F462087
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 547 | 340 | 505 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10152029|Ga0105240_101520292 |
| Length | 369 |
| Sequence | MVPAAEKKGLPSMDTAGEDNEQAGIRPEGAHSMPPALAVDRQAPDRNLALELVRVTEAAAMAAARWVGRGDKNGGDGAAVDAMRKLIGTVSMDGVVVIGEGEKDQAPMLYNGERVGDGTGPECDVAVDPIDGTTLMAKGMPNAIAVIAVAERGSMFDPSAVFYMEKIATGPEAADVIDITAPVQTNIQRVAKAKGGRPEDVTVVILDRPRHAELVSEVRAAGARIKFISDGDVAGAIMAARDGTGVDLLVGIGGTPEGIIAASAIACLGGTIQGRLWPRSPEEREKAEAAGHDLSRVLTTKDLVSGEDVFFCATGVTDGELLSGVRYDRSGLRTSSIVMRSKSGTIRMVDSLHQLSKLRAYASVDFDRN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 2 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 3 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 4 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 5 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 6 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 7 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 8 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 9 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 10 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 11 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 12 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 13 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 14 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 15 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 16 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 17 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 18 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 19 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 20 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 21 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 22 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 23 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 24 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 25 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 26 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 27 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 28 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 29 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 30 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 31 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 32 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 33 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 34 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 35 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 167 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 168 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 171 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 172 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 173 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 182 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 185 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 187 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 193 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 194 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 195 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 196 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 199 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 202 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 203 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 204 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 209 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 210 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 211 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 212 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 213 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 270 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 271 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 274 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 300 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 307 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 318 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 319 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 321 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 322 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 323 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 324 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 326 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 327 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 328 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 329 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 330 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 333 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 334 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 335 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 336 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 337 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 338 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 339 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 340 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.32 |
| Metatranscriptomes | 0 |
| Isolates | 7.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.37 |
| Bulb | 0 |
| Endosphere | 2.74 |
| Nodule | 0 |
| Rhizoplane | 4.94 |
| Rhizosphere | 82.45 |
| Stem | 0 |
| Stem Tuber | 0.18 |
| Unclassified | 9.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10002571 | 3300005327 | Bacteria | 15122 |
| 2 | Ga0070658_10004179 | 3300005327 | Bacteria | 11813 |
| 3 | Ga0070658_10043928 | 3300005327 | Bacteria | 3611 |
| 4 | Ga0070658_10095301 | 3300005327 | Bacteria | 2457 |
| 5 | Ga0070658_10210592 | 3300005327 | Bacteria | 1642 |
| 6 | Ga0070658_10211907 | 3300005327 | Bacteria | 1637 |
| 7 | Ga0070683_100027111 | 3300005329 | Bacteria | 5165 |
| 8 | Ga0070666_10035831 | 3300005335 | Bacteria | 3290 |
| 9 | Ga0070680_100063810 | 3300005336 | Bacteria | 3018 |
| 10 | Ga0070680_100191285 | 3300005336 | Bacteria | 1724 |
| 11 | Ga0070682_100020716 | 3300005337 | Bacteria | 3873 |
| 12 | Ga0070682_100125164 | 3300005337 | Bacteria | 1731 |
| 13 | Ga0068868_100021122 | 3300005338 | Bacteria | 4902 |
| 14 | Ga0068868_100111841 | 3300005338 | Bacteria | 2220 |
| 15 | Ga0070660_100305612 | 3300005339 | Bacteria | 1304 |
| 16 | Ga0070661_100145773 | 3300005344 | Bacteria | 1787 |
| 17 | Ga0070668_100007434 | 3300005347 | Bacteria | 8130 |
| 18 | Ga0070668_100142944 | 3300005347 | Bacteria | 1930 |
| 19 | Ga0070669_100129871 | 3300005353 | Bacteria | 1932 |
| 20 | Ga0070674_100057908 | 3300005356 | Bacteria | 2692 |
| 21 | Ga0070659_100005120 | 3300005366 | Bacteria | 9404 |
| 22 | Ga0070659_100312283 | 3300005366 | Bacteria | 1313 |
| 23 | Ga0070667_100015311 | 3300005367 | Bacteria | 6339 |
| 24 | Ga0070709_10132920 | 3300005434 | Bacteria | 1700 |
| 25 | Ga0070714_100000100 | 3300005435 | Bacteria | 73241 |
| 26 | Ga0070714_100022840 | 3300005435 | Bacteria | 5133 |
| 27 | Ga0070713_100133198 | 3300005436 | Bacteria | 2194 |
| 28 | Ga0070711_100010472 | 3300005439 | Bacteria | 5741 |
| 29 | Ga0070700_100000071 | 3300005441 | Bacteria | 72381 |
| 30 | Ga0070708_100381961 | 3300005445 | Bacteria | 1328 |
| 31 | Ga0070663_100310982 | 3300005455 | Bacteria | 1264 |
| 32 | Ga0070678_100067491 | 3300005456 | Bacteria | 2662 |
| 33 | Ga0070678_100347807 | 3300005456 | Bacteria | 1274 |
| 34 | Ga0070662_100305433 | 3300005457 | Bacteria | 1294 |
| 35 | Ga0070685_10036277 | 3300005466 | Bacteria | 2786 |
| 36 | Ga0070679_100011314 | 3300005530 | Bacteria | 8507 |
| 37 | Ga0070697_100117400 | 3300005536 | Bacteria | 2223 |
| 38 | Ga0070693_100006384 | 3300005547 | Bacteria | 5715 |
| 39 | Ga0070665_100006227 | 3300005548 | Bacteria | 12207 |
| 40 | Ga0070665_100010691 | 3300005548 | Bacteria | 9292 |
| 41 | Ga0070665_100070179 | 3300005548 | Bacteria | 3510 |
| 42 | Ga0070704_100033825 | 3300005549 | Bacteria | 3460 |
| 43 | Ga0068855_100010594 | 3300005563 | Bacteria | 11114 |
| 44 | Ga0068855_100031317 | 3300005563 | Bacteria | 6352 |
| 45 | Ga0068857_100000575 | 3300005577 | Bacteria | 26864 |
| 46 | Ga0068854_100089607 | 3300005578 | Bacteria | 2286 |
| 47 | Ga0068856_100221286 | 3300005614 | Bacteria | 1908 |
| 48 | Ga0068852_100197544 | 3300005616 | Bacteria | 1902 |
| 49 | Ga0068852_100231975 | 3300005616 | Bacteria | 1760 |
| 50 | Ga0068859_100119189 | 3300005617 | Bacteria | 2705 |
| 51 | Ga0068859_100135758 | 3300005617 | Bacteria | 2533 |
| 52 | Ga0068866_10001329 | 3300005718 | Bacteria | 10701 |
| 53 | Ga0068866_10203781 | 3300005718 | Bacteria | 1184 |
| 54 | Ga0068861_100004889 | 3300005719 | Bacteria | 9020 |
| 55 | Ga0068870_10015215 | 3300005840 | Bacteria | 3647 |
| 56 | Ga0068863_100000501 | 3300005841 | Bacteria | 39833 |
| 57 | Ga0068858_100042548 | 3300005842 | Bacteria | 4212 |
| 58 | Ga0068860_100000646 | 3300005843 | Bacteria | 40734 |
| 59 | Ga0068860_100013199 | 3300005843 | Bacteria | 8107 |
| 60 | Ga0068860_100070952 | 3300005843 | Bacteria | 3311 |
| 61 | Ga0068862_100032239 | 3300005844 | Bacteria | 4427 |
| 62 | Ga0081455_10006760 | 3300005937 | Bacteria | 12236 |
| 63 | Ga0081455_10020972 | 3300005937 | Bacteria | 6140 |
| 64 | Ga0081455_10045134 | 3300005937 | Bacteria | 3837 |
| 65 | Ga0081455_10061842 | 3300005937 | Bacteria | 3149 |
| 66 | Ga0081539_10022222 | 3300005985 | Bacteria | 4204 |
| 67 | Ga0070717_10186315 | 3300006028 | Bacteria | 1811 |
| 68 | Ga0075363_100022234 | 3300006048 | Bacteria | 3205 |
| 69 | Ga0075432_10046768 | 3300006058 | Bacteria | 1520 |
| 70 | Ga0075432_10072543 | 3300006058 | Bacteria | 1238 |
| 71 | Ga0070712_100021057 | 3300006175 | Bacteria | 4275 |
| 72 | Ga0097621_100048487 | 3300006237 | Bacteria | 3446 |
| 73 | Ga0068871_100291378 | 3300006358 | Bacteria | 1430 |
| 74 | Ga0075428_100020659 | 3300006844 | Bacteria | 7291 |
| 75 | Ga0075428_100178561 | 3300006844 | Bacteria | 2299 |
| 76 | Ga0075430_100013331 | 3300006846 | Bacteria | 7005 |
| 77 | Ga0075430_100041631 | 3300006846 | Bacteria | 3886 |
| 78 | Ga0075431_100068276 | 3300006847 | Bacteria | 3668 |
| 79 | Ga0075433_10028251 | 3300006852 | Bacteria | 4767 |
| 80 | Ga0075434_100021172 | 3300006871 | Bacteria | 6319 |
| 81 | Ga0075434_100145556 | 3300006871 | Bacteria | 2390 |
| 82 | Ga0075429_100010493 | 3300006880 | Bacteria | 8011 |
| 83 | Ga0075429_100023706 | 3300006880 | Bacteria | 5325 |
| 84 | Ga0068865_100093373 | 3300006881 | Bacteria | 2188 |
| 85 | Ga0068865_100119861 | 3300006881 | Bacteria | 1954 |
| 86 | Ga0075436_100007844 | 3300006914 | Bacteria | 7302 |
| 87 | Ga0097620_100119184 | 3300006931 | Bacteria | 2705 |
| 88 | Ga0097620_100135758 | 3300006931 | Bacteria | 2533 |
| 89 | Ga0105240_10083203 | 3300009093 | Bacteria | 3928 |
| 90 | Ga0105240_10108746 | 3300009093 | Bacteria | 3359 |
| 91 | Ga0105240_10152029 | 3300009093 | Bacteria | 2756 |
| 92 | Ga0105240_10213225 | 3300009093 | Bacteria | 2255 |
| 93 | Ga0111539_10005889 | 3300009094 | Bacteria | 15836 |
| 94 | Ga0111539_10069242 | 3300009094 | Bacteria | 4166 |
| 95 | Ga0111539_10463350 | 3300009094 | Bacteria | 1476 |
| 96 | Ga0105245_10037246 | 3300009098 | Bacteria | 4325 |
| 97 | Ga0105245_10050607 | 3300009098 | Bacteria | 3724 |
| 98 | Ga0105245_10230421 | 3300009098 | Bacteria | 1791 |
| 99 | Ga0105245_10238972 | 3300009098 | Bacteria | 1760 |
| 100 | Ga0105247_10010785 | 3300009101 | Bacteria | 5518 |
| 101 | Ga0114129_10000001 | 3300009147 | Bacteria | 292978 |
| 102 | Ga0114129_10000011 | 3300009147 | Bacteria | 139000 |
| 103 | Ga0114129_10022337 | 3300009147 | Bacteria | 8980 |
| 104 | Ga0105243_10059524 | 3300009148 | Bacteria | 3049 |
| 105 | Ga0105242_10007893 | 3300009176 | Bacteria | 8190 |
| 106 | Ga0105248_10017673 | 3300009177 | Bacteria | 7865 |
| 107 | Ga0105237_10098867 | 3300009545 | Bacteria | 2909 |
| 108 | Ga0105238_10034972 | 3300009551 | Bacteria | 5111 |
| 109 | Ga0105238_10200268 | 3300009551 | Bacteria | 1972 |
| 110 | Ga0105249_10009542 | 3300009553 | Bacteria | 8503 |
| 111 | Ga0105035_100397 | 3300009988 | Bacteria | 2708 |
| 112 | Ga0105239_10038959 | 3300010375 | Bacteria | 5206 |
| 113 | Ga0105246_10101774 | 3300011119 | Bacteria | 2093 |
| 114 | Ga0105246_10131361 | 3300011119 | Bacteria | 1871 |
| 115 | Ga0157371_10032061 | 3300013102 | Bacteria | 3782 |
| 116 | Ga0157370_10010773 | 3300013104 | Bacteria | 9612 |
| 117 | Ga0157370_10054518 | 3300013104 | Bacteria | 3811 |
| 118 | Ga0157369_10060752 | 3300013105 | Bacteria | 4075 |
| 119 | Ga0157369_10140464 | 3300013105 | Bacteria | 2556 |
| 120 | Ga0157374_10083843 | 3300013296 | Bacteria | 3028 |
| 121 | Ga0157374_10245445 | 3300013296 | Bacteria | 1761 |
| 122 | Ga0157378_10035336 | 3300013297 | Bacteria | 4419 |
| 123 | Ga0157378_10121661 | 3300013297 | Bacteria | 2406 |
| 124 | Ga0163162_10011592 | 3300013306 | Bacteria | 8597 |
| 125 | Ga0157372_10001746 | 3300013307 | Bacteria | 23569 |
| 126 | Ga0157372_10029416 | 3300013307 | Bacteria | 5998 |
| 127 | Ga0157375_10067938 | 3300013308 | Bacteria | 3563 |
| 128 | Ga0157375_10576354 | 3300013308 | Bacteria | 1286 |
| 129 | Ga0157380_10017791 | 3300014326 | Bacteria | 5266 |
| 130 | Ga0182008_10011923 | 3300014497 | Bacteria | 4607 |
| 131 | Ga0182008_10072794 | 3300014497 | Bacteria | 1691 |
| 132 | Ga0157379_10005138 | 3300014968 | Bacteria | 11230 |
| 133 | Ga0157376_10146413 | 3300014969 | Bacteria | 2125 |
| 134 | Ga0157376_10266690 | 3300014969 | Bacteria | 1607 |
| 135 | Ga0163161_10002295 | 3300017792 | Bacteria | 13711 |
| 136 | Ga0213873_10000055 | 3300021358 | Bacteria | 25297 |
| 137 | Ga0213876_10045684 | 3300021384 | Bacteria | 2316 |
| 138 | Ga0213875_10005541 | 3300021388 | Bacteria | 6762 |
| 139 | Ga0213875_10062007 | 3300021388 | Bacteria | 1749 |
| 140 | Ga0207696_1017156 | 3300025711 | Bacteria | 2404 |
| 141 | Ga0207688_10000941 | 3300025901 | Bacteria | 14730 |
| 142 | Ga0207680_10002698 | 3300025903 | Bacteria | 8292 |
| 143 | Ga0207680_10102740 | 3300025903 | Bacteria | 1839 |
| 144 | Ga0207647_10093262 | 3300025904 | Bacteria | 1794 |
| 145 | Ga0207647_10131174 | 3300025904 | Bacteria | 1473 |
| 146 | Ga0207699_10009414 | 3300025906 | Bacteria | 4863 |
| 147 | Ga0207705_10033923 | 3300025909 | Bacteria | 3647 |
| 148 | Ga0207705_10235076 | 3300025909 | Bacteria | 1395 |
| 149 | Ga0207705_10241395 | 3300025909 | Bacteria | 1376 |
| 150 | Ga0207654_10212842 | 3300025911 | Bacteria | 1278 |
| 151 | Ga0207707_10307067 | 3300025912 | Bacteria | 1371 |
| 152 | Ga0207695_10160220 | 3300025913 | Bacteria | 2182 |
| 153 | Ga0207671_10279785 | 3300025914 | Bacteria | 1316 |
| 154 | Ga0207693_10001318 | 3300025915 | Bacteria | 21993 |
| 155 | Ga0207693_10108088 | 3300025915 | Bacteria | 2182 |
| 156 | Ga0207663_10016373 | 3300025916 | Bacteria | 4110 |
| 157 | Ga0207662_10104077 | 3300025918 | Bacteria | 1762 |
| 158 | Ga0207662_10253670 | 3300025918 | Bacteria | 1155 |
| 159 | Ga0207657_10009491 | 3300025919 | Bacteria | 9775 |
| 160 | Ga0207681_10146869 | 3300025923 | Bacteria | 1763 |
| 161 | Ga0207687_10087823 | 3300025927 | Bacteria | 2260 |
| 162 | Ga0207664_10000002 | 3300025929 | Bacteria | 657053 |
| 163 | Ga0207664_10138935 | 3300025929 | Bacteria | 2053 |
| 164 | Ga0207690_10027443 | 3300025932 | Bacteria | 3598 |
| 165 | Ga0207690_10136024 | 3300025932 | Bacteria | 1804 |
| 166 | Ga0207706_10181755 | 3300025933 | Bacteria | 1847 |
| 167 | Ga0207686_10195976 | 3300025934 | Bacteria | 1443 |
| 168 | Ga0207670_10264501 | 3300025936 | Bacteria | 1335 |
| 169 | Ga0207669_10370601 | 3300025937 | Bacteria | 1113 |
| 170 | Ga0207704_10145105 | 3300025938 | Bacteria | 1666 |
| 171 | Ga0207665_10003129 | 3300025939 | Bacteria | 11102 |
| 172 | Ga0207689_10009079 | 3300025942 | Bacteria | 8608 |
| 173 | Ga0207689_10061934 | 3300025942 | Bacteria | 3077 |
| 174 | Ga0207661_10039494 | 3300025944 | Bacteria | 3704 |
| 175 | Ga0207667_10036970 | 3300025949 | Bacteria | 5225 |
| 176 | Ga0207667_10463829 | 3300025949 | Bacteria | 1286 |
| 177 | Ga0207668_10008237 | 3300025972 | Bacteria | 6212 |
| 178 | Ga0207658_10043005 | 3300025986 | Bacteria | 3282 |
| 179 | Ga0207677_10033194 | 3300026023 | Bacteria | 3327 |
| 180 | Ga0207703_10032291 | 3300026035 | Bacteria | 4143 |
| 181 | Ga0207678_10088391 | 3300026067 | Bacteria | 2648 |
| 182 | Ga0207708_10000029 | 3300026075 | Bacteria | 161861 |
| 183 | Ga0207641_10014067 | 3300026088 | Bacteria | 6560 |
| 184 | Ga0207641_10110399 | 3300026088 | Bacteria | 2437 |
| 185 | Ga0207648_10251056 | 3300026089 | Bacteria | 1577 |
| 186 | Ga0207674_10001857 | 3300026116 | Bacteria | 26899 |
| 187 | Ga0207674_10098646 | 3300026116 | Bacteria | 2904 |
| 188 | Ga0207675_100032684 | 3300026118 | Bacteria | 4846 |
| 189 | Ga0207683_10004078 | 3300026121 | Bacteria | 12620 |
| 190 | Ga0207683_10077668 | 3300026121 | Bacteria | 2941 |
| 191 | Ga0207683_10115631 | 3300026121 | Bacteria | 2405 |
| 192 | Ga0207428_10014718 | 3300027907 | Bacteria | 6779 |
| 193 | Ga0207428_10022540 | 3300027907 | Bacteria | 5312 |
| 194 | Ga0268266_10027110 | 3300028379 | Bacteria | 4874 |
| 195 | Ga0268266_10119390 | 3300028379 | Bacteria | 2345 |
| 196 | Ga0268266_10214873 | 3300028379 | Bacteria | 1765 |
| 197 | Ga0268264_10000530 | 3300028381 | Bacteria | 48308 |
| 198 | Ga0268264_10009405 | 3300028381 | Bacteria | 8092 |
| 199 | Ga0307515_10000088 | 3300028794 | Bacteria | 215810 |
| 200 | Ga0307515_10005747 | 3300028794 | Bacteria | 25062 |
| 201 | Ga0307515_10020175 | 3300028794 | Bacteria | 11915 |
| 202 | Ga0307512_10016907 | 3300030522 | Bacteria | 6716 |
| 203 | Ga0316181_1044065 | 3300030744 | Bacteria | 1596 |
| 204 | Ga0307509_10091925 | 3300031507 | Bacteria | 3104 |
| 205 | Ga0307408_100154686 | 3300031548 | Bacteria | 1814 |
| 206 | Ga0307508_10053527 | 3300031616 | Bacteria | 3581 |
| 207 | Ga0307508_10130730 | 3300031616 | Bacteria | 2114 |
| 208 | Ga0307508_10143073 | 3300031616 | Bacteria | 1995 |
| 209 | Ga0307508_10244765 | 3300031616 | Bacteria | 1390 |
| 210 | Ga0307514_10122442 | 3300031649 | Bacteria | 1810 |
| 211 | Ga0307516_10009338 | 3300031730 | Bacteria | 10949 |
| 212 | Ga0307516_10036509 | 3300031730 | Bacteria | 4917 |
| 213 | Ga0307516_10069228 | 3300031730 | Bacteria | 3395 |
| 214 | Ga0307405_10051056 | 3300031731 | Bacteria | 2564 |
| 215 | Ga0307410_10007244 | 3300031852 | Bacteria | 6059 |
| 216 | Ga0307407_10010167 | 3300031903 | Bacteria | 4424 |
| 217 | Ga0307412_10539612 | 3300031911 | Bacteria | 978 |
| 218 | Ga0307409_100053408 | 3300031995 | Bacteria | 3104 |
| 219 | Ga0307409_100238473 | 3300031995 | Bacteria | 1654 |
| 220 | Ga0307416_100194965 | 3300032002 | Bacteria | 1915 |
| 221 | Ga0307411_10259162 | 3300032005 | Bacteria | 1372 |
| 222 | Ga0307415_100010436 | 3300032126 | Bacteria | 5262 |
| 223 | Ga0307415_100032745 | 3300032126 | Bacteria | 3366 |
| 224 | Ga0307507_10096930 | 3300033179 | Bacteria | 2491 |
| 225 | Ga0373940_0006858 | 3300035088 | Bacteria | 2548 |
| 226 | Ga0373952_0023488 | 3300035092 | Bacteria | 1318 |
| 227 | Ga0373939_0029640 | 3300035114 | Bacteria | 1567 |
| 228 | Ga0373946_0045792 | 3300035171 | Bacteria | 1811 |
| 229 | Ga0373962_0003315 | 3300035242 | Bacteria | 3873 |
| 230 | Ga0373931_0298442 | 3300035691 | Bacteria | 994 |
| 231 | Ga0395900_0021103 | 3300037418 | Bacteria | 6657 |
| 232 | Ga0395900_0175999 | 3300037418 | Bacteria | 2176 |
| 233 | Ga0395900_0332386 | 3300037418 | Bacteria | 1497 |
| 234 | Ga0395898_0488222 | 3300037466 | Bacteria | 1172 |
| 235 | Ga0436364_0005541 | 3300037853 | Bacteria | 2557 |
| 236 | Ga0436364_0522243 | 3300037853 | Bacteria | 22527 |
| 237 | Ga0436364_0528793 | 3300037853 | Bacteria | 6405 |
| 238 | Ga0436364_1302924 | 3300037853 | Bacteria | 5832 |
| 239 | Ga0395901_0027028 | 3300038443 | Bacteria | 5894 |
| 240 | Ga0395901_0034091 | 3300038443 | Bacteria | 5257 |
| 241 | Ga0436365_0130473 | 3300039437 | Bacteria | 5608 |
| 242 | Ga0436365_1176999 | 3300039437 | Bacteria | 2363 |
| 243 | Ga0436363_1491085 | 3300039450 | Bacteria | 1150 |
| 244 | Ga0436362_1300112 | 3300039453 | Bacteria | 63878 |
| 245 | Ga0439439_0032932 | 3300041406 | Bacteria | 1325 |
| 246 | Ga0451793_0603958 | 3300041452 | Bacteria | 11316 |
| 247 | Ga0451807_2443037 | 3300041486 | Bacteria | 2119 |
| 248 | Ga0451833_0361120 | 3300041491 | Bacteria | 5167 |
| 249 | Ga0451833_0991290 | 3300041491 | Bacteria | 3302 |
| 250 | Ga0451843_1203602 | 3300041509 | Bacteria | 3378 |
| 251 | Ga0451853_3248538 | 3300041512 | Bacteria | 10764 |
| 252 | Ga0439449_0001239 | 3300042007 | Bacteria | 10006 |
| 253 | Ga0439464_0030652 | 3300042439 | Bacteria | 1507 |
| 254 | Ga0466972_0015874 | 3300044658 | Bacteria | 3765 |
| 255 | Ga0466972_0115961 | 3300044658 | Bacteria | 1264 |
| 256 | Ga0466965_0010511 | 3300044683 | Bacteria | 4322 |
| 257 | Ga0466965_0069545 | 3300044683 | Bacteria | 1769 |
| 258 | Ga0466966_0002733 | 3300044684 | Bacteria | 11586 |
| 259 | Ga0466966_0011711 | 3300044684 | Bacteria | 5815 |
| 260 | Ga0466966_0085082 | 3300044684 | Bacteria | 1966 |
| 261 | Ga0466966_0095505 | 3300044684 | Bacteria | 1842 |
| 262 | Ga0466966_0098602 | 3300044684 | Bacteria | 1809 |
| 263 | Ga0466961_0122932 | 3300044693 | Bacteria | 1629 |
| 264 | Ga0466963_0001454 | 3300044694 | Bacteria | 12773 |
| 265 | Ga0466963_0001502 | 3300044694 | Bacteria | 12623 |
| 266 | Ga0466963_0001927 | 3300044694 | Bacteria | 11358 |
| 267 | Ga0466963_0004764 | 3300044694 | Bacteria | 7911 |
| 268 | Ga0466963_0043317 | 3300044694 | Bacteria | 2959 |
| 269 | Ga0466963_0070313 | 3300044694 | Bacteria | 2354 |
| 270 | Ga0466963_0081455 | 3300044694 | Bacteria | 2192 |
| 271 | Ga0466963_0106794 | 3300044694 | Bacteria | 1920 |
| 272 | Ga0466963_0257594 | 3300044694 | Bacteria | 1225 |
| 273 | Ga0466968_0019078 | 3300044735 | Bacteria | 2757 |
| 274 | Ga0466970_0007430 | 3300044765 | Bacteria | 5491 |
| 275 | Ga0466970_0008918 | 3300044765 | Bacteria | 5058 |
| 276 | Ga0466970_0182838 | 3300044765 | Bacteria | 1163 |
| 277 | Ga0466957_0000398 | 3300044842 | Bacteria | 21209 |
| 278 | Ga0466957_0038708 | 3300044842 | Bacteria | 2874 |
| 279 | Ga0466957_0057316 | 3300044842 | Bacteria | 2384 |
| 280 | Ga0466960_0012861 | 3300044901 | Bacteria | 3543 |
| 281 | Ga0466960_0017309 | 3300044901 | Bacteria | 3140 |
| 282 | Ga0466960_0023774 | 3300044901 | Bacteria | 2755 |
| 283 | Ga0466959_0001790 | 3300045049 | Bacteria | 13433 |
| 284 | Ga0466959_0077858 | 3300045049 | Bacteria | 2392 |
| 285 | Ga0466958_0000850 | 3300045836 | Bacteria | 13567 |
| 286 | Ga0466958_0006064 | 3300045836 | Bacteria | 6553 |
| 287 | Ga0466967_0002518 | 3300045976 | Bacteria | 11459 |
| 288 | Ga0466967_0021502 | 3300045976 | Bacteria | 5243 |
| 289 | Ga0466967_0022687 | 3300045976 | Bacteria | 5128 |
| 290 | Ga0466967_0024563 | 3300045976 | Bacteria | 4957 |
| 291 | Ga0466967_0031168 | 3300045976 | Bacteria | 4485 |
| 292 | Ga0466967_0052107 | 3300045976 | Bacteria | 3590 |
| 293 | Ga0466967_0060288 | 3300045976 | Bacteria | 3362 |
| 294 | Ga0466967_0065320 | 3300045976 | Bacteria | 3238 |
| 295 | Ga0466967_0075238 | 3300045976 | Bacteria | 3035 |
| 296 | Ga0466967_0108145 | 3300045976 | Bacteria | 2551 |
| 297 | Ga0466967_0128919 | 3300045976 | Bacteria | 2346 |
| 298 | Ga0466967_0182311 | 3300045976 | Bacteria | 1981 |
| 299 | Ga0466967_0263158 | 3300045976 | Bacteria | 1650 |
| 300 | Ga0466967_0273227 | 3300045976 | Bacteria | 1620 |
| 301 | Ga0495627_051707 | 3300046453 | Bacteria | 1234 |
| 302 | Ga0495603_0150111 | 3300046455 | Bacteria | 1354 |
| 303 | Ga0495638_0070098 | 3300046460 | Bacteria | 2147 |
| 304 | Ga0495638_0120781 | 3300046460 | Bacteria | 1549 |
| 305 | Ga0495580_0075503 | 3300046472 | Bacteria | 2351 |
| 306 | Ga0495662_0000926 | 3300046476 | Bacteria | 14345 |
| 307 | Ga0495662_0109601 | 3300046476 | Bacteria | 1352 |
| 308 | Ga0495662_0147523 | 3300046476 | Bacteria | 1158 |
| 309 | Ga0495664_0005623 | 3300046477 | Bacteria | 6892 |
| 310 | Ga0495585_0005584 | 3300046492 | Bacteria | 7901 |
| 311 | Ga0495594_0002599 | 3300046499 | Bacteria | 9383 |
| 312 | Ga0495607_0085623 | 3300046501 | Bacteria | 1721 |
| 313 | Ga0495583_0028250 | 3300046506 | Bacteria | 2760 |
| 314 | Ga0495608_0009188 | 3300046511 | Bacteria | 6911 |
| 315 | Ga0495620_0068781 | 3300046515 | Bacteria | 1453 |
| 316 | Ga0495628_0014685 | 3300046516 | Bacteria | 6558 |
| 317 | Ga0495637_0038544 | 3300046520 | Bacteria | 2068 |
| 318 | Ga0495643_0006590 | 3300046522 | Bacteria | 7632 |
| 319 | Ga0495666_0003531 | 3300046526 | Bacteria | 7895 |
| 320 | Ga0495665_0005792 | 3300046531 | Bacteria | 6668 |
| 321 | Ga0495640_0010941 | 3300046533 | Bacteria | 6992 |
| 322 | Ga0495640_0021459 | 3300046533 | Bacteria | 4738 |
| 323 | Ga0495586_0003398 | 3300046535 | Bacteria | 8536 |
| 324 | Ga0495587_0067723 | 3300046536 | Bacteria | 2080 |
| 325 | Ga0495587_0179272 | 3300046536 | Bacteria | 1202 |
| 326 | Ga0495598_0098735 | 3300046537 | Bacteria | 963 |
| 327 | Ga0495622_0014252 | 3300046557 | Bacteria | 3692 |
| 328 | Ga0495667_0015255 | 3300046559 | Bacteria | 5188 |
| 329 | Ga0495656_0022000 | 3300046615 | Bacteria | 2491 |
| 330 | Ga0495656_0044724 | 3300046615 | Bacteria | 1866 |
| 331 | Ga0495611_0089041 | 3300046648 | Bacteria | 1425 |
| 332 | Ga0495588_0038485 | 3300046674 | Bacteria | 2433 |
| 333 | Ga0495588_0105136 | 3300046674 | Bacteria | 1485 |
| 334 | Ga0495599_0099807 | 3300046678 | Bacteria | 1809 |
| 335 | Ga0495669_0109471 | 3300046684 | Bacteria | 1289 |
| 336 | Ga0495613_0009131 | 3300046689 | Bacteria | 7352 |
| 337 | Ga0495613_0012112 | 3300046689 | Bacteria | 6409 |
| 338 | Ga0495613_0105233 | 3300046689 | Bacteria | 2037 |
| 339 | Ga0495613_0165598 | 3300046689 | Bacteria | 1571 |
| 340 | Ga0495670_0001259 | 3300046691 | Bacteria | 12383 |
| 341 | Ga0495670_0087230 | 3300046691 | Bacteria | 1594 |
| 342 | Ga0495670_0112015 | 3300046691 | Bacteria | 1413 |
| 343 | Ga0495589_0012158 | 3300046794 | Bacteria | 4463 |
| 344 | Ga0495660_0021129 | 3300046810 | Bacteria | 3730 |
| 345 | Ga0495660_0087562 | 3300046810 | Bacteria | 1624 |
| 346 | Ga0495581_0014046 | 3300047315 | Bacteria | 4643 |
| 347 | Ga0495581_0081810 | 3300047315 | Bacteria | 1870 |
| 348 | Ga0495604_0003003 | 3300047317 | Bacteria | 13500 |
| 349 | Ga0495604_0015964 | 3300047317 | Bacteria | 5995 |
| 350 | Ga0495636_0042508 | 3300047318 | Bacteria | 1889 |
| 351 | Ga0495674_0070038 | 3300047319 | Bacteria | 3031 |
| 352 | Ga0495676_0188180 | 3300047321 | Bacteria | 1442 |
| 353 | Ga0495675_0019073 | 3300047444 | Bacteria | 4356 |
| 354 | Ga0495675_0040841 | 3300047444 | Bacteria | 2957 |
| 355 | Ga0495677_0018581 | 3300047445 | Bacteria | 2519 |
| 356 | Ga0495685_000133 | 3300047447 | Bacteria | 25839 |
| 357 | Ga0495681_0001292 | 3300047470 | Bacteria | 18958 |
| 358 | Ga0495686_0033794 | 3300047472 | Bacteria | 3299 |
| 359 | Ga0495593_0058280 | 3300047673 | Bacteria | 2026 |
| 360 | Ga0495593_0061602 | 3300047673 | Bacteria | 1962 |
| 361 | Ga0495614_0001285 | 3300048089 | Bacteria | 10806 |
| 362 | Ga0496101_0126841 | 3300048904 | Bacteria | 1934 |
| 363 | Ga0496101_0350934 | 3300048904 | Bacteria | 1159 |
| 364 | Ga0496102_0001153 | 3300048905 | Bacteria | 24147 |
| 365 | Ga0496102_0011487 | 3300048905 | Bacteria | 7636 |
| 366 | Ga0496102_0015193 | 3300048905 | Bacteria | 6702 |
| 367 | Ga0496103_0077361 | 3300048906 | Bacteria | 2088 |
| 368 | Ga0496104_0141551 | 3300048907 | Bacteria | 2311 |
| 369 | Ga0496104_0308320 | 3300048907 | Bacteria | 1496 |
| 370 | Ga0496105_0003371 | 3300048908 | Bacteria | 11808 |
| 371 | Ga0496105_0416042 | 3300048908 | Bacteria | 1065 |
| 372 | Ga0496107_0115758 | 3300048910 | Bacteria | 1973 |
| 373 | Ga0496108_0070505 | 3300048911 | Bacteria | 2949 |
| 374 | Ga0496108_0113845 | 3300048911 | Bacteria | 2315 |
| 375 | Ga0496109_0003619 | 3300048912 | Bacteria | 12922 |
| 376 | Ga0496109_0035105 | 3300048912 | Bacteria | 4521 |
| 377 | Ga0496110_0035847 | 3300048913 | Bacteria | 4307 |
| 378 | Ga0496110_0055580 | 3300048913 | Bacteria | 3483 |
| 379 | Ga0496110_0218836 | 3300048913 | Bacteria | 1731 |
| 380 | Ga0496110_0287026 | 3300048913 | Bacteria | 1498 |
| 381 | Ga0496112_0002691 | 3300048915 | Bacteria | 14366 |
| 382 | Ga0496112_0035503 | 3300048915 | Bacteria | 4857 |
| 383 | Ga0496112_0071118 | 3300048915 | Bacteria | 3439 |
| 384 | Ga0496113_0006068 | 3300048916 | Bacteria | 7617 |
| 385 | Ga0496114_0002375 | 3300048917 | Bacteria | 14331 |
| 386 | Ga0496115_0003667 | 3300048918 | Bacteria | 11052 |
| 387 | Ga0496119_0000125 | 3300048922 | Bacteria | 108373 |
| 388 | Ga0496120_0000695 | 3300048923 | Bacteria | 49341 |
| 389 | Ga0501031_0115908 | 3300049568 | Bacteria | 1750 |
| 390 | Ga0501031_0130385 | 3300049568 | Bacteria | 1643 |
| 391 | Ga0501032_0012126 | 3300049569 | Bacteria | 6170 |
| 392 | Ga0501032_0217991 | 3300049569 | Bacteria | 1242 |
| 393 | Ga0501033_0008599 | 3300049570 | Bacteria | 7901 |
| 394 | Ga0501033_0023846 | 3300049570 | Bacteria | 4615 |
| 395 | Ga0501033_0050660 | 3300049570 | Bacteria | 3079 |
| 396 | Ga0501034_0007333 | 3300049571 | Bacteria | 11748 |
| 397 | Ga0501034_0015676 | 3300049571 | Bacteria | 7782 |
| 398 | Ga0501034_0153286 | 3300049571 | Bacteria | 2280 |
| 399 | Ga0501036_0012063 | 3300049572 | Bacteria | 7161 |
| 400 | Ga0501036_0015369 | 3300049572 | Bacteria | 6392 |
| 401 | Ga0501036_0039797 | 3300049572 | Bacteria | 3977 |
| 402 | Ga0501036_0076055 | 3300049572 | Bacteria | 2840 |
| 403 | Ga0501037_0011964 | 3300049573 | Bacteria | 6392 |
| 404 | Ga0501037_0013360 | 3300049573 | Bacteria | 6050 |
| 405 | Ga0501037_0033781 | 3300049573 | Bacteria | 3777 |
| 406 | Ga0501038_0000471 | 3300049574 | Bacteria | 35396 |
| 407 | Ga0501038_0002494 | 3300049574 | Bacteria | 17131 |
| 408 | Ga0501038_0009405 | 3300049574 | Bacteria | 8968 |
| 409 | Ga0501038_0018948 | 3300049574 | Bacteria | 6210 |
| 410 | Ga0501039_0016284 | 3300049575 | Bacteria | 5695 |
| 411 | Ga0501039_0047923 | 3300049575 | Bacteria | 3303 |
| 412 | Ga0501039_0109998 | 3300049575 | Bacteria | 2154 |
| 413 | Ga0501040_0010606 | 3300049576 | Bacteria | 6025 |
| 414 | Ga0501040_0030212 | 3300049576 | Bacteria | 3660 |
| 415 | Ga0501041_0000679 | 3300049577 | Bacteria | 18043 |
| 416 | Ga0501042_0055823 | 3300049578 | Bacteria | 2818 |
| 417 | Ga0501043_0005544 | 3300049579 | Bacteria | 10180 |
| 418 | Ga0501043_0076409 | 3300049579 | Bacteria | 2631 |
| 419 | Ga0501043_0090324 | 3300049579 | Bacteria | 2408 |
| 420 | Ga0501046_0000383 | 3300049580 | Bacteria | 44303 |
| 421 | Ga0501046_0041235 | 3300049580 | Bacteria | 3684 |
| 422 | Ga0501046_0132657 | 3300049580 | Bacteria | 1888 |
| 423 | Ga0501047_0002816 | 3300049581 | Bacteria | 16511 |
| 424 | Ga0501047_0004082 | 3300049581 | Bacteria | 13735 |
| 425 | Ga0501047_0010581 | 3300049581 | Bacteria | 8724 |
| 426 | Ga0501047_0077092 | 3300049581 | Bacteria | 3207 |
| 427 | Ga0501048_0005189 | 3300049582 | Bacteria | 9921 |
| 428 | Ga0501048_0006173 | 3300049582 | Bacteria | 9119 |
| 429 | Ga0501048_0083234 | 3300049582 | Bacteria | 2256 |
| 430 | Ga0501048_0147690 | 3300049582 | Bacteria | 1663 |
| 431 | Ga0501048_0298391 | 3300049582 | Bacteria | 1146 |
| 432 | Ga0501067_0000518 | 3300049583 | Bacteria | 21114 |
| 433 | Ga0501067_0004199 | 3300049583 | Bacteria | 7952 |
| 434 | Ga0501067_0024484 | 3300049583 | Bacteria | 3348 |
| 435 | Ga0501067_0042614 | 3300049583 | Bacteria | 2520 |
| 436 | Ga0501067_0130520 | 3300049583 | Bacteria | 1398 |
| 437 | Ga0501068_0002033 | 3300049584 | Bacteria | 10778 |
| 438 | Ga0501069_0156959 | 3300049585 | Bacteria | 1309 |
| 439 | Ga0501070_0002118 | 3300049586 | Bacteria | 17407 |
| 440 | Ga0501070_0107233 | 3300049586 | Bacteria | 2308 |
| 441 | Ga0501071_0000762 | 3300049587 | Bacteria | 17091 |
| 442 | Ga0501072_0001374 | 3300049588 | Bacteria | 18276 |
| 443 | Ga0501072_0273002 | 3300049588 | Bacteria | 1345 |
| 444 | Ga0501073_0014911 | 3300049589 | Bacteria | 5639 |
| 445 | Ga0501073_0088646 | 3300049589 | Bacteria | 2151 |
| 446 | Ga0501073_0260024 | 3300049589 | Bacteria | 1198 |
| 447 | Ga0501074_0102317 | 3300049590 | Bacteria | 2050 |
| 448 | Ga0501074_0182095 | 3300049590 | Bacteria | 1498 |
| 449 | Ga0501076_0089568 | 3300049592 | Bacteria | 2473 |
| 450 | Ga0501077_0034240 | 3300049593 | Bacteria | 3232 |
| 451 | Ga0501077_0088351 | 3300049593 | Bacteria | 1964 |
| 452 | Ga0501221_021181 | 3300049704 | Bacteria | 1277 |
| 453 | Ga0501079_0006612 | 3300049741 | Bacteria | 8725 |
| 454 | Ga0501079_0023409 | 3300049741 | Bacteria | 4740 |
| 455 | Ga0501080_0025423 | 3300049742 | Bacteria | 5495 |
| 456 | Ga0501080_0140412 | 3300049742 | Bacteria | 2234 |
| 457 | Ga0501083_0005784 | 3300049744 | Bacteria | 8755 |
| 458 | Ga0501035_0010403 | 3300049822 | Bacteria | 8623 |
| 459 | Ga0501035_0146391 | 3300049822 | Bacteria | 2051 |
| 460 | Ga0501035_0306983 | 3300049822 | Bacteria | 1335 |
| 461 | Ga0501044_0048397 | 3300049823 | Bacteria | 4392 |
| 462 | Ga0501044_0079363 | 3300049823 | Bacteria | 3325 |
| 463 | Ga0501044_0085434 | 3300049823 | Bacteria | 3188 |
| 464 | Ga0501045_0001401 | 3300049824 | Bacteria | 16093 |
| 465 | Ga0501045_0307231 | 3300049824 | Bacteria | 1180 |
| 466 | nmdc:mga03n38_14638_c1 | 3300050490 | Bacteria | 3011 |
| 467 | nmdc:mga05p37_1189_c1 | 3300050507 | Bacteria | 30061 |
| 468 | nmdc:mga05p37_22178_c1 | 3300050507 | Bacteria | 7698 |
| 469 | nmdc:mga09592_233_c1 | 3300050508 | Bacteria | 23820 |
| 470 | nmdc:mga0qj67_144995_c1 | 3300050509 | Bacteria | 1925 |
| 471 | nmdc:mga0qj67_19422_c1 | 3300050509 | Bacteria | 5191 |
| 472 | nmdc:mga0qj67_275_c1 | 3300050509 | Bacteria | 35760 |
| 473 | nmdc:mga0qj67_45216_c1 | 3300050509 | Bacteria | 3474 |
| 474 | nmdc:mga06r32_169_c1 | 3300050510 | Bacteria | 50248 |
| 475 | nmdc:mga06r32_4561_c1 | 3300050510 | Bacteria | 8457 |
| 476 | nmdc:mga08y16_22909_c1 | 3300050511 | Bacteria | 6592 |
| 477 | nmdc:mga08y16_380893_c1 | 3300050511 | Bacteria | 1446 |
| 478 | nmdc:mga08y16_88870_c1 | 3300050511 | Bacteria | 3220 |
| 479 | nmdc:mga0n895_88197_c1 | 3300050512 | Bacteria | 3102 |
| 480 | nmdc:mga0rr50_29935_c1 | 3300050513 | Bacteria | 3847 |
| 481 | nmdc:mga08x19_31945_c1 | 3300050514 | Bacteria | 3316 |
| 482 | nmdc:mga0a205_30421_c1 | 3300050515 | Bacteria | 5170 |
| 483 | Ga0495612_0074325 | 3300053078 | Bacteria | 1421 |
| 484 | Ga0500578_0031007 | 3300053086 | Bacteria | 3435 |
| 485 | Ga0500643_001854 | 3300053087 | Bacteria | 11539 |
| 486 | Ga0500654_020895 | 3300053099 | Bacteria | 4185 |
| 487 | Ga0500569_009784 | 3300053109 | Bacteria | 2237 |
| 488 | Ga0500614_010502 | 3300053123 | Bacteria | 1989 |
| 489 | Ga0500621_026732 | 3300053126 | Bacteria | 2267 |
| 490 | Ga0500652_006446 | 3300053131 | Bacteria | 3777 |
| 491 | Ga0500658_0003265 | 3300053134 | Bacteria | 6159 |
| 492 | Ga0500579_088696 | 3300053143 | Bacteria | 1684 |
| 493 | Ga0500600_0030685 | 3300053149 | Bacteria | 3162 |
| 494 | Ga0500616_0003280 | 3300053153 | Bacteria | 12491 |
| 495 | Ga0500656_001643 | 3300053732 | Bacteria | 1949 |
| 496 | Ga0500587_002331 | 3300053739 | Bacteria | 2696 |
| 497 | Ga0501084_0043180 | 3300054114 | Bacteria | 3771 |
| 498 | Ga0501084_0178234 | 3300054114 | Bacteria | 1794 |
| 499 | Ga0501082_0004519 | 3300060353 | Bacteria | 12147 |
| 500 | Ga0501082_0169154 | 3300060353 | Bacteria | 1900 |
| 501 | Ga0466962_0008836 | 3300061719 | Bacteria | 4828 |
| 502 | Ga0466962_0048291 | 3300061719 | Bacteria | 2034 |
| 503 | Ga0530510_0022871 | 3300061734 | Bacteria | 4455 |
| 504 | Ga0530510_0155973 | 3300061734 | Bacteria | 1687 |
| 505 | Ga0530510_0215846 | 3300061734 | Bacteria | 1425 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035691 | Ga0373931_0298442 | Ga0373931_0298442_32_880 | 281 |
| 2 | 3300046537 | Ga0495598_0098735 | Ga0495598_0098735_47_952 | 301 |
| 3 | 3300037853 | Ga0436364_0005541 | Ga0436364_0005541_523_1452 | 306 |
| 4 | 3300005436 | Ga0070713_100133198 | Ga0070713_1001331983 | 307 |
| 5 | 3300025915 | Ga0207693_10108088 | Ga0207693_101080883 | 307 |
| 6 | 3300025929 | Ga0207664_10138935 | Ga0207664_101389352 | 307 |
| 7 | 3300044765 | Ga0466970_0182838 | Ga0466970_0182838_13_969 | 307 |
| 8 | 3300030744 | Ga0316181_1044065 | Ga0316181_10440652 | 308 |
| 9 | 3300037466 | Ga0395898_0488222 | Ga0395898_0488222_224_1156 | 308 |
| 10 | 3300044684 | Ga0466966_0095505 | Ga0466966_0095505_15_953 | 308 |
| 11 | 3300048904 | Ga0496101_0350934 | Ga0496101_0350934_29_961 | 308 |
| 12 | 3300049571 | Ga0501034_0153286 | Ga0501034_0153286_1312_2265 | 308 |
| 13 | 3300050509 | nmdc:mga0qj67_144995_c1 | nmdc:mga0qj67_144995_c1_16_960 | 308 |
| 14 | 3300044684 | Ga0466966_0098602 | Ga0466966_0098602_14_943 | 309 |
| 15 | 3300044694 | Ga0466963_0001502 | Ga0466963_0001502_3375_4430 | 309 |
| 16 | 3300045976 | Ga0466967_0021502 | Ga0466967_0021502_23_970 | 309 |
| 17 | 3300031911 | Ga0307412_10539612 | Ga0307412_105396121 | 310 |
| 18 | 3300046515 | Ga0495620_0068781 | Ga0495620_0068781_507_1439 | 310 |
| 19 | 3300046536 | Ga0495587_0067723 | Ga0495587_0067723_12_944 | 310 |
| 20 | 3300031548 | Ga0307408_100154686 | Ga0307408_1001546862 | 313 |
| 21 | 3300041491 | Ga0451833_0361120 | Ga0451833_0361120_3301_4275 | 313 |
| 22 | 3300049704 | Ga0501221_021181 | Ga0501221_021181_187_1140 | 313 |
| 23 | 3300009098 | Ga0105245_10230421 | Ga0105245_102304212 | 314 |
| 24 | 3300049583 | Ga0501067_0130520 | Ga0501067_0130520_122_1117 | 315 |
| 25 | 3300049586 | Ga0501070_0107233 | Ga0501070_0107233_1006_2001 | 315 |
| 26 | 3300049588 | Ga0501072_0273002 | Ga0501072_0273002_216_1211 | 315 |
| 27 | 3300049590 | Ga0501074_0182095 | Ga0501074_0182095_194_1189 | 315 |
| 28 | 3300049593 | Ga0501077_0088351 | Ga0501077_0088351_188_1183 | 315 |
| 29 | 3300054114 | Ga0501084_0178234 | Ga0501084_0178234_97_1092 | 315 |
| 30 | 3300060353 | Ga0501082_0169154 | Ga0501082_0169154_681_1676 | 315 |
| 31 | 3300045976 | Ga0466967_0052107 | Ga0466967_0052107_2144_3139 | 317 |
| 32 | 3300044683 | Ga0466965_0069545 | Ga0466965_0069545_720_1733 | 318 |
| 33 | 3300044735 | Ga0466968_0019078 | Ga0466968_0019078_642_1613 | 318 |
| 34 | 3300044765 | Ga0466970_0007430 | Ga0466970_0007430_2559_3530 | 318 |
| 35 | 3300045049 | Ga0466959_0077858 | Ga0466959_0077858_434_1405 | 318 |
| 36 | 3300045976 | Ga0466967_0031168 | Ga0466967_0031168_1445_2416 | 318 |
| 37 | 3300045976 | Ga0466967_0263158 | Ga0466967_0263158_598_1605 | 318 |
| 38 | 3300009093 | Ga0105240_10108746 | Ga0105240_101087462 | 319 |
| 39 | 3300037418 | Ga0395900_0175999 | Ga0395900_0175999_1123_2136 | 320 |
| 40 | 3300061734 | Ga0530510_0215846 | Ga0530510_0215846_50_1015 | 321 |
| 41 | 3300041406 | Ga0439439_0032932 | Ga0439439_0032932_334_1305 | 322 |
| 42 | 3300044842 | Ga0466957_0038708 | Ga0466957_0038708_1267_2295 | 323 |
| 43 | 3300014497 | Ga0182008_10072794 | Ga0182008_100727941 | 324 |
| 44 | 3300048915 | Ga0496112_0071118 | Ga0496112_0071118_99_1073 | 324 |
| 45 | 3300032002 | Ga0307416_100194965 | Ga0307416_1001949652 | 325 |
| 46 | 3300032005 | Ga0307411_10259162 | Ga0307411_102591622 | 325 |
| 47 | 3300014497 | Ga0182008_10011923 | Ga0182008_100119231 | 326 |
| 48 | 3300021388 | Ga0213875_10005541 | Ga0213875_100055414 | 326 |
| 49 | 3300037418 | Ga0395900_0332386 | Ga0395900_0332386_447_1460 | 326 |
| 50 | 3300037853 | Ga0436364_1302924 | Ga0436364_1302924_4156_5154 | 326 |
| 51 | 3300039450 | Ga0436363_1491085 | Ga0436363_1491085_72_1070 | 326 |
| 52 | 3300005937 | Ga0081455_10061842 | Ga0081455_100618422 | 328 |
| 53 | 3300046536 | Ga0495587_0179272 | Ga0495587_0179272_82_1071 | 328 |
| 54 | 3300046615 | Ga0495656_0044724 | Ga0495656_0044724_215_1201 | 328 |
| 55 | 3300005563 | Ga0068855_100031317 | Ga0068855_1000313177 | 329 |
| 56 | 3300006871 | Ga0075434_100145556 | Ga0075434_1001455563 | 329 |
| 57 | 3300025904 | Ga0207647_10131174 | Ga0207647_101311742 | 329 |
| 58 | iso_pu_bacteria | 2861520306 | 2861524636 | 329 |
| 59 | iso_pu_bacteria | 8057568493 | 8057569656 | 329 |
| 60 | 3300005337 | Ga0070682_100125164 | Ga0070682_1001251641 | 330 |
| 61 | 3300005347 | Ga0070668_100142944 | Ga0070668_1001429442 | 330 |
| 62 | 3300005455 | Ga0070663_100310982 | Ga0070663_1003109821 | 330 |
| 63 | 3300005456 | Ga0070678_100347807 | Ga0070678_1003478071 | 330 |
| 64 | 3300005617 | Ga0068859_100135758 | Ga0068859_1001357583 | 330 |
| 65 | 3300006931 | Ga0097620_100135758 | Ga0097620_1001357582 | 330 |
| 66 | 3300009094 | Ga0111539_10005889 | Ga0111539_1000588913 | 330 |
| 67 | 3300014969 | Ga0157376_10146413 | Ga0157376_101464132 | 330 |
| 68 | 3300025918 | Ga0207662_10104077 | Ga0207662_101040772 | 330 |
| 69 | 3300025934 | Ga0207686_10195976 | Ga0207686_101959762 | 330 |
| 70 | 3300026118 | Ga0207675_100032684 | Ga0207675_1000326842 | 330 |
| 71 | 3300026121 | Ga0207683_10077668 | Ga0207683_100776683 | 330 |
| 72 | 3300026121 | Ga0207683_10115631 | Ga0207683_101156312 | 330 |
| 73 | 3300027907 | Ga0207428_10022540 | Ga0207428_100225403 | 330 |
| 74 | 3300041452 | Ga0451793_0603958 | Ga0451793_0603958_847_1839 | 330 |
| 75 | 3300041486 | Ga0451807_2443037 | Ga0451807_2443037_408_1400 | 330 |
| 76 | 3300041491 | Ga0451833_0991290 | Ga0451833_0991290_1190_2182 | 330 |
| 77 | 3300041509 | Ga0451843_1203602 | Ga0451843_1203602_177_1169 | 330 |
| 78 | 3300041512 | Ga0451853_3248538 | Ga0451853_3248538_5116_6108 | 330 |
| 79 | 3300046453 | Ga0495627_051707 | Ga0495627_051707_42_1037 | 330 |
| 80 | 3300046648 | Ga0495611_0089041 | Ga0495611_0089041_163_1158 | 330 |
| 81 | 3300046691 | Ga0495670_0087230 | Ga0495670_0087230_55_1050 | 330 |
| 82 | 3300047318 | Ga0495636_0042508 | Ga0495636_0042508_819_1814 | 330 |
| 83 | 3300047445 | Ga0495677_0018581 | Ga0495677_0018581_1236_2231 | 330 |
| 84 | 3300048908 | Ga0496105_0416042 | Ga0496105_0416042_52_1050 | 330 |
| 85 | 3300050511 | nmdc:mga08y16_88870_c1 | nmdc:mga08y16_88870_c1_1921_2916 | 330 |
| 86 | 3300005327 | Ga0070658_10211907 | Ga0070658_102119072 | 331 |
| 87 | 3300005329 | Ga0070683_100027111 | Ga0070683_1000271114 | 331 |
| 88 | 3300005577 | Ga0068857_100000575 | Ga0068857_10000057527 | 331 |
| 89 | 3300005937 | Ga0081455_10020972 | Ga0081455_100209727 | 331 |
| 90 | 3300006844 | Ga0075428_100178561 | Ga0075428_1001785612 | 331 |
| 91 | 3300009094 | Ga0111539_10069242 | Ga0111539_100692424 | 331 |
| 92 | 3300011119 | Ga0105246_10131361 | Ga0105246_101313612 | 331 |
| 93 | 3300025904 | Ga0207647_10093262 | Ga0207647_100932621 | 331 |
| 94 | 3300025942 | Ga0207689_10061934 | Ga0207689_100619342 | 331 |
| 95 | 3300025944 | Ga0207661_10039494 | Ga0207661_100394944 | 331 |
| 96 | 3300026116 | Ga0207674_10001857 | Ga0207674_1000185727 | 331 |
| 97 | 3300027907 | Ga0207428_10014718 | Ga0207428_100147184 | 331 |
| 98 | 3300044694 | Ga0466963_0257594 | Ga0466963_0257594_55_1062 | 331 |
| 99 | 3300046520 | Ga0495637_0038544 | Ga0495637_0038544_929_1927 | 331 |
| 100 | 3300046615 | Ga0495656_0022000 | Ga0495656_0022000_191_1189 | 331 |
| 101 | 3300046684 | Ga0495669_0109471 | Ga0495669_0109471_55_1053 | 331 |
| 102 | 3300046810 | Ga0495660_0087562 | Ga0495660_0087562_350_1348 | 331 |
| 103 | 3300048907 | Ga0496104_0141551 | Ga0496104_0141551_1111_2106 | 331 |
| 104 | 3300048912 | Ga0496109_0003619 | Ga0496109_0003619_3214_4209 | 331 |
| 105 | 3300048913 | Ga0496110_0218836 | Ga0496110_0218836_551_1546 | 331 |
| 106 | 3300048915 | Ga0496112_0002691 | Ga0496112_0002691_577_1572 | 331 |
| 107 | 3300048916 | Ga0496113_0006068 | Ga0496113_0006068_4463_5458 | 331 |
| 108 | 3300049583 | Ga0501067_0042614 | Ga0501067_0042614_614_1612 | 331 |
| 109 | 3300050509 | nmdc:mga0qj67_45216_c1 | nmdc:mga0qj67_45216_c1_1284_2297 | 331 |
| 110 | 3300050511 | nmdc:mga08y16_22909_c1 | nmdc:mga08y16_22909_c1_2836_3834 | 331 |
| 111 | iso_pu_bacteria | 2643221576 | 2643890217 | 331 |
| 112 | iso_pu_bacteria | 2643221590 | 2643959273 | 331 |
| 113 | iso_pu_bacteria | 2643221617 | 2644098206 | 331 |
| 114 | iso_pu_bacteria | 2643221620 | 2644119066 | 331 |
| 115 | iso_pu_bacteria | 2738541305 | 2738870016 | 331 |
| 116 | 3300025936 | Ga0207670_10264501 | Ga0207670_102645012 | 332 |
| 117 | 3300025937 | Ga0207669_10370601 | Ga0207669_103706011 | 332 |
| 118 | 3300049570 | Ga0501033_0023846 | Ga0501033_0023846_1666_2673 | 332 |
| 119 | iso_pu_bacteria | 2899370129 | 2899370393 | 332 |
| 120 | iso_pu_bacteria | 2915358134 | 2915363939 | 332 |
| 121 | 3300009098 | Ga0105245_10238972 | Ga0105245_102389722 | 333 |
| 122 | 3300026067 | Ga0207678_10088391 | Ga0207678_100883913 | 333 |
| 123 | 3300028794 | Ga0307515_10005747 | Ga0307515_1000574715 | 333 |
| 124 | 3300048913 | Ga0496110_0035847 | Ga0496110_0035847_55_1062 | 333 |
| 125 | iso_pu_bacteria | 8054472261 | 8054476665 | 333 |
| 126 | 3300005985 | Ga0081539_10022222 | Ga0081539_100222224 | 334 |
| 127 | 3300006844 | Ga0075428_100020659 | Ga0075428_1000206592 | 334 |
| 128 | 3300006846 | Ga0075430_100013331 | Ga0075430_1000133318 | 334 |
| 129 | 3300006880 | Ga0075429_100023706 | Ga0075429_1000237062 | 334 |
| 130 | 3300009147 | Ga0114129_10000001 | Ga0114129_10000001147 | 334 |
| 131 | 3300009147 | Ga0114129_10000011 | Ga0114129_10000011118 | 334 |
| 132 | 3300031616 | Ga0307508_10244765 | Ga0307508_102447652 | 334 |
| 133 | 3300044694 | Ga0466963_0106794 | Ga0466963_0106794_411_1421 | 334 |
| 134 | 3300044765 | Ga0466970_0008918 | Ga0466970_0008918_1639_2649 | 334 |
| 135 | 3300050507 | nmdc:mga05p37_1189_c1 | nmdc:mga05p37_1189_c1_9200_10249 | 334 |
| 136 | 3300050507 | nmdc:mga05p37_22178_c1 | nmdc:mga05p37_22178_c1_6468_7487 | 334 |
| 137 | 3300050508 | nmdc:mga09592_233_c1 | nmdc:mga09592_233_c1_5946_6965 | 334 |
| 138 | 3300050509 | nmdc:mga0qj67_19422_c1 | nmdc:mga0qj67_19422_c1_350_1378 | 334 |
| 139 | 3300050509 | nmdc:mga0qj67_275_c1 | nmdc:mga0qj67_275_c1_1222_2241 | 334 |
| 140 | 3300050510 | nmdc:mga06r32_169_c1 | nmdc:mga06r32_169_c1_20122_21141 | 334 |
| 141 | iso_pu_bacteria | 8033684223 | 8033688982 | 334 |
| 142 | 3300009094 | Ga0111539_10463350 | Ga0111539_104633502 | 335 |
| 143 | 3300025909 | Ga0207705_10241395 | Ga0207705_102413952 | 335 |
| 144 | 3300028794 | Ga0307515_10000088 | Ga0307515_1000008843 | 335 |
| 145 | 3300028794 | Ga0307515_10020175 | Ga0307515_100201755 | 335 |
| 146 | 3300031730 | Ga0307516_10009338 | Ga0307516_100093388 | 335 |
| 147 | 3300031730 | Ga0307516_10036509 | Ga0307516_100365092 | 335 |
| 148 | 3300031731 | Ga0307405_10051056 | Ga0307405_100510562 | 335 |
| 149 | 3300031903 | Ga0307407_10010167 | Ga0307407_100101674 | 335 |
| 150 | 3300031995 | Ga0307409_100053408 | Ga0307409_1000534084 | 335 |
| 151 | 3300032126 | Ga0307415_100010436 | Ga0307415_1000104362 | 335 |
| 152 | 3300042439 | Ga0439464_0030652 | Ga0439464_0030652_146_1198 | 335 |
| 153 | 3300046674 | Ga0495588_0105136 | Ga0495588_0105136_254_1273 | 335 |
| 154 | 3300050511 | nmdc:mga08y16_380893_c1 | nmdc:mga08y16_380893_c1_190_1209 | 335 |
| 155 | 3300005327 | Ga0070658_10095301 | Ga0070658_100953012 | 336 |
| 156 | 3300005337 | Ga0070682_100020716 | Ga0070682_1000207162 | 336 |
| 157 | 3300005338 | Ga0068868_100111841 | Ga0068868_1001118411 | 336 |
| 158 | 3300005548 | Ga0070665_100006227 | Ga0070665_10000622713 | 336 |
| 159 | 3300005616 | Ga0068852_100231975 | Ga0068852_1002319752 | 336 |
| 160 | 3300005843 | Ga0068860_100013199 | Ga0068860_10001319910 | 336 |
| 161 | 3300013296 | Ga0157374_10083843 | Ga0157374_100838432 | 336 |
| 162 | 3300013308 | Ga0157375_10576354 | Ga0157375_105763541 | 336 |
| 163 | 3300021358 | Ga0213873_10000055 | Ga0213873_100000554 | 336 |
| 164 | 3300021384 | Ga0213876_10045684 | Ga0213876_100456842 | 336 |
| 165 | 3300025918 | Ga0207662_10253670 | Ga0207662_102536701 | 336 |
| 166 | 3300025932 | Ga0207690_10136024 | Ga0207690_101360242 | 336 |
| 167 | 3300025986 | Ga0207658_10043005 | Ga0207658_100430054 | 336 |
| 168 | 3300026023 | Ga0207677_10033194 | Ga0207677_100331941 | 336 |
| 169 | 3300028379 | Ga0268266_10027110 | Ga0268266_100271102 | 336 |
| 170 | 3300028381 | Ga0268264_10009405 | Ga0268264_100094051 | 336 |
| 171 | 3300037853 | Ga0436364_0522243 | Ga0436364_0522243_13392_14426 | 336 |
| 172 | 3300039437 | Ga0436365_0130473 | Ga0436365_0130473_1900_2934 | 336 |
| 173 | 3300039453 | Ga0436362_1300112 | Ga0436362_1300112_3084_4118 | 336 |
| 174 | 3300044684 | Ga0466966_0002733 | Ga0466966_0002733_5902_6936 | 336 |
| 175 | 3300044694 | Ga0466963_0001454 | Ga0466963_0001454_7277_8311 | 336 |
| 176 | 3300044842 | Ga0466957_0000398 | Ga0466957_0000398_16700_17734 | 336 |
| 177 | 3300045049 | Ga0466959_0001790 | Ga0466959_0001790_11145_12179 | 336 |
| 178 | 3300045836 | Ga0466958_0000850 | Ga0466958_0000850_7323_8357 | 336 |
| 179 | 3300045976 | Ga0466967_0022687 | Ga0466967_0022687_2828_3862 | 336 |
| 180 | 3300045976 | Ga0466967_0075238 | Ga0466967_0075238_834_1868 | 336 |
| 181 | 3300005327 | Ga0070658_10004179 | Ga0070658_1000417911 | 337 |
| 182 | 3300005336 | Ga0070680_100063810 | Ga0070680_1000638103 | 337 |
| 183 | 3300005344 | Ga0070661_100145773 | Ga0070661_1001457732 | 337 |
| 184 | 3300005366 | Ga0070659_100312283 | Ga0070659_1003122831 | 337 |
| 185 | 3300005466 | Ga0070685_10036277 | Ga0070685_100362774 | 337 |
| 186 | 3300005530 | Ga0070679_100011314 | Ga0070679_1000113146 | 337 |
| 187 | 3300005718 | Ga0068866_10203781 | Ga0068866_102037811 | 337 |
| 188 | 3300006058 | Ga0075432_10072543 | Ga0075432_100725431 | 337 |
| 189 | 3300006881 | Ga0068865_100119861 | Ga0068865_1001198612 | 337 |
| 190 | 3300009093 | Ga0105240_10083203 | Ga0105240_100832033 | 337 |
| 191 | 3300013104 | Ga0157370_10054518 | Ga0157370_100545182 | 337 |
| 192 | 3300013105 | Ga0157369_10140464 | Ga0157369_101404642 | 337 |
| 193 | 3300025912 | Ga0207707_10307067 | Ga0207707_103070671 | 337 |
| 194 | 3300026089 | Ga0207648_10251056 | Ga0207648_102510561 | 337 |
| 195 | 3300026116 | Ga0207674_10098646 | Ga0207674_100986463 | 337 |
| 196 | 3300044658 | Ga0466972_0015874 | Ga0466972_0015874_705_1754 | 337 |
| 197 | 3300044683 | Ga0466965_0010511 | Ga0466965_0010511_1762_2811 | 337 |
| 198 | 3300044901 | Ga0466960_0017309 | Ga0466960_0017309_773_1822 | 337 |
| 199 | 3300048907 | Ga0496104_0308320 | Ga0496104_0308320_373_1398 | 337 |
| 200 | 3300005616 | Ga0068852_100197544 | Ga0068852_1001975442 | 338 |
| 201 | 3300006048 | Ga0075363_100022234 | Ga0075363_1000222342 | 338 |
| 202 | 3300031616 | Ga0307508_10130730 | Ga0307508_101307302 | 338 |
| 203 | 3300048905 | Ga0496102_0015193 | Ga0496102_0015193_3360_4385 | 338 |
| 204 | 3300049579 | Ga0501043_0076409 | Ga0501043_0076409_475_1500 | 338 |
| 205 | 3300049580 | Ga0501046_0000383 | Ga0501046_0000383_5228_6253 | 338 |
| 206 | 3300050490 | nmdc:mga03n38_14638_c1 | nmdc:mga03n38_14638_c1_25_1044 | 338 |
| 207 | iso_pu_bacteria | 2767802112 | 2768646568 | 338 |
| 208 | iso_pu_bacteria | 2990044586 | 2990048410 | 338 |
| 209 | 3300005937 | Ga0081455_10006760 | Ga0081455_100067606 | 339 |
| 210 | 3300005937 | Ga0081455_10045134 | Ga0081455_100451344 | 339 |
| 211 | 3300037418 | Ga0395900_0021103 | Ga0395900_0021103_1074_2102 | 339 |
| 212 | iso_pu_bacteria | 2582581312 | 2585296277 | 339 |
| 213 | iso_pu_bacteria | 2616644941 | 2616900238 | 339 |
| 214 | iso_pu_bacteria | 2643221548 | 2643763718 | 339 |
| 215 | iso_pu_bacteria | 2643221578 | 2643903292 | 339 |
| 216 | iso_pu_bacteria | 2643221673 | 2644404197 | 339 |
| 217 | iso_pu_bacteria | 2643221682 | 2644461847 | 339 |
| 218 | iso_pu_bacteria | 2731639228 | 2731905640 | 339 |
| 219 | iso_pu_bacteria | 2784132148 | 2784590075 | 339 |
| 220 | iso_pu_bacteria | 2799112218 | 2799185526 | 339 |
| 221 | iso_pu_bacteria | 2802429296 | 2804845090 | 339 |
| 222 | iso_pu_bacteria | 2808606982 | 2811844740 | 339 |
| 223 | iso_pu_bacteria | 2818991463 | 2819694917 | 339 |
| 224 | iso_pu_bacteria | 2862178590 | 2862185000 | 339 |
| 225 | iso_pu_bacteria | 2867346516 | 2867350307 | 339 |
| 226 | iso_pu_bacteria | 2873151551 | 2873154390 | 339 |
| 227 | iso_pu_bacteria | 2875391855 | 2875396367 | 339 |
| 228 | iso_pu_bacteria | 2912757875 | 2912762465 | 339 |
| 229 | iso_pu_bacteria | 2946045630 | 2946048226 | 339 |
| 230 | iso_pu_bacteria | 2966598605 | 2966601149 | 339 |
| 231 | iso_pu_bacteria | 2990088156 | 2990089185 | 339 |
| 232 | iso_pu_bacteria | 3006425503 | 3006429543 | 339 |
| 233 | iso_pu_bacteria | 3006493962 | 3006498714 | 339 |
| 234 | iso_pu_bacteria | 8025413630 | 8025417954 | 339 |
| 235 | iso_pu_bacteria | 8025530807 | 8025537622 | 339 |
| 236 | 3300044658 | Ga0466972_0115961 | Ga0466972_0115961_128_1159 | 340 |
| 237 | 3300048905 | Ga0496102_0011487 | Ga0496102_0011487_6482_7513 | 340 |
| 238 | 3300048911 | Ga0496108_0113845 | Ga0496108_0113845_515_1546 | 340 |
| 239 | 3300048913 | Ga0496110_0287026 | Ga0496110_0287026_50_1081 | 340 |
| 240 | 3300049583 | Ga0501067_0004199 | Ga0501067_0004199_6824_7855 | 340 |
| 241 | 3300049585 | Ga0501069_0156959 | Ga0501069_0156959_41_1072 | 340 |
| 242 | 3300053078 | Ga0495612_0074325 | Ga0495612_0074325_349_1398 | 340 |
| 243 | iso_pu_bacteria | 2862705112 | 2862708292 | 340 |
| 244 | iso_pu_bacteria | 8008485437 | 8008491272 | 340 |
| 245 | iso_pu_bacteria | 8025524527 | 8025530601 | 340 |
| 246 | 3300005327 | Ga0070658_10210592 | Ga0070658_102105922 | 341 |
| 247 | 3300005336 | Ga0070680_100191285 | Ga0070680_1001912852 | 341 |
| 248 | 3300005338 | Ga0068868_100021122 | Ga0068868_1000211224 | 341 |
| 249 | 3300005339 | Ga0070660_100305612 | Ga0070660_1003056121 | 341 |
| 250 | 3300005347 | Ga0070668_100007434 | Ga0070668_1000074343 | 341 |
| 251 | 3300005353 | Ga0070669_100129871 | Ga0070669_1001298712 | 341 |
| 252 | 3300005356 | Ga0070674_100057908 | Ga0070674_1000579082 | 341 |
| 253 | 3300005366 | Ga0070659_100005120 | Ga0070659_1000051208 | 341 |
| 254 | 3300005367 | Ga0070667_100015311 | Ga0070667_1000153117 | 341 |
| 255 | 3300005434 | Ga0070709_10132920 | Ga0070709_101329202 | 341 |
| 256 | 3300005435 | Ga0070714_100000100 | Ga0070714_10000010064 | 341 |
| 257 | 3300005435 | Ga0070714_100022840 | Ga0070714_1000228402 | 341 |
| 258 | 3300005439 | Ga0070711_100010472 | Ga0070711_1000104724 | 341 |
| 259 | 3300005456 | Ga0070678_100067491 | Ga0070678_1000674912 | 341 |
| 260 | 3300005457 | Ga0070662_100305433 | Ga0070662_1003054331 | 341 |
| 261 | 3300005536 | Ga0070697_100117400 | Ga0070697_1001174002 | 341 |
| 262 | 3300005547 | Ga0070693_100006384 | Ga0070693_1000063843 | 341 |
| 263 | 3300005549 | Ga0070704_100033825 | Ga0070704_1000338253 | 341 |
| 264 | 3300005563 | Ga0068855_100010594 | Ga0068855_1000105945 | 341 |
| 265 | 3300005578 | Ga0068854_100089607 | Ga0068854_1000896073 | 341 |
| 266 | 3300005614 | Ga0068856_100221286 | Ga0068856_1002212862 | 341 |
| 267 | 3300005617 | Ga0068859_100119189 | Ga0068859_1001191891 | 341 |
| 268 | 3300005718 | Ga0068866_10001329 | Ga0068866_100013299 | 341 |
| 269 | 3300005719 | Ga0068861_100004889 | Ga0068861_1000048893 | 341 |
| 270 | 3300005840 | Ga0068870_10015215 | Ga0068870_100152153 | 341 |
| 271 | 3300005843 | Ga0068860_100070952 | Ga0068860_1000709522 | 341 |
| 272 | 3300005844 | Ga0068862_100032239 | Ga0068862_1000322392 | 341 |
| 273 | 3300006028 | Ga0070717_10186315 | Ga0070717_101863152 | 341 |
| 274 | 3300006058 | Ga0075432_10046768 | Ga0075432_100467681 | 341 |
| 275 | 3300006175 | Ga0070712_100021057 | Ga0070712_1000210573 | 341 |
| 276 | 3300006237 | Ga0097621_100048487 | Ga0097621_1000484874 | 341 |
| 277 | 3300006358 | Ga0068871_100291378 | Ga0068871_1002913782 | 341 |
| 278 | 3300006846 | Ga0075430_100041631 | Ga0075430_1000416314 | 341 |
| 279 | 3300006847 | Ga0075431_100068276 | Ga0075431_1000682764 | 341 |
| 280 | 3300006852 | Ga0075433_10028251 | Ga0075433_100282514 | 341 |
| 281 | 3300006871 | Ga0075434_100021172 | Ga0075434_1000211723 | 341 |
| 282 | 3300006880 | Ga0075429_100010493 | Ga0075429_1000104933 | 341 |
| 283 | 3300006881 | Ga0068865_100093373 | Ga0068865_1000933732 | 341 |
| 284 | 3300006914 | Ga0075436_100007844 | Ga0075436_1000078444 | 341 |
| 285 | 3300006931 | Ga0097620_100119184 | Ga0097620_1001191841 | 341 |
| 286 | 3300009093 | Ga0105240_10213225 | Ga0105240_102132252 | 341 |
| 287 | 3300009098 | Ga0105245_10037246 | Ga0105245_100372463 | 341 |
| 288 | 3300009101 | Ga0105247_10010785 | Ga0105247_100107853 | 341 |
| 289 | 3300009147 | Ga0114129_10022337 | Ga0114129_100223374 | 341 |
| 290 | 3300009148 | Ga0105243_10059524 | Ga0105243_100595243 | 341 |
| 291 | 3300009176 | Ga0105242_10007893 | Ga0105242_100078935 | 341 |
| 292 | 3300009177 | Ga0105248_10017673 | Ga0105248_100176732 | 341 |
| 293 | 3300009545 | Ga0105237_10098867 | Ga0105237_100988673 | 341 |
| 294 | 3300009551 | Ga0105238_10034972 | Ga0105238_100349723 | 341 |
| 295 | 3300009551 | Ga0105238_10200268 | Ga0105238_102002682 | 341 |
| 296 | 3300009553 | Ga0105249_10009542 | Ga0105249_100095427 | 341 |
| 297 | 3300009988 | Ga0105035_100397 | Ga0105035_1003971 | 341 |
| 298 | 3300010375 | Ga0105239_10038959 | Ga0105239_100389593 | 341 |
| 299 | 3300013102 | Ga0157371_10032061 | Ga0157371_100320613 | 341 |
| 300 | 3300013104 | Ga0157370_10010773 | Ga0157370_100107737 | 341 |
| 301 | 3300013105 | Ga0157369_10060752 | Ga0157369_100607524 | 341 |
| 302 | 3300013296 | Ga0157374_10245445 | Ga0157374_102454452 | 341 |
| 303 | 3300013297 | Ga0157378_10121661 | Ga0157378_101216612 | 341 |
| 304 | 3300013306 | Ga0163162_10011592 | Ga0163162_100115927 | 341 |
| 305 | 3300013307 | Ga0157372_10001746 | Ga0157372_1000174619 | 341 |
| 306 | 3300013307 | Ga0157372_10029416 | Ga0157372_100294165 | 341 |
| 307 | 3300013308 | Ga0157375_10067938 | Ga0157375_100679383 | 341 |
| 308 | 3300014326 | Ga0157380_10017791 | Ga0157380_100177912 | 341 |
| 309 | 3300014968 | Ga0157379_10005138 | Ga0157379_100051389 | 341 |
| 310 | 3300014969 | Ga0157376_10266690 | Ga0157376_102666901 | 341 |
| 311 | 3300017792 | Ga0163161_10002295 | Ga0163161_1000229510 | 341 |
| 312 | 3300025901 | Ga0207688_10000941 | Ga0207688_1000094113 | 341 |
| 313 | 3300025903 | Ga0207680_10102740 | Ga0207680_101027401 | 341 |
| 314 | 3300025906 | Ga0207699_10009414 | Ga0207699_100094144 | 341 |
| 315 | 3300025911 | Ga0207654_10212842 | Ga0207654_102128421 | 341 |
| 316 | 3300025913 | Ga0207695_10160220 | Ga0207695_101602203 | 341 |
| 317 | 3300025914 | Ga0207671_10279785 | Ga0207671_102797851 | 341 |
| 318 | 3300025915 | Ga0207693_10001318 | Ga0207693_100013189 | 341 |
| 319 | 3300025916 | Ga0207663_10016373 | Ga0207663_100163733 | 341 |
| 320 | 3300025919 | Ga0207657_10009491 | Ga0207657_100094919 | 341 |
| 321 | 3300025923 | Ga0207681_10146869 | Ga0207681_101468692 | 341 |
| 322 | 3300025929 | Ga0207664_10000002 | Ga0207664_10000002566 | 341 |
| 323 | 3300025932 | Ga0207690_10027443 | Ga0207690_100274433 | 341 |
| 324 | 3300025933 | Ga0207706_10181755 | Ga0207706_101817553 | 341 |
| 325 | 3300025938 | Ga0207704_10145105 | Ga0207704_101451052 | 341 |
| 326 | 3300025939 | Ga0207665_10003129 | Ga0207665_100031298 | 341 |
| 327 | 3300025942 | Ga0207689_10009079 | Ga0207689_100090794 | 341 |
| 328 | 3300025949 | Ga0207667_10036970 | Ga0207667_100369704 | 341 |
| 329 | 3300025972 | Ga0207668_10008237 | Ga0207668_100082373 | 341 |
| 330 | 3300026088 | Ga0207641_10110399 | Ga0207641_101103993 | 341 |
| 331 | 3300026121 | Ga0207683_10004078 | Ga0207683_1000407810 | 341 |
| 332 | 3300028379 | Ga0268266_10119390 | Ga0268266_101193903 | 341 |
| 333 | 3300032126 | Ga0307415_100032745 | Ga0307415_1000327453 | 341 |
| 334 | 3300035088 | Ga0373940_0006858 | Ga0373940_0006858_722_1765 | 341 |
| 335 | 3300035092 | Ga0373952_0023488 | Ga0373952_0023488_85_1128 | 341 |
| 336 | 3300035114 | Ga0373939_0029640 | Ga0373939_0029640_160_1203 | 341 |
| 337 | 3300035242 | Ga0373962_0003315 | Ga0373962_0003315_1595_2638 | 341 |
| 338 | 3300038443 | Ga0395901_0027028 | Ga0395901_0027028_1372_2406 | 341 |
| 339 | 3300039437 | Ga0436365_1176999 | Ga0436365_1176999_90_1211 | 341 |
| 340 | 3300044901 | Ga0466960_0012861 | Ga0466960_0012861_767_1801 | 341 |
| 341 | 3300044901 | Ga0466960_0023774 | Ga0466960_0023774_738_1772 | 341 |
| 342 | 3300045976 | Ga0466967_0108145 | Ga0466967_0108145_479_1513 | 341 |
| 343 | 3300047321 | Ga0495676_0188180 | Ga0495676_0188180_113_1156 | 341 |
| 344 | 3300048904 | Ga0496101_0126841 | Ga0496101_0126841_482_1525 | 341 |
| 345 | 3300048908 | Ga0496105_0003371 | Ga0496105_0003371_483_1526 | 341 |
| 346 | 3300048910 | Ga0496107_0115758 | Ga0496107_0115758_371_1414 | 341 |
| 347 | 3300048911 | Ga0496108_0070505 | Ga0496108_0070505_410_1453 | 341 |
| 348 | 3300048912 | Ga0496109_0035105 | Ga0496109_0035105_410_1453 | 341 |
| 349 | 3300048913 | Ga0496110_0055580 | Ga0496110_0055580_1846_2889 | 341 |
| 350 | 3300048915 | Ga0496112_0035503 | Ga0496112_0035503_1792_2835 | 341 |
| 351 | 3300048917 | Ga0496114_0002375 | Ga0496114_0002375_8673_9716 | 341 |
| 352 | 3300048918 | Ga0496115_0003667 | Ga0496115_0003667_9564_10607 | 341 |
| 353 | 3300049572 | Ga0501036_0012063 | Ga0501036_0012063_3521_4558 | 341 |
| 354 | 3300049573 | Ga0501037_0033781 | Ga0501037_0033781_2666_3703 | 341 |
| 355 | 3300049574 | Ga0501038_0000471 | Ga0501038_0000471_19341_20378 | 341 |
| 356 | 3300049575 | Ga0501039_0109998 | Ga0501039_0109998_758_1795 | 341 |
| 357 | 3300049581 | Ga0501047_0004082 | Ga0501047_0004082_10120_11157 | 341 |
| 358 | 3300049582 | Ga0501048_0147690 | Ga0501048_0147690_55_1092 | 341 |
| 359 | 3300049583 | Ga0501067_0024484 | Ga0501067_0024484_874_1908 | 341 |
| 360 | 3300050510 | nmdc:mga06r32_4561_c1 | nmdc:mga06r32_4561_c1_7219_8277 | 341 |
| 361 | 3300050512 | nmdc:mga0n895_88197_c1 | nmdc:mga0n895_88197_c1_1414_2457 | 341 |
| 362 | 3300050513 | nmdc:mga0rr50_29935_c1 | nmdc:mga0rr50_29935_c1_1732_2775 | 341 |
| 363 | 3300050514 | nmdc:mga08x19_31945_c1 | nmdc:mga08x19_31945_c1_519_1562 | 341 |
| 364 | 3300050515 | nmdc:mga0a205_30421_c1 | nmdc:mga0a205_30421_c1_646_1689 | 341 |
| 365 | 3300061734 | Ga0530510_0155973 | Ga0530510_0155973_305_1339 | 341 |
| 366 | iso_pu_bacteria | 2984576629 | 2984579759 | 341 |
| 367 | iso_pu_bacteria | 2990256926 | 2990257365 | 341 |
| 368 | 3300005327 | Ga0070658_10043928 | Ga0070658_100439283 | 342 |
| 369 | 3300005335 | Ga0070666_10035831 | Ga0070666_100358312 | 342 |
| 370 | 3300005441 | Ga0070700_100000071 | Ga0070700_10000007124 | 342 |
| 371 | 3300005445 | Ga0070708_100381961 | Ga0070708_1003819611 | 342 |
| 372 | 3300005548 | Ga0070665_100010691 | Ga0070665_1000106913 | 342 |
| 373 | 3300005548 | Ga0070665_100070179 | Ga0070665_1000701792 | 342 |
| 374 | 3300005841 | Ga0068863_100000501 | Ga0068863_1000005012 | 342 |
| 375 | 3300005842 | Ga0068858_100042548 | Ga0068858_1000425483 | 342 |
| 376 | 3300005843 | Ga0068860_100000646 | Ga0068860_10000064616 | 342 |
| 377 | 3300009093 | Ga0105240_10152029 | Ga0105240_101520292 | 342 |
| 378 | 3300011119 | Ga0105246_10101774 | Ga0105246_101017741 | 342 |
| 379 | 3300013297 | Ga0157378_10035336 | Ga0157378_100353362 | 342 |
| 380 | 3300021388 | Ga0213875_10062007 | Ga0213875_100620072 | 342 |
| 381 | 3300025711 | Ga0207696_1017156 | Ga0207696_10171561 | 342 |
| 382 | 3300025903 | Ga0207680_10002698 | Ga0207680_1000269811 | 342 |
| 383 | 3300025909 | Ga0207705_10235076 | Ga0207705_102350761 | 342 |
| 384 | 3300025949 | Ga0207667_10463829 | Ga0207667_104638292 | 342 |
| 385 | 3300026035 | Ga0207703_10032291 | Ga0207703_100322913 | 342 |
| 386 | 3300026075 | Ga0207708_10000029 | Ga0207708_1000002924 | 342 |
| 387 | 3300026088 | Ga0207641_10014067 | Ga0207641_100140672 | 342 |
| 388 | 3300028379 | Ga0268266_10214873 | Ga0268266_102148731 | 342 |
| 389 | 3300028381 | Ga0268264_10000530 | Ga0268264_1000053035 | 342 |
| 390 | 3300030522 | Ga0307512_10016907 | Ga0307512_100169075 | 342 |
| 391 | 3300031507 | Ga0307509_10091925 | Ga0307509_100919253 | 342 |
| 392 | 3300031616 | Ga0307508_10053527 | Ga0307508_100535274 | 342 |
| 393 | 3300031616 | Ga0307508_10143073 | Ga0307508_101430732 | 342 |
| 394 | 3300031649 | Ga0307514_10122442 | Ga0307514_101224422 | 342 |
| 395 | 3300031730 | Ga0307516_10069228 | Ga0307516_100692283 | 342 |
| 396 | 3300031852 | Ga0307410_10007244 | Ga0307410_100072443 | 342 |
| 397 | 3300031995 | Ga0307409_100238473 | Ga0307409_1002384731 | 342 |
| 398 | 3300033179 | Ga0307507_10096930 | Ga0307507_100969301 | 342 |
| 399 | 3300035171 | Ga0373946_0045792 | Ga0373946_0045792_220_1302 | 342 |
| 400 | 3300037853 | Ga0436364_0528793 | Ga0436364_0528793_3098_4156 | 342 |
| 401 | 3300042007 | Ga0439449_0001239 | Ga0439449_0001239_933_1967 | 342 |
| 402 | 3300044684 | Ga0466966_0085082 | Ga0466966_0085082_95_1180 | 342 |
| 403 | 3300044693 | Ga0466961_0122932 | Ga0466961_0122932_25_1074 | 342 |
| 404 | 3300044694 | Ga0466963_0001927 | Ga0466963_0001927_6124_7191 | 342 |
| 405 | 3300044694 | Ga0466963_0004764 | Ga0466963_0004764_432_1496 | 342 |
| 406 | 3300044694 | Ga0466963_0043317 | Ga0466963_0043317_1527_2579 | 342 |
| 407 | 3300044694 | Ga0466963_0070313 | Ga0466963_0070313_1159_2217 | 342 |
| 408 | 3300044694 | Ga0466963_0081455 | Ga0466963_0081455_924_1973 | 342 |
| 409 | 3300044842 | Ga0466957_0057316 | Ga0466957_0057316_419_1471 | 342 |
| 410 | 3300045836 | Ga0466958_0006064 | Ga0466958_0006064_697_1749 | 342 |
| 411 | 3300045976 | Ga0466967_0024563 | Ga0466967_0024563_3266_4330 | 342 |
| 412 | 3300045976 | Ga0466967_0060288 | Ga0466967_0060288_833_1897 | 342 |
| 413 | 3300045976 | Ga0466967_0065320 | Ga0466967_0065320_1805_2869 | 342 |
| 414 | 3300045976 | Ga0466967_0128919 | Ga0466967_0128919_675_1733 | 342 |
| 415 | 3300045976 | Ga0466967_0182311 | Ga0466967_0182311_585_1649 | 342 |
| 416 | 3300045976 | Ga0466967_0273227 | Ga0466967_0273227_66_1124 | 342 |
| 417 | 3300046455 | Ga0495603_0150111 | Ga0495603_0150111_38_1069 | 342 |
| 418 | 3300046460 | Ga0495638_0070098 | Ga0495638_0070098_357_1397 | 342 |
| 419 | 3300046460 | Ga0495638_0120781 | Ga0495638_0120781_77_1108 | 342 |
| 420 | 3300046472 | Ga0495580_0075503 | Ga0495580_0075503_189_1235 | 342 |
| 421 | 3300046476 | Ga0495662_0000926 | Ga0495662_0000926_9923_10969 | 342 |
| 422 | 3300046476 | Ga0495662_0109601 | Ga0495662_0109601_48_1079 | 342 |
| 423 | 3300046476 | Ga0495662_0147523 | Ga0495662_0147523_80_1111 | 342 |
| 424 | 3300046477 | Ga0495664_0005623 | Ga0495664_0005623_4153_5199 | 342 |
| 425 | 3300046492 | Ga0495585_0005584 | Ga0495585_0005584_918_1949 | 342 |
| 426 | 3300046499 | Ga0495594_0002599 | Ga0495594_0002599_627_1658 | 342 |
| 427 | 3300046501 | Ga0495607_0085623 | Ga0495607_0085623_280_1320 | 342 |
| 428 | 3300046506 | Ga0495583_0028250 | Ga0495583_0028250_1128_2162 | 342 |
| 429 | 3300046511 | Ga0495608_0009188 | Ga0495608_0009188_3606_4652 | 342 |
| 430 | 3300046516 | Ga0495628_0014685 | Ga0495628_0014685_3089_4135 | 342 |
| 431 | 3300046522 | Ga0495643_0006590 | Ga0495643_0006590_847_1887 | 342 |
| 432 | 3300046526 | Ga0495666_0003531 | Ga0495666_0003531_747_1793 | 342 |
| 433 | 3300046531 | Ga0495665_0005792 | Ga0495665_0005792_3117_4163 | 342 |
| 434 | 3300046533 | Ga0495640_0010941 | Ga0495640_0010941_2541_3587 | 342 |
| 435 | 3300046533 | Ga0495640_0021459 | Ga0495640_0021459_2216_3247 | 342 |
| 436 | 3300046535 | Ga0495586_0003398 | Ga0495586_0003398_3992_5038 | 342 |
| 437 | 3300046557 | Ga0495622_0014252 | Ga0495622_0014252_366_1397 | 342 |
| 438 | 3300046559 | Ga0495667_0015255 | Ga0495667_0015255_1265_2311 | 342 |
| 439 | 3300046674 | Ga0495588_0038485 | Ga0495588_0038485_110_1141 | 342 |
| 440 | 3300046678 | Ga0495599_0099807 | Ga0495599_0099807_747_1793 | 342 |
| 441 | 3300046689 | Ga0495613_0009131 | Ga0495613_0009131_2901_3932 | 342 |
| 442 | 3300046689 | Ga0495613_0012112 | Ga0495613_0012112_3597_4643 | 342 |
| 443 | 3300046689 | Ga0495613_0105233 | Ga0495613_0105233_213_1253 | 342 |
| 444 | 3300046689 | Ga0495613_0165598 | Ga0495613_0165598_460_1491 | 342 |
| 445 | 3300046691 | Ga0495670_0001259 | Ga0495670_0001259_8127_9167 | 342 |
| 446 | 3300046691 | Ga0495670_0112015 | Ga0495670_0112015_298_1329 | 342 |
| 447 | 3300046794 | Ga0495589_0012158 | Ga0495589_0012158_1879_2919 | 342 |
| 448 | 3300046810 | Ga0495660_0021129 | Ga0495660_0021129_1572_2612 | 342 |
| 449 | 3300047315 | Ga0495581_0014046 | Ga0495581_0014046_3470_4516 | 342 |
| 450 | 3300047315 | Ga0495581_0081810 | Ga0495581_0081810_795_1826 | 342 |
| 451 | 3300047317 | Ga0495604_0003003 | Ga0495604_0003003_4049_5095 | 342 |
| 452 | 3300047317 | Ga0495604_0015964 | Ga0495604_0015964_217_1248 | 342 |
| 453 | 3300047319 | Ga0495674_0070038 | Ga0495674_0070038_594_1640 | 342 |
| 454 | 3300047444 | Ga0495675_0019073 | Ga0495675_0019073_2981_4027 | 342 |
| 455 | 3300047444 | Ga0495675_0040841 | Ga0495675_0040841_283_1314 | 342 |
| 456 | 3300047447 | Ga0495685_000133 | Ga0495685_000133_15389_16429 | 342 |
| 457 | 3300047470 | Ga0495681_0001292 | Ga0495681_0001292_9073_10113 | 342 |
| 458 | 3300047472 | Ga0495686_0033794 | Ga0495686_0033794_1896_2936 | 342 |
| 459 | 3300047673 | Ga0495593_0058280 | Ga0495593_0058280_698_1729 | 342 |
| 460 | 3300047673 | Ga0495593_0061602 | Ga0495593_0061602_136_1182 | 342 |
| 461 | 3300048089 | Ga0495614_0001285 | Ga0495614_0001285_1469_2500 | 342 |
| 462 | 3300048905 | Ga0496102_0001153 | Ga0496102_0001153_13840_14886 | 342 |
| 463 | 3300048906 | Ga0496103_0077361 | Ga0496103_0077361_176_1222 | 342 |
| 464 | 3300048922 | Ga0496119_0000125 | Ga0496119_0000125_59180_60238 | 342 |
| 465 | 3300048923 | Ga0496120_0000695 | Ga0496120_0000695_37076_38134 | 342 |
| 466 | 3300049568 | Ga0501031_0115908 | Ga0501031_0115908_46_1080 | 342 |
| 467 | 3300049568 | Ga0501031_0130385 | Ga0501031_0130385_346_1377 | 342 |
| 468 | 3300049569 | Ga0501032_0217991 | Ga0501032_0217991_146_1183 | 342 |
| 469 | 3300049570 | Ga0501033_0050660 | Ga0501033_0050660_1451_2482 | 342 |
| 470 | 3300049571 | Ga0501034_0015676 | Ga0501034_0015676_1772_2803 | 342 |
| 471 | 3300049572 | Ga0501036_0039797 | Ga0501036_0039797_1380_2411 | 342 |
| 472 | 3300049572 | Ga0501036_0076055 | Ga0501036_0076055_644_1678 | 342 |
| 473 | 3300049573 | Ga0501037_0013360 | Ga0501037_0013360_2776_3813 | 342 |
| 474 | 3300049574 | Ga0501038_0002494 | Ga0501038_0002494_9299_10333 | 342 |
| 475 | 3300049574 | Ga0501038_0018948 | Ga0501038_0018948_4455_5486 | 342 |
| 476 | 3300049575 | Ga0501039_0047923 | Ga0501039_0047923_1808_2845 | 342 |
| 477 | 3300049579 | Ga0501043_0090324 | Ga0501043_0090324_1319_2353 | 342 |
| 478 | 3300049580 | Ga0501046_0132657 | Ga0501046_0132657_681_1718 | 342 |
| 479 | 3300049581 | Ga0501047_0010581 | Ga0501047_0010581_3432_4469 | 342 |
| 480 | 3300049581 | Ga0501047_0077092 | Ga0501047_0077092_1611_2642 | 342 |
| 481 | 3300049582 | Ga0501048_0005189 | Ga0501048_0005189_5329_6366 | 342 |
| 482 | 3300049582 | Ga0501048_0083234 | Ga0501048_0083234_65_1102 | 342 |
| 483 | 3300049589 | Ga0501073_0088646 | Ga0501073_0088646_1018_2052 | 342 |
| 484 | 3300049589 | Ga0501073_0260024 | Ga0501073_0260024_38_1075 | 342 |
| 485 | 3300049742 | Ga0501080_0140412 | Ga0501080_0140412_1137_2171 | 342 |
| 486 | 3300049822 | Ga0501035_0146391 | Ga0501035_0146391_443_1477 | 342 |
| 487 | 3300049822 | Ga0501035_0306983 | Ga0501035_0306983_234_1265 | 342 |
| 488 | 3300049823 | Ga0501044_0048397 | Ga0501044_0048397_3309_4343 | 342 |
| 489 | 3300049823 | Ga0501044_0079363 | Ga0501044_0079363_2266_3297 | 342 |
| 490 | 3300049824 | Ga0501045_0307231 | Ga0501045_0307231_130_1167 | 342 |
| 491 | 3300053086 | Ga0500578_0031007 | Ga0500578_0031007_1703_2743 | 342 |
| 492 | 3300053087 | Ga0500643_001854 | Ga0500643_001854_3815_4846 | 342 |
| 493 | 3300053099 | Ga0500654_020895 | Ga0500654_020895_415_1455 | 342 |
| 494 | 3300053109 | Ga0500569_009784 | Ga0500569_009784_40_1080 | 342 |
| 495 | 3300053123 | Ga0500614_010502 | Ga0500614_010502_880_1920 | 342 |
| 496 | 3300053126 | Ga0500621_026732 | Ga0500621_026732_747_1787 | 342 |
| 497 | 3300053131 | Ga0500652_006446 | Ga0500652_006446_1436_2476 | 342 |
| 498 | 3300053134 | Ga0500658_0003265 | Ga0500658_0003265_713_1753 | 342 |
| 499 | 3300053143 | Ga0500579_088696 | Ga0500579_088696_471_1511 | 342 |
| 500 | 3300053149 | Ga0500600_0030685 | Ga0500600_0030685_55_1095 | 342 |
| 501 | 3300053153 | Ga0500616_0003280 | Ga0500616_0003280_9900_10940 | 342 |
| 502 | 3300053732 | Ga0500656_001643 | Ga0500656_001643_846_1886 | 342 |
| 503 | 3300053739 | Ga0500587_002331 | Ga0500587_002331_34_1074 | 342 |
| 504 | 3300061719 | Ga0466962_0008836 | Ga0466962_0008836_1754_2818 | 342 |
| 505 | 3300061719 | Ga0466962_0048291 | Ga0466962_0048291_642_1694 | 342 |
| 506 | 3300049569 | Ga0501032_0012126 | Ga0501032_0012126_796_1851 | 343 |
| 507 | 3300049570 | Ga0501033_0008599 | Ga0501033_0008599_332_1387 | 343 |
| 508 | 3300049571 | Ga0501034_0007333 | Ga0501034_0007333_6152_7207 | 343 |
| 509 | 3300049572 | Ga0501036_0015369 | Ga0501036_0015369_4542_5597 | 343 |
| 510 | 3300049573 | Ga0501037_0011964 | Ga0501037_0011964_796_1851 | 343 |
| 511 | 3300049574 | Ga0501038_0009405 | Ga0501038_0009405_1647_2702 | 343 |
| 512 | 3300049575 | Ga0501039_0016284 | Ga0501039_0016284_1757_2812 | 343 |
| 513 | 3300049576 | Ga0501040_0010606 | Ga0501040_0010606_349_1404 | 343 |
| 514 | 3300049576 | Ga0501040_0030212 | Ga0501040_0030212_2019_3062 | 343 |
| 515 | 3300049577 | Ga0501041_0000679 | Ga0501041_0000679_6622_7677 | 343 |
| 516 | 3300049578 | Ga0501042_0055823 | Ga0501042_0055823_1117_2172 | 343 |
| 517 | 3300049579 | Ga0501043_0005544 | Ga0501043_0005544_4542_5597 | 343 |
| 518 | 3300049580 | Ga0501046_0041235 | Ga0501046_0041235_1365_2420 | 343 |
| 519 | 3300049581 | Ga0501047_0002816 | Ga0501047_0002816_9406_10461 | 343 |
| 520 | 3300049582 | Ga0501048_0006173 | Ga0501048_0006173_4741_5796 | 343 |
| 521 | 3300049582 | Ga0501048_0298391 | Ga0501048_0298391_13_1056 | 343 |
| 522 | 3300049583 | Ga0501067_0000518 | Ga0501067_0000518_13843_14898 | 343 |
| 523 | 3300049584 | Ga0501068_0002033 | Ga0501068_0002033_5015_6070 | 343 |
| 524 | 3300049586 | Ga0501070_0002118 | Ga0501070_0002118_3374_4429 | 343 |
| 525 | 3300049587 | Ga0501071_0000762 | Ga0501071_0000762_7453_8508 | 343 |
| 526 | 3300049588 | Ga0501072_0001374 | Ga0501072_0001374_10697_11752 | 343 |
| 527 | 3300049589 | Ga0501073_0014911 | Ga0501073_0014911_4364_5419 | 343 |
| 528 | 3300049590 | Ga0501074_0102317 | Ga0501074_0102317_775_1830 | 343 |
| 529 | 3300049592 | Ga0501076_0089568 | Ga0501076_0089568_708_1763 | 343 |
| 530 | 3300049593 | Ga0501077_0034240 | Ga0501077_0034240_256_1311 | 343 |
| 531 | 3300049741 | Ga0501079_0006612 | Ga0501079_0006612_4659_5714 | 343 |
| 532 | 3300049741 | Ga0501079_0023409 | Ga0501079_0023409_1229_2272 | 343 |
| 533 | 3300049742 | Ga0501080_0025423 | Ga0501080_0025423_1117_2172 | 343 |
| 534 | 3300049744 | Ga0501083_0005784 | Ga0501083_0005784_3324_4379 | 343 |
| 535 | 3300049822 | Ga0501035_0010403 | Ga0501035_0010403_4542_5597 | 343 |
| 536 | 3300049823 | Ga0501044_0085434 | Ga0501044_0085434_769_1824 | 343 |
| 537 | 3300049824 | Ga0501045_0001401 | Ga0501045_0001401_9247_10302 | 343 |
| 538 | 3300054114 | Ga0501084_0043180 | Ga0501084_0043180_943_1998 | 343 |
| 539 | 3300060353 | Ga0501082_0004519 | Ga0501082_0004519_6527_7582 | 343 |
| 540 | 3300061734 | Ga0530510_0022871 | Ga0530510_0022871_788_1843 | 343 |
| 541 | 3300005327 | Ga0070658_10002571 | Ga0070658_100025717 | 344 |
| 542 | 3300009098 | Ga0105245_10050607 | Ga0105245_100506075 | 344 |
| 543 | 3300025909 | Ga0207705_10033923 | Ga0207705_100339232 | 344 |
| 544 | 3300025927 | Ga0207687_10087823 | Ga0207687_100878232 | 344 |
| 545 | 3300038443 | Ga0395901_0034091 | Ga0395901_0034091_2441_3499 | 344 |
| 546 | 3300044684 | Ga0466966_0011711 | Ga0466966_0011711_3211_4275 | 344 |
| 547 | 3300045976 | Ga0466967_0002518 | Ga0466967_0002518_758_1858 | 344 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7txb-assembly2.cif.gz_A | structure of the class ii fructose-1,6-bisphophatase from mycobacterium tuberculosis complexed with substrate f1,6bp | 0.9796 | 25 | 328 |
| 7txb-assembly2.cif.gz_A | structure of the class ii fructose-1,6-bisphophatase from mycobacterium tuberculosis complexed with substrate f1,6bp | 0.9733 | 25 | 328 |
| 3roj-assembly1.cif.gz_B | d-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase of synechocystis sp. pcc 6803 | 0.9577 | 17 | 327 |
| 5a5l-assembly1.cif.gz_A | structure of dual function fbpase sbpase from thermosynechococcus elongatus | 0.9564 | 16 | 327 |
| 2r8t-assembly1.cif.gz_A | crystal structure of the fructose 1,6-bisphosphatase glpx from e.coli in the complex with fructose 1,6-bisphosphate | 0.9554 | 18 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WN21_138_292_3.40.190.90 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9876 | 126 | 279 | 3.40.190.90 |
| af_P9WN21_138_292_3.40.190.90 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9751 | 126 | 279 | 3.40.190.90 |
| 3rplA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9456 | 126 | 279 | 3.40.190.90 |
| 2r8tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9415 | 126 | 280 | 3.40.190.90 |
| 1ni9A01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.9283 | 17 | 328 | 3.30.540.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K3DBZ6-F1-model_v4 | Fructose-1,6-bisphosphatase class 2 (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase class 2) | 0.9992 | 123 | 234 |
GO:0005829
GO:0006071 GO:0006094 GO:0030388 GO:0042132 |
| AF-A0A2V6AHL6-F1-model_v4 | fructose-bisphosphatase (EC 3.1.3.11) | 0.9986 | 283 | 328 |
GO:0005829
GO:0006071 GO:0006094 GO:0030388 GO:0042132 |
| AF-A0A7Y0WYT6-F1-model_v4 | deleted | 0.9965 | 285 | 330 |
|
| AF-A0A2M7PVF3-F1-model_v4 | fructose-bisphosphatase (EC 3.1.3.11) | 0.9919 | 138 | 224 |
GO:0005829
GO:0006071 GO:0006094 GO:0030388 GO:0042132 |
| AF-A0A350RIR2-F1-model_v4 | Fructose-1,6-bisphosphatase class 2 (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase class 2) | 0.9914 | 125 | 256 |
GO:0005829
GO:0006071 GO:0006094 GO:0030388 GO:0042132 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar