | 3300027907 | Ga0207428_10466492 | Ga0207428_104664922 | 97 |
| 44 | 3300031901 | Ga0307406_10489352 | Ga0307406_104893523 | 97 |
| 45 | 3300035241 | Ga0373961_0356179 | Ga0373961_0356179_68_367 | 97 |
| 46 | 3300049514 | Ga0501291_145365 | Ga0501291_145365_140_436 | 97 |
| 47 | 3300049568 | Ga0501031_0906632 | Ga0501031_0906632_27_323 | 97 |
| 48 | 3300049670 | Ga0501236_143625 | Ga0501236_143625_195_491 | 97 |
| 49 | 3300049775 | Ga0501279_020951 | Ga0501279_020951_340_636 | 97 |
| 50 | 3300049779 | Ga0501283_060895 | Ga0501283_060895_71_367 | 97 |
| 51 | 3300050511 | nmdc:mga08y16_97110_c1 | nmdc:mga08y16_97110_c1_1156_1455 | 97 |
| 52 | 3300050512 | nmdc:mga0n895_148448_c1 | nmdc:mga0n895_148448_c1_499_798 | 97 |
| 53 | 3300050513 | nmdc:mga0rr50_218122_c1 | nmdc:mga0rr50_218122_c1_289_588 | 97 |
| 54 | 3300050515 | nmdc:mga0a205_757585_c1 | nmdc:mga0a205_757585_c1_104_403 | 97 |
| 55 | 3300054114 | Ga0501084_1330324 | Ga0501084_1330324_67_363 | 97 |
| 56 | 3300059421 | Ga0590071_042090 | Ga0590071_042090_118_411 | 97 |
| 57 | 3300059426 | Ga0590077_006009 | Ga0590077_006009_758_1051 | 97 |
| 58 | 3300060353 | Ga0501082_0930367 | Ga0501082_0930367_292_588 | 97 |
| 59 | 3300005334 | Ga0068869_100659656 | Ga0068869_1006596562 | 98 |
| 60 | 3300005336 | Ga0070680_100324222 | Ga0070680_1003242222 | 98 |
| 61 | 3300005340 | Ga0070689_100052957 | Ga0070689_1000529572 | 98 |
| 62 | 3300005340 | Ga0070689_100085539 | Ga0070689_1000855393 | 98 |
| 63 | 3300005340 | Ga0070689_101993857 | Ga0070689_1019938572 | 98 |
| 64 | 3300005341 | Ga0070691_10046647 | Ga0070691_100466473 | 98 |
| 65 | 3300005343 | Ga0070687_100851383 | Ga0070687_1008513832 | 98 |
| 66 | 3300005345 | Ga0070692_10041072 | Ga0070692_100410722 | 98 |
| 67 | 3300005365 | Ga0070688_100057770 | Ga0070688_1000577702 | 98 |
| 68 | 3300005365 | Ga0070688_100396158 | Ga0070688_1003961582 | 98 |
| 69 | 3300005406 | Ga0070703_10046014 | Ga0070703_100460142 | 98 |
| 70 | 3300005406 | Ga0070703_10270622 | Ga0070703_102706222 | 98 |
| 71 | 3300005438 | Ga0070701_10683453 | Ga0070701_106834532 | 98 |
| 72 | 3300005440 | Ga0070705_100312551 | Ga0070705_1003125513 | 98 |
| 73 | 3300005440 | Ga0070705_100993991 | Ga0070705_1009939912 | 98 |
| 74 | 3300005441 | Ga0070700_100103049 | Ga0070700_1001030493 | 98 |
| 75 | 3300005444 | Ga0070694_100004187 | Ga0070694_1000041879 | 98 |
| 76 | 3300005444 | Ga0070694_100124419 | Ga0070694_1001244192 | 98 |
| 77 | 3300005444 | Ga0070694_100404432 | Ga0070694_1004044322 | 98 |
| 78 | 3300005444 | Ga0070694_100526049 | Ga0070694_1005260492 | 98 |
| 79 | 3300005444 | Ga0070694_101334292 | Ga0070694_1013342921 | 98 |
| 80 | 3300005445 | Ga0070708_101410064 | Ga0070708_1014100641 | 98 |
| 81 | 3300005467 | Ga0070706_101343694 | Ga0070706_1013436941 | 98 |
| 82 | 3300005468 | Ga0070707_100060346 | Ga0070707_1000603464 | 98 |
| 83 | 3300005471 | Ga0070698_100214935 | Ga0070698_1002149353 | 98 |
| 84 | 3300005518 | Ga0070699_100341536 | Ga0070699_1003415362 | 98 |
| 85 | 3300005544 | Ga0070686_100621417 | Ga0070686_1006214172 | 98 |
| 86 | 3300005544 | Ga0070686_101384765 | Ga0070686_1013847652 | 98 |
| 87 | 3300005545 | Ga0070695_100010236 | Ga0070695_1000102362 | 98 |
| 88 | 3300005545 | Ga0070695_100038330 | Ga0070695_1000383303 | 98 |
| 89 | 3300005545 | Ga0070695_101352078 | Ga0070695_1013520781 | 98 |
| 90 | 3300005546 | Ga0070696_100007068 | Ga0070696_10000706812 | 98 |
| 91 | 3300005546 | Ga0070696_100058464 | Ga0070696_1000584645 | 98 |
| 92 | 3300005546 | Ga0070696_100069113 | Ga0070696_1000691134 | 98 |
| 93 | 3300005546 | Ga0070696_100277018 | Ga0070696_1002770182 | 98 |
| 94 | 3300005546 | Ga0070696_101654844 | Ga0070696_1016548442 | 98 |
| 95 | 3300005547 | Ga0070693_100325727 | Ga0070693_1003257272 | 98 |
| 96 | 3300005549 | Ga0070704_100038185 | Ga0070704_1000381851 | 98 |
| 97 | 3300005549 | Ga0070704_100038276 | Ga0070704_1000382764 | 98 |
| 98 | 3300005549 | Ga0070704_100056791 | Ga0070704_1000567912 | 98 |
| 99 | 3300005549 | Ga0070704_100549860 | Ga0070704_1005498602 | 98 |
| 100 | 3300005615 | Ga0070702_100217042 | Ga0070702_1002170422 | 98 |
| 101 | 3300005617 | Ga0068859_100496457 | Ga0068859_1004964572 | 98 |
| 102 | 3300005617 | Ga0068859_101347168 | Ga0068859_1013471682 | 98 |
| 103 | 3300005844 | Ga0068862_100209721 | Ga0068862_1002097212 | 98 |
| 104 | 3300005844 | Ga0068862_100631912 | Ga0068862_1006319122 | 98 |
| 105 | 3300006844 | Ga0075428_100101689 | Ga0075428_1001016894 | 98 |
| 106 | 3300006852 | Ga0075433_10269771 | Ga0075433_102697713 | 98 |
| 107 | 3300006852 | Ga0075433_10414417 | Ga0075433_104144173 | 98 |
| 108 | 3300006871 | Ga0075434_100604109 | Ga0075434_1006041093 | 98 |
| 109 | 3300006880 | Ga0075429_100980912 | Ga0075429_1009809122 | 98 |
| 110 | 3300006914 | Ga0075436_100008614 | Ga0075436_1000086146 | 98 |
| 111 | 3300006931 | Ga0097620_100496459 | Ga0097620_1004964592 | 98 |
| 112 | 3300006931 | Ga0097620_101347157 | Ga0097620_1013471572 | 98 |
| 113 | 3300007076 | Ga0075435_100023958 | Ga0075435_1000239587 | 98 |
| 114 | 3300007076 | Ga0075435_100348670 | Ga0075435_1003486702 | 98 |
| 115 | 3300007076 | Ga0075435_100619590 | Ga0075435_1006195902 | 98 |
| 116 | 3300009094 | Ga0111539_11087744 | Ga0111539_110877443 | 98 |
| 117 | 3300009147 | Ga0114129_10337806 | Ga0114129_103378062 | 98 |
| 118 | 3300014326 | Ga0157380_10746265 | Ga0157380_107462651 | 98 |
| 119 | 3300025885 | Ga0207653_10278474 | Ga0207653_102784742 | 98 |
| 120 | 3300025908 | Ga0207643_10562698 | Ga0207643_105626981 | 98 |
| 121 | 3300025910 | Ga0207684_10393779 | Ga0207684_103937791 | 98 |
| 122 | 3300025910 | Ga0207684_10997503 | Ga0207684_109975031 | 98 |
| 123 | 3300025917 | Ga0207660_10571607 | Ga0207660_105716072 | 98 |
| 124 | 3300025918 | Ga0207662_10159138 | Ga0207662_101591382 | 98 |
| 125 | 3300025922 | Ga0207646_11102331 | Ga0207646_111023312 | 98 |
| 126 | 3300025936 | Ga0207670_10204585 | Ga0207670_102045853 | 98 |
| 127 | 3300025936 | Ga0207670_10582027 | Ga0207670_105820272 | 98 |
| 128 | 3300025942 | Ga0207689_10173261 | Ga0207689_101732613 | 98 |
| 129 | 3300025942 | Ga0207689_11352639 | Ga0207689_113526391 | 98 |
| 130 | 3300026075 | Ga0207708_10136212 | Ga0207708_101362123 | 98 |
| 131 | 3300026118 | Ga0207675_101881946 | Ga0207675_1018819462 | 98 |
| 132 | 3300026118 | Ga0207675_102256862 | Ga0207675_1022568622 | 98 |
| 133 | 3300027364 | Ga0209967_1008800 | Ga0209967_10088002 | 98 |
| 134 | 3300027364 | Ga0209967_1063258 | Ga0209967_10632582 | 98 |
| 135 | 3300027378 | Ga0209981_1034749 | Ga0209981_10347492 | 98 |
| 136 | 3300027395 | Ga0209996_1001756 | Ga0209996_10017563 | 98 |
| 137 | 3300027462 | Ga0210000_1013014 | Ga0210000_10130143 | 98 |
| 138 | 3300027526 | Ga0209968_1023725 | Ga0209968_10237252 | 98 |
| 139 | 3300027526 | Ga0209968_1039555 | Ga0209968_10395552 | 98 |
| 140 | 3300027543 | Ga0209999_1053645 | Ga0209999_10536452 | 98 |
| 141 | 3300027665 | Ga0209983_1018474 | Ga0209983_10184742 | 98 |
| 142 | 3300027695 | Ga0209966_1001170 | Ga0209966_10011702 | 98 |
| 143 | 3300028380 | Ga0268265_10226154 | Ga0268265_102261542 | 98 |
| 144 | 3300028380 | Ga0268265_10493241 | Ga0268265_104932413 | 98 |
| 145 | 3300031548 | Ga0307408_100351273 | Ga0307408_1003512732 | 98 |
| 146 | 3300031548 | Ga0307408_100867652 | Ga0307408_1008676522 | 98 |
| 147 | 3300031548 | Ga0307408_101624463 | Ga0307408_1016244632 | 98 |
| 148 | 3300031731 | Ga0307405_10436012 | Ga0307405_104360122 | 98 |
| 149 | 3300031824 | Ga0307413_11750810 | Ga0307413_117508101 | 98 |
| 150 | 3300031901 | Ga0307406_11218519 | Ga0307406_112185192 | 98 |
| 151 | 3300031911 | Ga0307412_10256369 | Ga0307412_102563693 | 98 |
| 152 | 3300031995 | Ga0307409_101162890 | Ga0307409_1011628902 | 98 |
| 153 | 3300032002 | Ga0307416_100234360 | Ga0307416_1002343603 | 98 |
| 154 | 3300032002 | Ga0307416_100887468 | Ga0307416_1008874682 | 98 |
| 155 | 3300035111 | Ga0373923_0046854 | Ga0373923_0046854_1382_1684 | 98 |
| 156 | 3300035112 | Ga0373932_0342170 | Ga0373932_0342170_111_413 | 98 |
| 157 | 3300035113 | Ga0373936_0511581 | Ga0373936_0511581_54_356 | 98 |
| 158 | 3300035172 | Ga0373955_0523840 | Ga0373955_0523840_402_704 | 98 |
| 159 | 3300036401 | Ga0373937_0027675 | Ga0373937_0027675_2986_3288 | 98 |
| 160 | 3300038996 | Ga0242420_041902 | Ga0242420_041902_450_749 | 98 |
| 161 | 3300041408 | Ga0439453_0081833 | Ga0439453_0081833_34_342 | 98 |
| 162 | 3300042001 | Ga0439441_001833 | Ga0439441_001833_743_1039 | 98 |
| 163 | 3300042001 | Ga0439441_020394 | Ga0439441_020394_675_983 | 98 |
| 164 | 3300042126 | Ga0450888_045601 | Ga0450888_045601_25_324 | 98 |
| 165 | 3300042134 | Ga0450898_104048 | Ga0450898_104048_21_317 | 98 |
| 166 | 3300042435 | Ga0439434_0065614 | Ga0439434_0065614_589_897 | 98 |
| 167 | 3300042436 | Ga0439435_0000831 | Ga0439435_0000831_2881_3177 | 98 |
| 168 | 3300042436 | Ga0439435_0042707 | Ga0439435_0042707_152_460 | 98 |
| 169 | 3300042437 | Ga0439444_0000510 | Ga0439444_0000510_2158_2466 | 98 |
| 170 | 3300042437 | Ga0439444_0002926 | Ga0439444_0002926_397_693 | 98 |
| 171 | 3300042461 | Ga0439460_0001357 | Ga0439460_0001357_830_1126 | 98 |
| 172 | 3300042876 | Ga0451577_0436653 | Ga0451577_0436653_519_824 | 98 |
| 173 | 3300045051 | Ga0451576_0111760 | Ga0451576_0111760_1886_2191 | 98 |
| 174 | 3300046454 | Ga0495592_0144972 | Ga0495592_0144972_675_977 | 98 |
| 175 | 3300046463 | Ga0495653_0088878 | Ga0495653_0088878_1900_2202 | 98 |
| 176 | 3300046476 | Ga0495662_0010692 | Ga0495662_0010692_2763_3065 | 98 |
| 177 | 3300046511 | Ga0495608_0004174 | Ga0495608_0004174_8786_9088 | 98 |
| 178 | 3300046514 | Ga0495618_0007803 | Ga0495618_0007803_1358_1660 | 98 |
| 179 | 3300046516 | Ga0495628_0015350 | Ga0495628_0015350_3006_3308 | 98 |
| 180 | 3300046517 | Ga0495630_0053374 | Ga0495630_0053374_1410_1712 | 98 |
| 181 | 3300046526 | Ga0495666_0037729 | Ga0495666_0037729_1039_1341 | 98 |
| 182 | 3300046528 | Ga0495642_0066310 | Ga0495642_0066310_1120_1416 | 98 |
| 183 | 3300046529 | Ga0495652_0400760 | Ga0495652_0400760_140_442 | 98 |
| 184 | 3300046533 | Ga0495640_0006542 | Ga0495640_0006542_2399_2701 | 98 |
| 185 | 3300046535 | Ga0495586_0003090 | Ga0495586_0003090_4325_4627 | 98 |
| 186 | 3300046536 | Ga0495587_0182562 | Ga0495587_0182562_295_597 | 98 |
| 187 | 3300046539 | Ga0495621_0015137 | Ga0495621_0015137_1036_1332 | 98 |
| 188 | 3300046543 | Ga0495645_0043321 | Ga0495645_0043321_2121_2423 | 98 |
| 189 | 3300046559 | Ga0495667_0006793 | Ga0495667_0006793_2816_3118 | 98 |
| 190 | 3300046642 | Ga0495634_0016497 | Ga0495634_0016497_283_585 | 98 |
| 191 | 3300046663 | Ga0495635_0065769 | Ga0495635_0065769_565_867 | 98 |
| 192 | 3300046664 | Ga0495659_0028236 | Ga0495659_0028236_281_577 | 98 |
| 193 | 3300046678 | Ga0495599_0004175 | Ga0495599_0004175_2913_3215 | 98 |
| 194 | 3300046683 | Ga0495658_0046663 | Ga0495658_0046663_196_498 | 98 |
| 195 | 3300046683 | Ga0495658_0982454 | Ga0495658_0982454_88_390 | 98 |
| 196 | 3300046689 | Ga0495613_0008754 | Ga0495613_0008754_4441_4743 | 98 |
| 197 | 3300046690 | Ga0495624_0251646 | Ga0495624_0251646_419_721 | 98 |
| 198 | 3300046809 | Ga0495600_0016281 | Ga0495600_0016281_2024_2326 | 98 |
| 199 | 3300047315 | Ga0495581_0521541 | Ga0495581_0521541_140_442 | 98 |
| 200 | 3300047317 | Ga0495604_0003608 | Ga0495604_0003608_7705_8007 | 98 |
| 201 | 3300047319 | Ga0495674_1077781 | Ga0495674_1077781_19_321 | 98 |
| 202 | 3300047322 | Ga0495680_0004943 | Ga0495680_0004943_9229_9531 | 98 |
| 203 | 3300047447 | Ga0495685_154116 | Ga0495685_154116_412_708 | 98 |
| 204 | 3300047673 | Ga0495593_0054403 | Ga0495593_0054403_1409_1711 | 98 |
| 205 | 3300048089 | Ga0495614_0550505 | Ga0495614_0550505_215_517 | 98 |
| 206 | 3300049514 | Ga0501291_073751 | Ga0501291_073751_152_451 | 98 |
| 207 | 3300049524 | Ga0501301_014980 | Ga0501301_014980_160_459 | 98 |
| 208 | 3300049570 | Ga0501033_0235638 | Ga0501033_0235638_47_343 | 98 |
| 209 | 3300049572 | Ga0501036_0175905 | Ga0501036_0175905_1158_1454 | 98 |
| 210 | 3300049572 | Ga0501036_1181214 | Ga0501036_1181214_146_442 | 98 |
| 211 | 3300049574 | Ga0501038_0163217 | Ga0501038_0163217_882_1178 | 98 |
| 212 | 3300049575 | Ga0501039_0032224 | Ga0501039_0032224_1627_1923 | 98 |
| 213 | 3300049575 | Ga0501039_0074075 | Ga0501039_0074075_2144_2440 | 98 |
| 214 | 3300049575 | Ga0501039_0322384 | Ga0501039_0322384_164_460 | 98 |
| 215 | 3300049575 | Ga0501039_0629093 | Ga0501039_0629093_241_537 | 98 |
| 216 | 3300049576 | Ga0501040_0072651 | Ga0501040_0072651_1421_1717 | 98 |
| 217 | 3300049576 | Ga0501040_0257837 | Ga0501040_0257837_645_941 | 98 |
| 218 | 3300049576 | Ga0501040_0281278 | Ga0501040_0281278_469_765 | 98 |
| 219 | 3300049577 | Ga0501041_0052281 | Ga0501041_0052281_1361_1657 | 98 |
| 220 | 3300049577 | Ga0501041_0753993 | Ga0501041_0753993_124_420 | 98 |
| 221 | 3300049578 | Ga0501042_0078476 | Ga0501042_0078476_313_609 | 98 |
| 222 | 3300049578 | Ga0501042_0373827 | Ga0501042_0373827_666_962 | 98 |
| 223 | 3300049579 | Ga0501043_0073068 | Ga0501043_0073068_1573_1869 | 98 |
| 224 | 3300049579 | Ga0501043_0389956 | Ga0501043_0389956_710_1006 | 98 |
| 225 | 3300049580 | Ga0501046_0247179 | Ga0501046_0247179_882_1178 | 98 |
| 226 | 3300049582 | Ga0501048_0044897 | Ga0501048_0044897_131_427 | 98 |
| 227 | 3300049587 | Ga0501071_0370798 | Ga0501071_0370798_501_797 | 98 |
| 228 | 3300049587 | Ga0501071_0540988 | Ga0501071_0540988_472_768 | 98 |
| 229 | 3300049587 | Ga0501071_0541405 | Ga0501071_0541405_518_820 | 98 |
| 230 | 3300049587 | Ga0501071_0582484 | Ga0501071_0582484_170_472 | 98 |
| 231 | 3300049588 | Ga0501072_0043357 | Ga0501072_0043357_2700_2996 | 98 |
| 232 | 3300049588 | Ga0501072_0233396 | Ga0501072_0233396_528_824 | 98 |
| 233 | 3300049588 | Ga0501072_1343029 | Ga0501072_1343029_149_457 | 98 |
| 234 | 3300049591 | Ga0501075_0023147 | Ga0501075_0023147_57_353 | 98 |
| 235 | 3300049591 | Ga0501075_0050733 | Ga0501075_0050733_2384_2680 | 98 |
| 236 | 3300049591 | Ga0501075_0832096 | Ga0501075_0832096_349_651 | 98 |
| 237 | 3300049591 | Ga0501075_0834800 | Ga0501075_0834800_251_547 | 98 |
| 238 | 3300049592 | Ga0501076_0006798 | Ga0501076_0006798_683_979 | 98 |
| 239 | 3300049592 | Ga0501076_0116029 | Ga0501076_0116029_844_1140 | 98 |
| 240 | 3300049592 | Ga0501076_0529820 | Ga0501076_0529820_283_585 | 98 |
| 241 | 3300049592 | Ga0501076_0855321 | Ga0501076_0855321_123_419 | 98 |
| 242 | 3300049593 | Ga0501077_0022870 | Ga0501077_0022870_1584_1880 | 98 |
| 243 | 3300049593 | Ga0501077_0095478 | Ga0501077_0095478_1420_1716 | 98 |
| 244 | 3300049667 | Ga0501230_112797 | Ga0501230_112797_255_551 | 98 |
| 245 | 3300049741 | Ga0501079_0002756 | Ga0501079_0002756_7037_7333 | 98 |
| 246 | 3300049741 | Ga0501079_0495286 | Ga0501079_0495286_429_725 | 98 |
| 247 | 3300049741 | Ga0501079_0860283 | Ga0501079_0860283_105_401 | 98 |
| 248 | 3300049742 | Ga0501080_0042805 | Ga0501080_0042805_1699_1995 | 98 |
| 249 | 3300049742 | Ga0501080_0550268 | Ga0501080_0550268_151_447 | 98 |
| 250 | 3300049743 | Ga0501081_0031542 | Ga0501081_0031542_1701_1997 | 98 |
| 251 | 3300049743 | Ga0501081_0039707 | Ga0501081_0039707_254_550 | 98 |
| 252 | 3300049743 | Ga0501081_0088566 | Ga0501081_0088566_244_540 | 98 |
| 253 | 3300049743 | Ga0501081_0747566 | Ga0501081_0747566_14_316 | 98 |
| 254 | 3300049744 | Ga0501083_0384832 | Ga0501083_0384832_38_334 | 98 |
| 255 | 3300049779 | Ga0501283_024134 | Ga0501283_024134_511_810 | 98 |
| 256 | 3300049822 | Ga0501035_0505709 | Ga0501035_0505709_337_633 | 98 |
| 257 | 3300049823 | Ga0501044_0396778 | Ga0501044_0396778_914_1210 | 98 |
| 258 | 3300049824 | Ga0501045_0018274 | Ga0501045_0018274_3146_3442 | 98 |
| 259 | 3300049824 | Ga0501045_0518628 | Ga0501045_0518628_368_664 | 98 |
| 260 | 3300050507 | nmdc:mga05p37_219245_c1 | nmdc:mga05p37_219245_c1_488_790 | 98 |
| 261 | 3300050508 | nmdc:mga09592_1179955_c1 | nmdc:mga09592_1179955_c1_145_453 | 98 |
| 262 | 3300050508 | nmdc:mga09592_57568_c1 | nmdc:mga09592_57568_c1_1087_1392 | 98 |
| 263 | 3300050509 | nmdc:mga0qj67_311960_c1 | nmdc:mga0qj67_311960_c1_33_341 | 98 |
| 264 | 3300050509 | nmdc:mga0qj67_342752_c1 | nmdc:mga0qj67_342752_c1_723_1028 | 98 |
| 265 | 3300050510 | nmdc:mga06r32_726388_c1 | nmdc:mga06r32_726388_c1_256_564 | 98 |
| 266 | 3300050511 | nmdc:mga08y16_1040937_c1 | nmdc:mga08y16_1040937_c1_270_575 | 98 |
| 267 | 3300050512 | nmdc:mga0n895_615667_c1 | nmdc:mga0n895_615667_c1_372_674 | 98 |
| 268 | 3300050513 | nmdc:mga0rr50_348457_c1 | nmdc:mga0rr50_348457_c1_279_575 | 98 |
| 269 | 3300050513 | nmdc:mga0rr50_529407_c1 | nmdc:mga0rr50_529407_c1_191_487 | 98 |
| 270 | 3300050513 | nmdc:mga0rr50_774922_c1 | nmdc:mga0rr50_774922_c1_287_589 | 98 |
| 271 | 3300050513 | nmdc:mga0rr50_77938_c1 | nmdc:mga0rr50_77938_c1_1941_2246 | 98 |
| 272 | 3300050514 | nmdc:mga08x19_1063969_c1 | nmdc:mga08x19_1063969_c1_124_420 | 98 |
| 273 | 3300050514 | nmdc:mga08x19_196081_c1 | nmdc:mga08x19_196081_c1_361_657 | 98 |
| 274 | 3300050515 | nmdc:mga0a205_261260_c1 | nmdc:mga0a205_261260_c1_80_382 | 98 |
| 275 | 3300050515 | nmdc:mga0a205_713731_c1 | nmdc:mga0a205_713731_c1_51_347 | 98 |
| 276 | 3300053077 | Ga0495601_0023412 | Ga0495601_0023412_1976_2278 | 98 |
| 277 | 3300053085 | Ga0495619_0084370 | Ga0495619_0084370_1813_2115 | 98 |
| 278 | 3300054114 | Ga0501084_0195116 | Ga0501084_0195116_1379_1675 | 98 |
| 279 | 3300054114 | Ga0501084_0233717 | Ga0501084_0233717_479_775 | 98 |
| 280 | 3300054114 | Ga0501084_1749792 | Ga0501084_1749792_141_437 | 98 |
| 281 | 3300060353 | Ga0501082_0269995 | Ga0501082_0269995_18_314 | 98 |
| 282 | 3300060353 | Ga0501082_1121804 | Ga0501082_1121804_208_504 | 98 |
| 283 | 3300060353 | Ga0501082_1383089 | Ga0501082_1383089_109_405 | 98 |
| 284 | 3300061734 | Ga0530510_0004302 | Ga0530510_0004302_2384_2680 | 98 |
| 285 | 3300002076 | JGI24749J21850_1070434 | JGI24749J21850_10704341 | 99 |
| 286 | 3300005295 | Ga0065707_10004016 | Ga0065707_100040167 | 99 |
| 287 | 3300005295 | Ga0065707_10014317 | Ga0065707_100143172 | 99 |
| 288 | 3300005330 | Ga0070690_100000335 | Ga0070690_1000003357 | 99 |
| 289 | 3300005330 | Ga0070690_100112218 | Ga0070690_1001122182 | 99 |
| 290 | 3300005334 | Ga0068869_100001158 | Ga0068869_1000011587 | 99 |
| 291 | 3300005334 | Ga0068869_101230353 | Ga0068869_1012303531 | 99 |
| 292 | 3300005336 | Ga0070680_100014145 | Ga0070680_1000141452 | 99 |
| 293 | 3300005336 | Ga0070680_100787444 | Ga0070680_1007874442 | 99 |
| 294 | 3300005336 | Ga0070680_101676107 | Ga0070680_1016761071 | 99 |
| 295 | 3300005337 | Ga0070682_100042183 | Ga0070682_1000421833 | 99 |
| 296 | 3300005338 | Ga0068868_100000378 | Ga0068868_1000003787 | 99 |
| 297 | 3300005338 | Ga0068868_102111502 | Ga0068868_1021115021 | 99 |
| 298 | 3300005340 | Ga0070689_100029187 | Ga0070689_1000291873 | 99 |
| 299 | 3300005340 | Ga0070689_100038792 | Ga0070689_1000387926 | 99 |
| 300 | 3300005341 | Ga0070691_10010712 | Ga0070691_100107125 | 99 |
| 301 | 3300005343 | Ga0070687_100000353 | Ga0070687_10000035311 | 99 |
| 302 | 3300005345 | Ga0070692_10003721 | Ga0070692_100037217 | 99 |
| 303 | 3300005345 | Ga0070692_10548474 | Ga0070692_105484742 | 99 |
| 304 | 3300005353 | Ga0070669_100086279 | Ga0070669_1000862792 | 99 |
| 305 | 3300005354 | Ga0070675_100776465 | Ga0070675_1007764652 | 99 |
| 306 | 3300005355 | Ga0070671_100657961 | Ga0070671_1006579612 | 99 |
| 307 | 3300005364 | Ga0070673_100076315 | Ga0070673_1000763155 | 99 |
| 308 | 3300005364 | Ga0070673_100356585 | Ga0070673_1003565853 | 99 |
| 309 | 3300005406 | Ga0070703_10006589 | Ga0070703_100065894 | 99 |
| 310 | 3300005435 | Ga0070714_100515251 | Ga0070714_1005152512 | 99 |
| 311 | 3300005438 | Ga0070701_10000027 | Ga0070701_1000002712 | 99 |
| 312 | 3300005439 | Ga0070711_100230792 | Ga0070711_1002307922 | 99 |
| 313 | 3300005440 | Ga0070705_100000061 | Ga0070705_10000006123 | 99 |
| 314 | 3300005441 | Ga0070700_100000386 | Ga0070700_1000003867 | 99 |
| 315 | 3300005444 | Ga0070694_100000096 | Ga0070694_10000009612 | 99 |
| 316 | 3300005444 | Ga0070694_100064216 | Ga0070694_1000642161 | 99 |
| 317 | 3300005456 | Ga0070678_100339582 | Ga0070678_1003395822 | 99 |
| 318 | 3300005458 | Ga0070681_10032716 | Ga0070681_100327165 | 99 |
| 319 | 3300005459 | Ga0068867_100001399 | Ga0068867_1000013996 | 99 |
| 320 | 3300005471 | Ga0070698_101020568 | Ga0070698_1010205682 | 99 |
| 321 | 3300005518 | Ga0070699_100258895 | Ga0070699_1002588953 | 99 |
| 322 | 3300005518 | Ga0070699_100424320 | Ga0070699_1004243202 | 99 |
| 323 | 3300005530 | Ga0070679_100030156 | Ga0070679_1000301565 | 99 |
| 324 | 3300005536 | Ga0070697_100677716 | Ga0070697_1006777162 | 99 |
| 325 | 3300005539 | Ga0068853_100032789 | Ga0068853_1000327895 | 99 |
| 326 | 3300005539 | Ga0068853_100739161 | Ga0068853_1007391612 | 99 |
| 327 | 3300005544 | Ga0070686_100001578 | Ga0070686_1000015783 | 99 |
| 328 | 3300005545 | Ga0070695_100000965 | Ga0070695_10000096513 | 99 |
| 329 | 3300005546 | Ga0070696_100000560 | Ga0070696_10000056012 | 99 |
| 330 | 3300005546 | Ga0070696_100872946 | Ga0070696_1008729461 | 99 |
| 331 | 3300005547 | Ga0070693_100000003 | Ga0070693_10000000361 | 99 |
| 332 | 3300005547 | Ga0070693_100815156 | Ga0070693_1008151562 | 99 |
| 333 | 3300005549 | Ga0070704_100000504 | Ga0070704_10000050410 | 99 |
| 334 | 3300005563 | Ga0068855_100005492 | Ga0068855_1000054928 | 99 |
| 335 | 3300005578 | Ga0068854_100003450 | Ga0068854_10000345011 | 99 |
| 336 | 3300005614 | Ga0068856_100144011 | Ga0068856_1001440114 | 99 |
| 337 | 3300005614 | Ga0068856_100181533 | Ga0068856_1001815333 | 99 |
| 338 | 3300005615 | Ga0070702_100000004 | Ga0070702_10000000457 | 99 |
| 339 | 3300005616 | Ga0068852_100068470 | Ga0068852_1000684702 | 99 |
| 340 | 3300005616 | Ga0068852_102334300 | Ga0068852_1023343002 | 99 |
| 341 | 3300005617 | Ga0068859_100002292 | Ga0068859_10000229218 | 99 |
| 342 | 3300005617 | Ga0068859_102533112 | Ga0068859_1025331122 | 99 |
| 343 | 3300005618 | Ga0068864_100318573 | Ga0068864_1003185732 | 99 |
| 344 | 3300005718 | Ga0068866_10000342 | Ga0068866_1000034217 | 99 |
| 345 | 3300005719 | Ga0068861_100001170 | Ga0068861_1000011707 | 99 |
| 346 | 3300005840 | Ga0068870_10004636 | Ga0068870_100046364 | 99 |
| 347 | 3300005840 | Ga0068870_10667036 | Ga0068870_106670362 | 99 |
| 348 | 3300005841 | Ga0068863_100255736 | Ga0068863_1002557362 | 99 |
| 349 | 3300005841 | Ga0068863_102309958 | Ga0068863_1023099582 | 99 |
| 350 | 3300005842 | Ga0068858_100002734 | Ga0068858_10000273416 | 99 |
| 351 | 3300005843 | Ga0068860_100002098 | Ga0068860_1000020987 | 99 |
| 352 | 3300005844 | Ga0068862_100001419 | Ga0068862_1000014193 | 99 |
| 353 | 3300005844 | Ga0068862_100223759 | Ga0068862_1002237592 | 99 |
| 354 | 3300006237 | Ga0097621_100000024 | Ga0097621_1000000245 | 99 |
| 355 | 3300006358 | Ga0068871_100002217 | Ga0068871_10000221710 | 99 |
| 356 | 3300006844 | Ga0075428_100004856 | Ga0075428_10000485615 | 99 |
| 357 | 3300006844 | Ga0075428_100552022 | Ga0075428_1005520222 | 99 |
| 358 | 3300006846 | Ga0075430_100000969 | Ga0075430_10000096915 | 99 |
| 359 | 3300006846 | Ga0075430_100260665 | Ga0075430_1002606652 | 99 |
| 360 | 3300006846 | Ga0075430_100333374 | Ga0075430_1003333743 | 99 |
| 361 | 3300006846 | Ga0075430_100725297 | Ga0075430_1007252971 | 99 |
| 362 | 3300006846 | Ga0075430_101355137 | Ga0075430_1013551372 | 99 |
| 363 | 3300006847 | Ga0075431_100152711 | Ga0075431_1001527112 | 99 |
| 364 | 3300006847 | Ga0075431_100215892 | Ga0075431_1002158922 | 99 |
| 365 | 3300006847 | Ga0075431_101950940 | Ga0075431_1019509402 | 99 |
| 366 | 3300006852 | Ga0075433_10030077 | Ga0075433_100300774 | 99 |
| 367 | 3300006852 | Ga0075433_10724170 | Ga0075433_107241702 | 99 |
| 368 | 3300006871 | Ga0075434_100001724 | Ga0075434_10000172417 | 99 |
| 369 | 3300006871 | Ga0075434_100412890 | Ga0075434_1004128903 | 99 |
| 370 | 3300006880 | Ga0075429_100000496 | Ga0075429_1000004966 | 99 |
| 371 | 3300006880 | Ga0075429_100496424 | Ga0075429_1004964242 | 99 |
| 372 | 3300006880 | Ga0075429_100564167 | Ga0075429_1005641672 | 99 |
| 373 | 3300006880 | Ga0075429_101048655 | Ga0075429_1010486552 | 99 |
| 374 | 3300006881 | Ga0068865_100000417 | Ga0068865_1000004176 | 99 |
| 375 | 3300006914 | Ga0075436_100012065 | Ga0075436_1000120653 | 99 |
| 376 | 3300006931 | Ga0097620_100002292 | Ga0097620_10000229218 | 99 |
| 377 | 3300006931 | Ga0097620_102533510 | Ga0097620_1025335102 | 99 |
| 378 | 3300007076 | Ga0075435_100008441 | Ga0075435_1000084416 | 99 |
| 379 | 3300007265 | Ga0099794_10765755 | Ga0099794_107657552 | 99 |
| 380 | 3300009093 | Ga0105240_10289283 | Ga0105240_102892833 | 99 |
| 381 | 3300009094 | Ga0111539_10028668 | Ga0111539_100286686 | 99 |
| 382 | 3300009094 | Ga0111539_11114271 | Ga0111539_111142713 | 99 |
| 383 | 3300009094 | Ga0111539_11193443 | Ga0111539_111934433 | 99 |
| 384 | 3300009094 | Ga0111539_11840597 | Ga0111539_118405972 | 99 |
| 385 | 3300009098 | Ga0105245_10038220 | Ga0105245_100382202 | 99 |
| 386 | 3300009147 | Ga0114129_10001872 | Ga0114129_1000187217 | 99 |
| 387 | 3300009148 | Ga0105243_10000339 | Ga0105243_1000033916 | 99 |
| 388 | 3300009174 | Ga0105241_10015808 | Ga0105241_100158086 | 99 |
| 389 | 3300009176 | Ga0105242_10000346 | Ga0105242_1000034623 | 99 |
| 390 | 3300009177 | Ga0105248_10357117 | Ga0105248_103571172 | 99 |
| 391 | 3300009553 | Ga0105249_10012564 | Ga0105249_100125645 | 99 |
| 392 | 3300010375 | Ga0105239_10433348 | Ga0105239_104333482 | 99 |
| 393 | 3300011119 | Ga0105246_10052088 | Ga0105246_100520885 | 99 |
| 394 | 3300011119 | Ga0105246_10421530 | Ga0105246_104215303 | 99 |
| 395 | 3300013297 | Ga0157378_10000192 | Ga0157378_1000019257 | 99 |
| 396 | 3300013308 | Ga0157375_10350516 | Ga0157375_103505162 | 99 |
| 397 | 3300013308 | Ga0157375_11441174 | Ga0157375_114411742 | 99 |
| 398 | 3300014326 | Ga0157380_10007200 | Ga0157380_100072003 | 99 |
| 399 | 3300014745 | Ga0157377_10170307 | Ga0157377_101703072 | 99 |
| 400 | 3300014745 | Ga0157377_11034594 | Ga0157377_110345942 | 99 |
| 401 | 3300014968 | Ga0157379_11367602 | Ga0157379_113676022 | 99 |
| 402 | 3300014969 | Ga0157376_10021789 | Ga0157376_100217895 | 99 |
| 403 | 3300025885 | Ga0207653_10008181 | Ga0207653_100081813 | 99 |
| 404 | 3300025899 | Ga0207642_10001562 | Ga0207642_100015627 | 99 |
| 405 | 3300025901 | Ga0207688_10034726 | Ga0207688_100347263 | 99 |
| 406 | 3300025903 | Ga0207680_10968270 | Ga0207680_109682702 | 99 |
| 407 | 3300025908 | Ga0207643_10022819 | Ga0207643_100228195 | 99 |
| 408 | 3300025908 | Ga0207643_10584830 | Ga0207643_105848302 | 99 |
| 409 | 3300025911 | Ga0207654_10068769 | Ga0207654_100687693 | 99 |
| 410 | 3300025912 | Ga0207707_10026336 | Ga0207707_100263364 | 99 |
| 411 | 3300025913 | Ga0207695_10908393 | Ga0207695_109083932 | 99 |
| 412 | 3300025916 | Ga0207663_10132078 | Ga0207663_101320783 | 99 |
| 413 | 3300025916 | Ga0207663_10892900 | Ga0207663_108929002 | 99 |
| 414 | 3300025917 | Ga0207660_10006379 | Ga0207660_100063795 | 99 |
| 415 | 3300025918 | Ga0207662_10000653 | Ga0207662_1000065311 | 99 |
| 416 | 3300025921 | Ga0207652_10017093 | Ga0207652_100170935 | 99 |
| 417 | 3300025923 | Ga0207681_10061208 | Ga0207681_100612082 | 99 |
| 418 | 3300025924 | Ga0207694_11688766 | Ga0207694_116887662 | 99 |
| 419 | 3300025926 | Ga0207659_10965981 | Ga0207659_109659812 | 99 |
| 420 | 3300025927 | Ga0207687_10000454 | Ga0207687_100004547 | 99 |
| 421 | 3300025934 | Ga0207686_10000806 | Ga0207686_100008067 | 99 |
| 422 | 3300025935 | Ga0207709_10000297 | Ga0207709_1000029724 | 99 |
| 423 | 3300025936 | Ga0207670_10000590 | Ga0207670_1000059014 | 99 |
| 424 | 3300025936 | Ga0207670_11170261 | Ga0207670_111702612 | 99 |
| 425 | 3300025938 | Ga0207704_10000251 | Ga0207704_100002515 | 99 |
| 426 | 3300025942 | Ga0207689_10000103 | Ga0207689_1000010317 | 99 |
| 427 | 3300025942 | Ga0207689_10639396 | Ga0207689_106393961 | 99 |
| 428 | 3300025949 | Ga0207667_10007221 | Ga0207667_1000722110 | 99 |
| 429 | 3300025949 | Ga0207667_11472842 | Ga0207667_114728421 | 99 |
| 430 | 3300025960 | Ga0207651_10432190 | Ga0207651_104321901 | 99 |
| 431 | 3300025960 | Ga0207651_10783580 | Ga0207651_107835802 | 99 |
| 432 | 3300025961 | Ga0207712_10007693 | Ga0207712_100076937 | 99 |
| 433 | 3300025981 | Ga0207640_10002458 | Ga0207640_1000245811 | 99 |
| 434 | 3300026023 | Ga0207677_10000533 | Ga0207677_1000053311 | 99 |
| 435 | 3300026035 | Ga0207703_10000898 | Ga0207703_1000089819 | 99 |
| 436 | 3300026041 | Ga0207639_10255285 | Ga0207639_102552852 | 99 |
| 437 | 3300026041 | Ga0207639_10935617 | Ga0207639_109356172 | 99 |
| 438 | 3300026075 | Ga0207708_10000048 | Ga0207708_1000004875 | 99 |
| 439 | 3300026078 | Ga0207702_10110494 | Ga0207702_101104943 | 99 |
| 440 | 3300026088 | Ga0207641_10430228 | Ga0207641_104302282 | 99 |
| 441 | 3300026088 | Ga0207641_10709501 | Ga0207641_107095012 | 99 |
| 442 | 3300026088 | Ga0207641_11426660 | Ga0207641_114266601 | 99 |
| 443 | 3300026089 | Ga0207648_10001181 | Ga0207648_1000118117 | 99 |
| 444 | 3300026095 | Ga0207676_10151260 | Ga0207676_101512602 | 99 |
| 445 | 3300026118 | Ga0207675_100000593 | Ga0207675_10000059334 | 99 |
| 446 | 3300026121 | Ga0207683_10296710 | Ga0207683_102967102 | 99 |
| 447 | 3300026142 | Ga0207698_10130723 | Ga0207698_101307234 | 99 |
| 448 | 3300027462 | Ga0210000_1032061 | Ga0210000_10320612 | 99 |
| 449 | 3300027671 | Ga0209588_1158990 | Ga0209588_11589902 | 99 |
| 450 | 3300027907 | Ga0207428_10001315 | Ga0207428_1000131523 | 99 |
| 451 | 3300028380 | Ga0268265_10001097 | Ga0268265_1000109713 | 99 |
| 452 | 3300028381 | Ga0268264_10001229 | Ga0268264_1000122923 | 99 |
| 453 | 3300028381 | Ga0268264_10118907 | Ga0268264_101189073 | 99 |
| 454 | 3300031995 | Ga0307409_102286518 | Ga0307409_1022865181 | 99 |
| 455 | 3300032002 | Ga0307416_101527416 | Ga0307416_1015274162 | 99 |
| 456 | 3300034816 | Ga0373930_0075034 | Ga0373930_0075034_166_465 | 99 |
| 457 | 3300034816 | Ga0373930_0076282 | Ga0373930_0076282_169_468 | 99 |
| 458 | 3300034817 | Ga0373948_0007555 | Ga0373948_0007555_356_655 | 99 |
| 459 | 3300034819 | Ga0373958_0090307 | Ga0373958_0090307_274_573 | 99 |
| 460 | 3300035083 | Ga0373926_0001853 | Ga0373926_0001853_3377_3676 | 99 |
| 461 | 3300035084 | Ga0373928_0218609 | Ga0373928_0218609_95_394 | 99 |
| 462 | 3300035088 | Ga0373940_0006129 | Ga0373940_0006129_2177_2476 | 99 |
| 463 | 3300035088 | Ga0373940_0082640 | Ga0373940_0082640_79_378 | 99 |
| 464 | 3300035089 | Ga0373944_0114925 | Ga0373944_0114925_143_442 | 99 |
| 465 | 3300035112 | Ga0373932_0005675 | Ga0373932_0005675_1987_2286 | 99 |
| 466 | 3300035112 | Ga0373932_0208714 | Ga0373932_0208714_72_371 | 99 |
| 467 | 3300035113 | Ga0373936_0012274 | Ga0373936_0012274_711_1010 | 99 |
| 468 | 3300035114 | Ga0373939_0003338 | Ga0373939_0003338_283_582 | 99 |
| 469 | 3300035115 | Ga0373941_0094607 | Ga0373941_0094607_314_613 | 99 |
| 470 | 3300035115 | Ga0373941_0128249 | Ga0373941_0128249_343_642 | 99 |
| 471 | 3300035116 | Ga0373945_0002027 | Ga0373945_0002027_5384_5683 | 99 |
| 472 | 3300035121 | Ga0373960_0005276 | Ga0373960_0005276_762_1061 | 99 |
| 473 | 3300035121 | Ga0373960_0026206 | Ga0373960_0026206_637_936 | 99 |
| 474 | 3300035170 | Ga0373943_0112843 | Ga0373943_0112843_706_1005 | 99 |
| 475 | 3300035171 | Ga0373946_0027343 | Ga0373946_0027343_575_874 | 99 |
| 476 | 3300035171 | Ga0373946_0032062 | Ga0373946_0032062_1105_1404 | 99 |
| 477 | 3300035207 | Ga0373942_0045506 | Ga0373942_0045506_632_931 | 99 |
| 478 | 3300035207 | Ga0373942_0145007 | Ga0373942_0145007_122_421 | 99 |
| 479 | 3300035242 | Ga0373962_0005654 | Ga0373962_0005654_2347_2646 | 99 |
| 480 | 3300035410 | Ga0373924_0078045 | Ga0373924_0078045_203_502 | 99 |
| 481 | 3300035691 | Ga0373931_0001701 | Ga0373931_0001701_1882_2181 | 99 |
| 482 | 3300035691 | Ga0373931_0005942 | Ga0373931_0005942_5027_5326 | 99 |
| 483 | 3300035691 | Ga0373931_0251719 | Ga0373931_0251719_134_433 | 99 |
| 484 | 3300035691 | Ga0373931_0309791 | Ga0373931_0309791_246_545 | 99 |
| 485 | 3300035692 | Ga0373935_0037106 | Ga0373935_0037106_1642_1941 | 99 |
| 486 | 3300035695 | Ga0373927_0224957 | Ga0373927_0224957_331_630 | 99 |
| 487 | 3300035725 | Ga0373947_0151792 | Ga0373947_0151792_647_946 | 99 |
| 488 | 3300037068 | Ga0373925_0140207 | Ga0373925_0140207_860_1159 | 99 |
| 489 | 3300037068 | Ga0373925_0227750 | Ga0373925_0227750_331_630 | 99 |
| 490 | 3300041413 | Ga0439465_0210171 | Ga0439465_0210171_148_447 | 99 |
| 491 | 3300044673 | Ga0453683_0241345 | Ga0453683_0241345_614_913 | 99 |
| 492 | 3300044712 | Ga0453684_0419155 | Ga0453684_0419155_367_666 | 99 |
| 493 | 3300045051 | Ga0451576_0007423 | Ga0451576_0007423_12181_12480 | 99 |
| 494 | 3300045051 | Ga0451576_0094232 | Ga0451576_0094232_456_755 | 99 |
| 495 | 3300045051 | Ga0451576_0859020 | Ga0451576_0859020_530_829 | 99 |
| 496 | 3300046472 | Ga0495580_0064097 | Ga0495580_0064097_2106_2405 | 99 |
| 497 | 3300046473 | Ga0495582_0030860 | Ga0495582_0030860_1800_2099 | 99 |
| 498 | 3300046475 | Ga0495639_0024781 | Ga0495639_0024781_1755_2054 | 99 |
| 499 | 3300046517 | Ga0495630_0229142 | Ga0495630_0229142_184_483 | 99 |
| 500 | 3300046523 | Ga0495644_0158588 | Ga0495644_0158588_368_667 | 99 |
| 501 | 3300046531 | Ga0495665_0025372 | Ga0495665_0025372_1885_2184 | 99 |
| 502 | 3300046535 | Ga0495586_0001122 | Ga0495586_0001122_2603_2902 | 99 |
| 503 | 3300046615 | Ga0495656_0016860 | Ga0495656_0016860_1526_1825 | 99 |
| 504 | 3300046664 | Ga0495659_0156507 | Ga0495659_0156507_241_543 | 99 |
| 505 | 3300046683 | Ga0495658_0002217 | Ga0495658_0002217_2393_2692 | 99 |
| 506 | 3300046683 | Ga0495658_0328829 | Ga0495658_0328829_618_923 | 99 |
| 507 | 3300047318 | Ga0495636_0160047 | Ga0495636_0160047_405_704 | 99 |
| 508 | 3300048917 | Ga0496114_0244555 | Ga0496114_0244555_685_984 | 99 |
| 509 | 3300049521 | Ga0501298_032279 | Ga0501298_032279_238_549 | 99 |
| 510 | 3300049568 | Ga0501031_0335901 | Ga0501031_0335901_558_869 | 99 |
| 511 | 3300049572 | Ga0501036_0109864 | Ga0501036_0109864_260_571 | 99 |
| 512 | 3300049574 | Ga0501038_0390191 | Ga0501038_0390191_641_952 | 99 |
| 513 | 3300049575 | Ga0501039_0096349 | Ga0501039_0096349_951_1262 | 99 |
| 514 | 3300049575 | Ga0501039_0236417 | Ga0501039_0236417_1015_1323 | 99 |
| 515 | 3300049576 | Ga0501040_0309663 | Ga0501040_0309663_482_790 | 99 |
| 516 | 3300049576 | Ga0501040_0771604 | Ga0501040_0771604_191_502 | 99 |
| 517 | 3300049577 | Ga0501041_0783338 | Ga0501041_0783338_266_577 | 99 |
| 518 | 3300049578 | Ga0501042_0597798 | Ga0501042_0597798_255_563 | 99 |
| 519 | 3300049579 | Ga0501043_0365420 | Ga0501043_0365420_531_842 | 99 |
| 520 | 3300049582 | Ga0501048_0214866 | Ga0501048_0214866_869_1180 | 99 |
| 521 | 3300049588 | Ga0501072_0053110 | Ga0501072_0053110_485_793 | 99 |
| 522 | 3300049588 | Ga0501072_0175799 | Ga0501072_0175799_1192_1491 | 99 |
| 523 | 3300049588 | Ga0501072_0916982 | Ga0501072_0916982_132_431 | 99 |
| 524 | 3300049592 | Ga0501076_0357659 | Ga0501076_0357659_161_469 | 99 |
| 525 | 3300050507 | nmdc:mga05p37_46362_c1 | nmdc:mga05p37_46362_c1_5011_5310 | 99 |
| 526 | 3300050507 | nmdc:mga05p37_991921_c1 | nmdc:mga05p37_991921_c1_517_816 | 99 |
| 527 | 3300050508 | nmdc:mga09592_2325_c1 | nmdc:mga09592_2325_c1_15031_15330 | 99 |
| 528 | 3300050508 | nmdc:mga09592_255722_c1 | nmdc:mga09592_255722_c1_317_616 | 99 |
| 529 | 3300050508 | nmdc:mga09592_576209_c1 | nmdc:mga09592_576209_c1_556_855 | 99 |
| 530 | 3300050508 | nmdc:mga09592_979780_c1 | nmdc:mga09592_979780_c1_302_601 | 99 |
| 531 | 3300050509 | nmdc:mga0qj67_1303402_c1 | nmdc:mga0qj67_1303402_c1_239_538 | 99 |
| 532 | 3300050509 | nmdc:mga0qj67_443978_c1 | nmdc:mga0qj67_443978_c1_46_345 | 99 |
| 533 | 3300050510 | nmdc:mga06r32_1449446_c1 | nmdc:mga06r32_1449446_c1_255_554 | 99 |
| 534 | 3300050510 | nmdc:mga06r32_28844_c1 | nmdc:mga06r32_28844_c1_4573_4872 | 99 |
| 535 | 3300050510 | nmdc:mga06r32_750982_c1 | nmdc:mga06r32_750982_c1_129_428 | 99 |
| 536 | 3300050510 | nmdc:mga06r32_942060_c1 | nmdc:mga06r32_942060_c1_462_761 | 99 |
| 537 | 3300050511 | nmdc:mga08y16_1707_c1 | nmdc:mga08y16_1707_c1_5710_6009 | 99 |
| 538 | 3300050511 | nmdc:mga08y16_32909_c1 | nmdc:mga08y16_32909_c1_1062_1361 | 99 |
| 539 | 3300050512 | nmdc:mga0n895_282651_c1 | nmdc:mga0n895_282651_c1_274_573 | 99 |
| 540 | 3300050512 | nmdc:mga0n895_333_c1 | nmdc:mga0n895_333_c1_21205_21504 | 99 |
| 541 | 3300050513 | nmdc:mga0rr50_569_c1 | nmdc:mga0rr50_569_c1_15148_15447 | 99 |
| 542 | 3300050514 | nmdc:mga08x19_1192_c1 | nmdc:mga08x19_1192_c1_1342_1641 | 99 |
| 543 | 3300050514 | nmdc:mga08x19_28528_c1 | nmdc:mga08x19_28528_c1_398_697 | 99 |
| 544 | 3300050514 | nmdc:mga08x19_990611_c1 | nmdc:mga08x19_990611_c1_210_512 | 99 |
| 545 | 3300050515 | nmdc:mga0a205_32720_c1 | nmdc:mga0a205_32720_c1_3670_3969 | 99 |
| 546 | 3300050515 | nmdc:mga0a205_377382_c1 | nmdc:mga0a205_377382_c1_501_800 | 99 |
| 547 | 3300050515 | nmdc:mga0a205_880840_c1 | nmdc:mga0a205_880840_c1_51_350 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mnr-assembly1.cif.gz_B | crystal structure of the znf3 of nucleoporin nup358/ranbp2 in complex with ran-gdp | 0.9514 | 74 | 98 |
| 7mnv-assembly1.cif.gz_B | crystal structure of the znf8 of nucleoporin nup358/ranbp2 in complex with ran-gdp | 0.9468 | 74 | 98 |
| 3gj8-assembly1.cif.gz_B | crystal structure of human rangdp-nup153znf34 complex | 0.9453 | 73 | 98 |
| 3gj5-assembly2.cif.gz_D | crystal structure of human rangdp-nup153znf4 complex | 0.933 | 73 | 97 |
| 3gj4-assembly1.cif.gz_B | crystal structure of human rangdp-nup153znf3 complex | 0.9264 | 73 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55EN0_237_398_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.913 | 73 | 98 | 3.30.70.330 |
| af_P09391_1_67_3.30.70.2350 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8915 | 1 | 66 | 3.30.70.2350 |
| af_Q4DHR8_1_892_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.8761 | 74 | 98 | 1.25.10.10 |
| 1yj7B01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 | 0.8526 | 1 | 66 | 3.30.70.1530 |
| af_Q4DTI5_457_613_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8155 | 76 | 97 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2AEB9-F1-model_v4 | DUF2007 domain-containing protein | 0.8837 | 2 | 66 |
|
| AF-A0A2H6AB27-F1-model_v4 | DUF2007 domain-containing protein | 0.8722 | 3 | 66 |
|
| AF-A0A829YHJ1-F1-model_v4 | DUF2007 domain-containing protein | 0.8704 | 1 | 66 |
|
| AF-A0A7C5C5T0-F1-model_v4 | DUF2007 domain-containing protein | 0.8679 | 3 | 66 |
|
| AF-A0A2E0E796-F1-model_v4 | deleted | 0.858 | 1 | 66 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar