F462087

General Info

Members Datasets Scaffolds Average Seq Length
547 340 505 342

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10152029|Ga0105240_101520292
Length 369
Sequence MVPAAEKKGLPSMDTAGEDNEQAGIRPEGAHSMPPALAVDRQAPDRNLALELVRVTEAAAMAAARWVGRGDKNGGDGAAVDAMRKLIGTVSMDGVVVIGEGEKDQAPMLYNGERVGDGTGPECDVAVDPIDGTTLMAKGMPNAIAVIAVAERGSMFDPSAVFYMEKIATGPEAADVIDITAPVQTNIQRVAKAKGGRPEDVTVVILDRPRHAELVSEVRAAGARIKFISDGDVAGAIMAARDGTGVDLLVGIGGTPEGIIAASAIACLGGTIQGRLWPRSPEEREKAEAAGHDLSRVLTTKDLVSGEDVFFCATGVTDGELLSGVRYDRSGLRTSSIVMRSKSGTIRMVDSLHQLSKLRAYASVDFDRN

Samples

Sample ID Description Type Environment
1 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
2 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
3 2643221548 Streptomyces sp. Root55 Isolate Unclassified
4 2643221576 Nocardioides sp. Root614 Isolate Unclassified
5 2643221578 Streptomyces sp. Root63 Isolate Unclassified
6 2643221590 Nocardioides sp. Root682 Isolate Unclassified
7 2643221617 Nocardioides sp. Root79 Isolate Unclassified
8 2643221620 Nocardioides sp. Root240 Isolate Unclassified
9 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
10 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
11 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
12 2738541305 Nocardioides sp. CF167 Isolate Unclassified
13 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
14 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
15 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
16 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
17 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
18 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
19 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
20 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
21 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
22 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
23 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
24 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
25 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
26 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
27 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
28 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
29 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
30 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
31 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
32 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
33 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
34 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
35 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
167 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
195 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
196 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
199 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
224 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
236 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
246 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
254 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
317 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
318 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
319 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
320 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
321 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
322 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
323 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
324 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
325 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
326 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
327 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
328 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
329 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
334 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
335 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
336 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
337 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
338 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
339 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
340 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.32
Metatranscriptomes 0
Isolates 7.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 2.74
Nodule 0
Rhizoplane 4.94
Rhizosphere 82.45
Stem 0
Stem Tuber 0.18
Unclassified 9.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10002571 3300005327 Bacteria 15122
2 Ga0070658_10004179 3300005327 Bacteria 11813
3 Ga0070658_10043928 3300005327 Bacteria 3611
4 Ga0070658_10095301 3300005327 Bacteria 2457
5 Ga0070658_10210592 3300005327 Bacteria 1642
6 Ga0070658_10211907 3300005327 Bacteria 1637
7 Ga0070683_100027111 3300005329 Bacteria 5165
8 Ga0070666_10035831 3300005335 Bacteria 3290
9 Ga0070680_100063810 3300005336 Bacteria 3018
10 Ga0070680_100191285 3300005336 Bacteria 1724
11 Ga0070682_100020716 3300005337 Bacteria 3873
12 Ga0070682_100125164 3300005337 Bacteria 1731
13 Ga0068868_100021122 3300005338 Bacteria 4902
14 Ga0068868_100111841 3300005338 Bacteria 2220
15 Ga0070660_100305612 3300005339 Bacteria 1304
16 Ga0070661_100145773 3300005344 Bacteria 1787
17 Ga0070668_100007434 3300005347 Bacteria 8130
18 Ga0070668_100142944 3300005347 Bacteria 1930
19 Ga0070669_100129871 3300005353 Bacteria 1932
20 Ga0070674_100057908 3300005356 Bacteria 2692
21 Ga0070659_100005120 3300005366 Bacteria 9404
22 Ga0070659_100312283 3300005366 Bacteria 1313
23 Ga0070667_100015311 3300005367 Bacteria 6339
24 Ga0070709_10132920 3300005434 Bacteria 1700
25 Ga0070714_100000100 3300005435 Bacteria 73241
26 Ga0070714_100022840 3300005435 Bacteria 5133
27 Ga0070713_100133198 3300005436 Bacteria 2194
28 Ga0070711_100010472 3300005439 Bacteria 5741
29 Ga0070700_100000071 3300005441 Bacteria 72381
30 Ga0070708_100381961 3300005445 Bacteria 1328
31 Ga0070663_100310982 3300005455 Bacteria 1264
32 Ga0070678_100067491 3300005456 Bacteria 2662
33 Ga0070678_100347807 3300005456 Bacteria 1274
34 Ga0070662_100305433 3300005457 Bacteria 1294
35 Ga0070685_10036277 3300005466 Bacteria 2786
36 Ga0070679_100011314 3300005530 Bacteria 8507
37 Ga0070697_100117400 3300005536 Bacteria 2223
38 Ga0070693_100006384 3300005547 Bacteria 5715
39 Ga0070665_100006227 3300005548 Bacteria 12207
40 Ga0070665_100010691 3300005548 Bacteria 9292
41 Ga0070665_100070179 3300005548 Bacteria 3510
42 Ga0070704_100033825 3300005549 Bacteria 3460
43 Ga0068855_100010594 3300005563 Bacteria 11114
44 Ga0068855_100031317 3300005563 Bacteria 6352
45 Ga0068857_100000575 3300005577 Bacteria 26864
46 Ga0068854_100089607 3300005578 Bacteria 2286
47 Ga0068856_100221286 3300005614 Bacteria 1908
48 Ga0068852_100197544 3300005616 Bacteria 1902
49 Ga0068852_100231975 3300005616 Bacteria 1760
50 Ga0068859_100119189 3300005617 Bacteria 2705
51 Ga0068859_100135758 3300005617 Bacteria 2533
52 Ga0068866_10001329 3300005718 Bacteria 10701
53 Ga0068866_10203781 3300005718 Bacteria 1184
54 Ga0068861_100004889 3300005719 Bacteria 9020
55 Ga0068870_10015215 3300005840 Bacteria 3647
56 Ga0068863_100000501 3300005841 Bacteria 39833
57 Ga0068858_100042548 3300005842 Bacteria 4212
58 Ga0068860_100000646 3300005843 Bacteria 40734
59 Ga0068860_100013199 3300005843 Bacteria 8107
60 Ga0068860_100070952 3300005843 Bacteria 3311
61 Ga0068862_100032239 3300005844 Bacteria 4427
62 Ga0081455_10006760 3300005937 Bacteria 12236
63 Ga0081455_10020972 3300005937 Bacteria 6140
64 Ga0081455_10045134 3300005937 Bacteria 3837
65 Ga0081455_10061842 3300005937 Bacteria 3149
66 Ga0081539_10022222 3300005985 Bacteria 4204
67 Ga0070717_10186315 3300006028 Bacteria 1811
68 Ga0075363_100022234 3300006048 Bacteria 3205
69 Ga0075432_10046768 3300006058 Bacteria 1520
70 Ga0075432_10072543 3300006058 Bacteria 1238
71 Ga0070712_100021057 3300006175 Bacteria 4275
72 Ga0097621_100048487 3300006237 Bacteria 3446
73 Ga0068871_100291378 3300006358 Bacteria 1430
74 Ga0075428_100020659 3300006844 Bacteria 7291
75 Ga0075428_100178561 3300006844 Bacteria 2299
76 Ga0075430_100013331 3300006846 Bacteria 7005
77 Ga0075430_100041631 3300006846 Bacteria 3886
78 Ga0075431_100068276 3300006847 Bacteria 3668
79 Ga0075433_10028251 3300006852 Bacteria 4767
80 Ga0075434_100021172 3300006871 Bacteria 6319
81 Ga0075434_100145556 3300006871 Bacteria 2390
82 Ga0075429_100010493 3300006880 Bacteria 8011
83 Ga0075429_100023706 3300006880 Bacteria 5325
84 Ga0068865_100093373 3300006881 Bacteria 2188
85 Ga0068865_100119861 3300006881 Bacteria 1954
86 Ga0075436_100007844 3300006914 Bacteria 7302
87 Ga0097620_100119184 3300006931 Bacteria 2705
88 Ga0097620_100135758 3300006931 Bacteria 2533
89 Ga0105240_10083203 3300009093 Bacteria 3928
90 Ga0105240_10108746 3300009093 Bacteria 3359
91 Ga0105240_10152029 3300009093 Bacteria 2756
92 Ga0105240_10213225 3300009093 Bacteria 2255
93 Ga0111539_10005889 3300009094 Bacteria 15836
94 Ga0111539_10069242 3300009094 Bacteria 4166
95 Ga0111539_10463350 3300009094 Bacteria 1476
96 Ga0105245_10037246 3300009098 Bacteria 4325
97 Ga0105245_10050607 3300009098 Bacteria 3724
98 Ga0105245_10230421 3300009098 Bacteria 1791
99 Ga0105245_10238972 3300009098 Bacteria 1760
100 Ga0105247_10010785 3300009101 Bacteria 5518
101 Ga0114129_10000001 3300009147 Bacteria 292978
102 Ga0114129_10000011 3300009147 Bacteria 139000
103 Ga0114129_10022337 3300009147 Bacteria 8980
104 Ga0105243_10059524 3300009148 Bacteria 3049
105 Ga0105242_10007893 3300009176 Bacteria 8190
106 Ga0105248_10017673 3300009177 Bacteria 7865
107 Ga0105237_10098867 3300009545 Bacteria 2909
108 Ga0105238_10034972 3300009551 Bacteria 5111
109 Ga0105238_10200268 3300009551 Bacteria 1972
110 Ga0105249_10009542 3300009553 Bacteria 8503
111 Ga0105035_100397 3300009988 Bacteria 2708
112 Ga0105239_10038959 3300010375 Bacteria 5206
113 Ga0105246_10101774 3300011119 Bacteria 2093
114 Ga0105246_10131361 3300011119 Bacteria 1871
115 Ga0157371_10032061 3300013102 Bacteria 3782
116 Ga0157370_10010773 3300013104 Bacteria 9612
117 Ga0157370_10054518 3300013104 Bacteria 3811
118 Ga0157369_10060752 3300013105 Bacteria 4075
119 Ga0157369_10140464 3300013105 Bacteria 2556
120 Ga0157374_10083843 3300013296 Bacteria 3028
121 Ga0157374_10245445 3300013296 Bacteria 1761
122 Ga0157378_10035336 3300013297 Bacteria 4419
123 Ga0157378_10121661 3300013297 Bacteria 2406
124 Ga0163162_10011592 3300013306 Bacteria 8597
125 Ga0157372_10001746 3300013307 Bacteria 23569
126 Ga0157372_10029416 3300013307 Bacteria 5998
127 Ga0157375_10067938 3300013308 Bacteria 3563
128 Ga0157375_10576354 3300013308 Bacteria 1286
129 Ga0157380_10017791 3300014326 Bacteria 5266
130 Ga0182008_10011923 3300014497 Bacteria 4607
131 Ga0182008_10072794 3300014497 Bacteria 1691
132 Ga0157379_10005138 3300014968 Bacteria 11230
133 Ga0157376_10146413 3300014969 Bacteria 2125
134 Ga0157376_10266690 3300014969 Bacteria 1607
135 Ga0163161_10002295 3300017792 Bacteria 13711
136 Ga0213873_10000055 3300021358 Bacteria 25297
137 Ga0213876_10045684 3300021384 Bacteria 2316
138 Ga0213875_10005541 3300021388 Bacteria 6762
139 Ga0213875_10062007 3300021388 Bacteria 1749
140 Ga0207696_1017156 3300025711 Bacteria 2404
141 Ga0207688_10000941 3300025901 Bacteria 14730
142 Ga0207680_10002698 3300025903 Bacteria 8292
143 Ga0207680_10102740 3300025903 Bacteria 1839
144 Ga0207647_10093262 3300025904 Bacteria 1794
145 Ga0207647_10131174 3300025904 Bacteria 1473
146 Ga0207699_10009414 3300025906 Bacteria 4863
147 Ga0207705_10033923 3300025909 Bacteria 3647
148 Ga0207705_10235076 3300025909 Bacteria 1395
149 Ga0207705_10241395 3300025909 Bacteria 1376
150 Ga0207654_10212842 3300025911 Bacteria 1278
151 Ga0207707_10307067 3300025912 Bacteria 1371
152 Ga0207695_10160220 3300025913 Bacteria 2182
153 Ga0207671_10279785 3300025914 Bacteria 1316
154 Ga0207693_10001318 3300025915 Bacteria 21993
155 Ga0207693_10108088 3300025915 Bacteria 2182
156 Ga0207663_10016373 3300025916 Bacteria 4110
157 Ga0207662_10104077 3300025918 Bacteria 1762
158 Ga0207662_10253670 3300025918 Bacteria 1155
159 Ga0207657_10009491 3300025919 Bacteria 9775
160 Ga0207681_10146869 3300025923 Bacteria 1763
161 Ga0207687_10087823 3300025927 Bacteria 2260
162 Ga0207664_10000002 3300025929 Bacteria 657053
163 Ga0207664_10138935 3300025929 Bacteria 2053
164 Ga0207690_10027443 3300025932 Bacteria 3598
165 Ga0207690_10136024 3300025932 Bacteria 1804
166 Ga0207706_10181755 3300025933 Bacteria 1847
167 Ga0207686_10195976 3300025934 Bacteria 1443
168 Ga0207670_10264501 3300025936 Bacteria 1335
169 Ga0207669_10370601 3300025937 Bacteria 1113
170 Ga0207704_10145105 3300025938 Bacteria 1666
171 Ga0207665_10003129 3300025939 Bacteria 11102
172 Ga0207689_10009079 3300025942 Bacteria 8608
173 Ga0207689_10061934 3300025942 Bacteria 3077
174 Ga0207661_10039494 3300025944 Bacteria 3704
175 Ga0207667_10036970 3300025949 Bacteria 5225
176 Ga0207667_10463829 3300025949 Bacteria 1286
177 Ga0207668_10008237 3300025972 Bacteria 6212
178 Ga0207658_10043005 3300025986 Bacteria 3282
179 Ga0207677_10033194 3300026023 Bacteria 3327
180 Ga0207703_10032291 3300026035 Bacteria 4143
181 Ga0207678_10088391 3300026067 Bacteria 2648
182 Ga0207708_10000029 3300026075 Bacteria 161861
183 Ga0207641_10014067 3300026088 Bacteria 6560
184 Ga0207641_10110399 3300026088 Bacteria 2437
185 Ga0207648_10251056 3300026089 Bacteria 1577
186 Ga0207674_10001857 3300026116 Bacteria 26899
187 Ga0207674_10098646 3300026116 Bacteria 2904
188 Ga0207675_100032684 3300026118 Bacteria 4846
189 Ga0207683_10004078 3300026121 Bacteria 12620
190 Ga0207683_10077668 3300026121 Bacteria 2941
191 Ga0207683_10115631 3300026121 Bacteria 2405
192 Ga0207428_10014718 3300027907 Bacteria 6779
193 Ga0207428_10022540 3300027907 Bacteria 5312
194 Ga0268266_10027110 3300028379 Bacteria 4874
195 Ga0268266_10119390 3300028379 Bacteria 2345
196 Ga0268266_10214873 3300028379 Bacteria 1765
197 Ga0268264_10000530 3300028381 Bacteria 48308
198 Ga0268264_10009405 3300028381 Bacteria 8092
199 Ga0307515_10000088 3300028794 Bacteria 215810
200 Ga0307515_10005747 3300028794 Bacteria 25062
201 Ga0307515_10020175 3300028794 Bacteria 11915
202 Ga0307512_10016907 3300030522 Bacteria 6716
203 Ga0316181_1044065 3300030744 Bacteria 1596
204 Ga0307509_10091925 3300031507 Bacteria 3104
205 Ga0307408_100154686 3300031548 Bacteria 1814
206 Ga0307508_10053527 3300031616 Bacteria 3581
207 Ga0307508_10130730 3300031616 Bacteria 2114
208 Ga0307508_10143073 3300031616 Bacteria 1995
209 Ga0307508_10244765 3300031616 Bacteria 1390
210 Ga0307514_10122442 3300031649 Bacteria 1810
211 Ga0307516_10009338 3300031730 Bacteria 10949
212 Ga0307516_10036509 3300031730 Bacteria 4917
213 Ga0307516_10069228 3300031730 Bacteria 3395
214 Ga0307405_10051056 3300031731 Bacteria 2564
215 Ga0307410_10007244 3300031852 Bacteria 6059
216 Ga0307407_10010167 3300031903 Bacteria 4424
217 Ga0307412_10539612 3300031911 Bacteria 978
218 Ga0307409_100053408 3300031995 Bacteria 3104
219 Ga0307409_100238473 3300031995 Bacteria 1654
220 Ga0307416_100194965 3300032002 Bacteria 1915
221 Ga0307411_10259162 3300032005 Bacteria 1372
222 Ga0307415_100010436 3300032126 Bacteria 5262
223 Ga0307415_100032745 3300032126 Bacteria 3366
224 Ga0307507_10096930 3300033179 Bacteria 2491
225 Ga0373940_0006858 3300035088 Bacteria 2548
226 Ga0373952_0023488 3300035092 Bacteria 1318
227 Ga0373939_0029640 3300035114 Bacteria 1567
228 Ga0373946_0045792 3300035171 Bacteria 1811
229 Ga0373962_0003315 3300035242 Bacteria 3873
230 Ga0373931_0298442 3300035691 Bacteria 994
231 Ga0395900_0021103 3300037418 Bacteria 6657
232 Ga0395900_0175999 3300037418 Bacteria 2176
233 Ga0395900_0332386 3300037418 Bacteria 1497
234 Ga0395898_0488222 3300037466 Bacteria 1172
235 Ga0436364_0005541 3300037853 Bacteria 2557
236 Ga0436364_0522243 3300037853 Bacteria 22527
237 Ga0436364_0528793 3300037853 Bacteria 6405
238 Ga0436364_1302924 3300037853 Bacteria 5832
239 Ga0395901_0027028 3300038443 Bacteria 5894
240 Ga0395901_0034091 3300038443 Bacteria 5257
241 Ga0436365_0130473 3300039437 Bacteria 5608
242 Ga0436365_1176999 3300039437 Bacteria 2363
243 Ga0436363_1491085 3300039450 Bacteria 1150
244 Ga0436362_1300112 3300039453 Bacteria 63878
245 Ga0439439_0032932 3300041406 Bacteria 1325
246 Ga0451793_0603958 3300041452 Bacteria 11316
247 Ga0451807_2443037 3300041486 Bacteria 2119
248 Ga0451833_0361120 3300041491 Bacteria 5167
249 Ga0451833_0991290 3300041491 Bacteria 3302
250 Ga0451843_1203602 3300041509 Bacteria 3378
251 Ga0451853_3248538 3300041512 Bacteria 10764
252 Ga0439449_0001239 3300042007 Bacteria 10006
253 Ga0439464_0030652 3300042439 Bacteria 1507
254 Ga0466972_0015874 3300044658 Bacteria 3765
255 Ga0466972_0115961 3300044658 Bacteria 1264
256 Ga0466965_0010511 3300044683 Bacteria 4322
257 Ga0466965_0069545 3300044683 Bacteria 1769
258 Ga0466966_0002733 3300044684 Bacteria 11586
259 Ga0466966_0011711 3300044684 Bacteria 5815
260 Ga0466966_0085082 3300044684 Bacteria 1966
261 Ga0466966_0095505 3300044684 Bacteria 1842
262 Ga0466966_0098602 3300044684 Bacteria 1809
263 Ga0466961_0122932 3300044693 Bacteria 1629
264 Ga0466963_0001454 3300044694 Bacteria 12773
265 Ga0466963_0001502 3300044694 Bacteria 12623
266 Ga0466963_0001927 3300044694 Bacteria 11358
267 Ga0466963_0004764 3300044694 Bacteria 7911
268 Ga0466963_0043317 3300044694 Bacteria 2959
269 Ga0466963_0070313 3300044694 Bacteria 2354
270 Ga0466963_0081455 3300044694 Bacteria 2192
271 Ga0466963_0106794 3300044694 Bacteria 1920
272 Ga0466963_0257594 3300044694 Bacteria 1225
273 Ga0466968_0019078 3300044735 Bacteria 2757
274 Ga0466970_0007430 3300044765 Bacteria 5491
275 Ga0466970_0008918 3300044765 Bacteria 5058
276 Ga0466970_0182838 3300044765 Bacteria 1163
277 Ga0466957_0000398 3300044842 Bacteria 21209
278 Ga0466957_0038708 3300044842 Bacteria 2874
279 Ga0466957_0057316 3300044842 Bacteria 2384
280 Ga0466960_0012861 3300044901 Bacteria 3543
281 Ga0466960_0017309 3300044901 Bacteria 3140
282 Ga0466960_0023774 3300044901 Bacteria 2755
283 Ga0466959_0001790 3300045049 Bacteria 13433
284 Ga0466959_0077858 3300045049 Bacteria 2392
285 Ga0466958_0000850 3300045836 Bacteria 13567
286 Ga0466958_0006064 3300045836 Bacteria 6553
287 Ga0466967_0002518 3300045976 Bacteria 11459
288 Ga0466967_0021502 3300045976 Bacteria 5243
289 Ga0466967_0022687 3300045976 Bacteria 5128
290 Ga0466967_0024563 3300045976 Bacteria 4957
291 Ga0466967_0031168 3300045976 Bacteria 4485
292 Ga0466967_0052107 3300045976 Bacteria 3590
293 Ga0466967_0060288 3300045976 Bacteria 3362
294 Ga0466967_0065320 3300045976 Bacteria 3238
295 Ga0466967_0075238 3300045976 Bacteria 3035
296 Ga0466967_0108145 3300045976 Bacteria 2551
297 Ga0466967_0128919 3300045976 Bacteria 2346
298 Ga0466967_0182311 3300045976 Bacteria 1981
299 Ga0466967_0263158 3300045976 Bacteria 1650
300 Ga0466967_0273227 3300045976 Bacteria 1620
301 Ga0495627_051707 3300046453 Bacteria 1234
302 Ga0495603_0150111 3300046455 Bacteria 1354
303 Ga0495638_0070098 3300046460 Bacteria 2147
304 Ga0495638_0120781 3300046460 Bacteria 1549
305 Ga0495580_0075503 3300046472 Bacteria 2351
306 Ga0495662_0000926 3300046476 Bacteria 14345
307 Ga0495662_0109601 3300046476 Bacteria 1352
308 Ga0495662_0147523 3300046476 Bacteria 1158
309 Ga0495664_0005623 3300046477 Bacteria 6892
310 Ga0495585_0005584 3300046492 Bacteria 7901
311 Ga0495594_0002599 3300046499 Bacteria 9383
312 Ga0495607_0085623 3300046501 Bacteria 1721
313 Ga0495583_0028250 3300046506 Bacteria 2760
314 Ga0495608_0009188 3300046511 Bacteria 6911
315 Ga0495620_0068781 3300046515 Bacteria 1453
316 Ga0495628_0014685 3300046516 Bacteria 6558
317 Ga0495637_0038544 3300046520 Bacteria 2068
318 Ga0495643_0006590 3300046522 Bacteria 7632
319 Ga0495666_0003531 3300046526 Bacteria 7895
320 Ga0495665_0005792 3300046531 Bacteria 6668
321 Ga0495640_0010941 3300046533 Bacteria 6992
322 Ga0495640_0021459 3300046533 Bacteria 4738
323 Ga0495586_0003398 3300046535 Bacteria 8536
324 Ga0495587_0067723 3300046536 Bacteria 2080
325 Ga0495587_0179272 3300046536 Bacteria 1202
326 Ga0495598_0098735 3300046537 Bacteria 963
327 Ga0495622_0014252 3300046557 Bacteria 3692
328 Ga0495667_0015255 3300046559 Bacteria 5188
329 Ga0495656_0022000 3300046615 Bacteria 2491
330 Ga0495656_0044724 3300046615 Bacteria 1866
331 Ga0495611_0089041 3300046648 Bacteria 1425
332 Ga0495588_0038485 3300046674 Bacteria 2433
333 Ga0495588_0105136 3300046674 Bacteria 1485
334 Ga0495599_0099807 3300046678 Bacteria 1809
335 Ga0495669_0109471 3300046684 Bacteria 1289
336 Ga0495613_0009131 3300046689 Bacteria 7352
337 Ga0495613_0012112 3300046689 Bacteria 6409
338 Ga0495613_0105233 3300046689 Bacteria 2037
339 Ga0495613_0165598 3300046689 Bacteria 1571
340 Ga0495670_0001259 3300046691 Bacteria 12383
341 Ga0495670_0087230 3300046691 Bacteria 1594
342 Ga0495670_0112015 3300046691 Bacteria 1413
343 Ga0495589_0012158 3300046794 Bacteria 4463
344 Ga0495660_0021129 3300046810 Bacteria 3730
345 Ga0495660_0087562 3300046810 Bacteria 1624
346 Ga0495581_0014046 3300047315 Bacteria 4643
347 Ga0495581_0081810 3300047315 Bacteria 1870
348 Ga0495604_0003003 3300047317 Bacteria 13500
349 Ga0495604_0015964 3300047317 Bacteria 5995
350 Ga0495636_0042508 3300047318 Bacteria 1889
351 Ga0495674_0070038 3300047319 Bacteria 3031
352 Ga0495676_0188180 3300047321 Bacteria 1442
353 Ga0495675_0019073 3300047444 Bacteria 4356
354 Ga0495675_0040841 3300047444 Bacteria 2957
355 Ga0495677_0018581 3300047445 Bacteria 2519
356 Ga0495685_000133 3300047447 Bacteria 25839
357 Ga0495681_0001292 3300047470 Bacteria 18958
358 Ga0495686_0033794 3300047472 Bacteria 3299
359 Ga0495593_0058280 3300047673 Bacteria 2026
360 Ga0495593_0061602 3300047673 Bacteria 1962
361 Ga0495614_0001285 3300048089 Bacteria 10806
362 Ga0496101_0126841 3300048904 Bacteria 1934
363 Ga0496101_0350934 3300048904 Bacteria 1159
364 Ga0496102_0001153 3300048905 Bacteria 24147
365 Ga0496102_0011487 3300048905 Bacteria 7636
366 Ga0496102_0015193 3300048905 Bacteria 6702
367 Ga0496103_0077361 3300048906 Bacteria 2088
368 Ga0496104_0141551 3300048907 Bacteria 2311
369 Ga0496104_0308320 3300048907 Bacteria 1496
370 Ga0496105_0003371 3300048908 Bacteria 11808
371 Ga0496105_0416042 3300048908 Bacteria 1065
372 Ga0496107_0115758 3300048910 Bacteria 1973
373 Ga0496108_0070505 3300048911 Bacteria 2949
374 Ga0496108_0113845 3300048911 Bacteria 2315
375 Ga0496109_0003619 3300048912 Bacteria 12922
376 Ga0496109_0035105 3300048912 Bacteria 4521
377 Ga0496110_0035847 3300048913 Bacteria 4307
378 Ga0496110_0055580 3300048913 Bacteria 3483
379 Ga0496110_0218836 3300048913 Bacteria 1731
380 Ga0496110_0287026 3300048913 Bacteria 1498
381 Ga0496112_0002691 3300048915 Bacteria 14366
382 Ga0496112_0035503 3300048915 Bacteria 4857
383 Ga0496112_0071118 3300048915 Bacteria 3439
384 Ga0496113_0006068 3300048916 Bacteria 7617
385 Ga0496114_0002375 3300048917 Bacteria 14331
386 Ga0496115_0003667 3300048918 Bacteria 11052
387 Ga0496119_0000125 3300048922 Bacteria 108373
388 Ga0496120_0000695 3300048923 Bacteria 49341
389 Ga0501031_0115908 3300049568 Bacteria 1750
390 Ga0501031_0130385 3300049568 Bacteria 1643
391 Ga0501032_0012126 3300049569 Bacteria 6170
392 Ga0501032_0217991 3300049569 Bacteria 1242
393 Ga0501033_0008599 3300049570 Bacteria 7901
394 Ga0501033_0023846 3300049570 Bacteria 4615
395 Ga0501033_0050660 3300049570 Bacteria 3079
396 Ga0501034_0007333 3300049571 Bacteria 11748
397 Ga0501034_0015676 3300049571 Bacteria 7782
398 Ga0501034_0153286 3300049571 Bacteria 2280
399 Ga0501036_0012063 3300049572 Bacteria 7161
400 Ga0501036_0015369 3300049572 Bacteria 6392
401 Ga0501036_0039797 3300049572 Bacteria 3977
402 Ga0501036_0076055 3300049572 Bacteria 2840
403 Ga0501037_0011964 3300049573 Bacteria 6392
404 Ga0501037_0013360 3300049573 Bacteria 6050
405 Ga0501037_0033781 3300049573 Bacteria 3777
406 Ga0501038_0000471 3300049574 Bacteria 35396
407 Ga0501038_0002494 3300049574 Bacteria 17131
408 Ga0501038_0009405 3300049574 Bacteria 8968
409 Ga0501038_0018948 3300049574 Bacteria 6210
410 Ga0501039_0016284 3300049575 Bacteria 5695
411 Ga0501039_0047923 3300049575 Bacteria 3303
412 Ga0501039_0109998 3300049575 Bacteria 2154
413 Ga0501040_0010606 3300049576 Bacteria 6025
414 Ga0501040_0030212 3300049576 Bacteria 3660
415 Ga0501041_0000679 3300049577 Bacteria 18043
416 Ga0501042_0055823 3300049578 Bacteria 2818
417 Ga0501043_0005544 3300049579 Bacteria 10180
418 Ga0501043_0076409 3300049579 Bacteria 2631
419 Ga0501043_0090324 3300049579 Bacteria 2408
420 Ga0501046_0000383 3300049580 Bacteria 44303
421 Ga0501046_0041235 3300049580 Bacteria 3684
422 Ga0501046_0132657 3300049580 Bacteria 1888
423 Ga0501047_0002816 3300049581 Bacteria 16511
424 Ga0501047_0004082 3300049581 Bacteria 13735
425 Ga0501047_0010581 3300049581 Bacteria 8724
426 Ga0501047_0077092 3300049581 Bacteria 3207
427 Ga0501048_0005189 3300049582 Bacteria 9921
428 Ga0501048_0006173 3300049582 Bacteria 9119
429 Ga0501048_0083234 3300049582 Bacteria 2256
430 Ga0501048_0147690 3300049582 Bacteria 1663
431 Ga0501048_0298391 3300049582 Bacteria 1146
432 Ga0501067_0000518 3300049583 Bacteria 21114
433 Ga0501067_0004199 3300049583 Bacteria 7952
434 Ga0501067_0024484 3300049583 Bacteria 3348
435 Ga0501067_0042614 3300049583 Bacteria 2520
436 Ga0501067_0130520 3300049583 Bacteria 1398
437 Ga0501068_0002033 3300049584 Bacteria 10778
438 Ga0501069_0156959 3300049585 Bacteria 1309
439 Ga0501070_0002118 3300049586 Bacteria 17407
440 Ga0501070_0107233 3300049586 Bacteria 2308
441 Ga0501071_0000762 3300049587 Bacteria 17091
442 Ga0501072_0001374 3300049588 Bacteria 18276
443 Ga0501072_0273002 3300049588 Bacteria 1345
444 Ga0501073_0014911 3300049589 Bacteria 5639
445 Ga0501073_0088646 3300049589 Bacteria 2151
446 Ga0501073_0260024 3300049589 Bacteria 1198
447 Ga0501074_0102317 3300049590 Bacteria 2050
448 Ga0501074_0182095 3300049590 Bacteria 1498
449 Ga0501076_0089568 3300049592 Bacteria 2473
450 Ga0501077_0034240 3300049593 Bacteria 3232
451 Ga0501077_0088351 3300049593 Bacteria 1964
452 Ga0501221_021181 3300049704 Bacteria 1277
453 Ga0501079_0006612 3300049741 Bacteria 8725
454 Ga0501079_0023409 3300049741 Bacteria 4740
455 Ga0501080_0025423 3300049742 Bacteria 5495
456 Ga0501080_0140412 3300049742 Bacteria 2234
457 Ga0501083_0005784 3300049744 Bacteria 8755
458 Ga0501035_0010403 3300049822 Bacteria 8623
459 Ga0501035_0146391 3300049822 Bacteria 2051
460 Ga0501035_0306983 3300049822 Bacteria 1335
461 Ga0501044_0048397 3300049823 Bacteria 4392
462 Ga0501044_0079363 3300049823 Bacteria 3325
463 Ga0501044_0085434 3300049823 Bacteria 3188
464 Ga0501045_0001401 3300049824 Bacteria 16093
465 Ga0501045_0307231 3300049824 Bacteria 1180
466 nmdc:mga03n38_14638_c1 3300050490 Bacteria 3011
467 nmdc:mga05p37_1189_c1 3300050507 Bacteria 30061
468 nmdc:mga05p37_22178_c1 3300050507 Bacteria 7698
469 nmdc:mga09592_233_c1 3300050508 Bacteria 23820
470 nmdc:mga0qj67_144995_c1 3300050509 Bacteria 1925
471 nmdc:mga0qj67_19422_c1 3300050509 Bacteria 5191
472 nmdc:mga0qj67_275_c1 3300050509 Bacteria 35760
473 nmdc:mga0qj67_45216_c1 3300050509 Bacteria 3474
474 nmdc:mga06r32_169_c1 3300050510 Bacteria 50248
475 nmdc:mga06r32_4561_c1 3300050510 Bacteria 8457
476 nmdc:mga08y16_22909_c1 3300050511 Bacteria 6592
477 nmdc:mga08y16_380893_c1 3300050511 Bacteria 1446
478 nmdc:mga08y16_88870_c1 3300050511 Bacteria 3220
479 nmdc:mga0n895_88197_c1 3300050512 Bacteria 3102
480 nmdc:mga0rr50_29935_c1 3300050513 Bacteria 3847
481 nmdc:mga08x19_31945_c1 3300050514 Bacteria 3316
482 nmdc:mga0a205_30421_c1 3300050515 Bacteria 5170
483 Ga0495612_0074325 3300053078 Bacteria 1421
484 Ga0500578_0031007 3300053086 Bacteria 3435
485 Ga0500643_001854 3300053087 Bacteria 11539
486 Ga0500654_020895 3300053099 Bacteria 4185
487 Ga0500569_009784 3300053109 Bacteria 2237
488 Ga0500614_010502 3300053123 Bacteria 1989
489 Ga0500621_026732 3300053126 Bacteria 2267
490 Ga0500652_006446 3300053131 Bacteria 3777
491 Ga0500658_0003265 3300053134 Bacteria 6159
492 Ga0500579_088696 3300053143 Bacteria 1684
493 Ga0500600_0030685 3300053149 Bacteria 3162
494 Ga0500616_0003280 3300053153 Bacteria 12491
495 Ga0500656_001643 3300053732 Bacteria 1949
496 Ga0500587_002331 3300053739 Bacteria 2696
497 Ga0501084_0043180 3300054114 Bacteria 3771
498 Ga0501084_0178234 3300054114 Bacteria 1794
499 Ga0501082_0004519 3300060353 Bacteria 12147
500 Ga0501082_0169154 3300060353 Bacteria 1900
501 Ga0466962_0008836 3300061719 Bacteria 4828
502 Ga0466962_0048291 3300061719 Bacteria 2034
503 Ga0530510_0022871 3300061734 Bacteria 4455
504 Ga0530510_0155973 3300061734 Bacteria 1687
505 Ga0530510_0215846 3300061734 Bacteria 1425

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035691 Ga0373931_0298442 Ga0373931_0298442_32_880 281
2 3300046537 Ga0495598_0098735 Ga0495598_0098735_47_952 301
3 3300037853 Ga0436364_0005541 Ga0436364_0005541_523_1452 306
4 3300005436 Ga0070713_100133198 Ga0070713_1001331983 307
5 3300025915 Ga0207693_10108088 Ga0207693_101080883 307
6 3300025929 Ga0207664_10138935 Ga0207664_101389352 307
7 3300044765 Ga0466970_0182838 Ga0466970_0182838_13_969 307
8 3300030744 Ga0316181_1044065 Ga0316181_10440652 308
9 3300037466 Ga0395898_0488222 Ga0395898_0488222_224_1156 308
10 3300044684 Ga0466966_0095505 Ga0466966_0095505_15_953 308
11 3300048904 Ga0496101_0350934 Ga0496101_0350934_29_961 308
12 3300049571 Ga0501034_0153286 Ga0501034_0153286_1312_2265 308
13 3300050509 nmdc:mga0qj67_144995_c1 nmdc:mga0qj67_144995_c1_16_960 308
14 3300044684 Ga0466966_0098602 Ga0466966_0098602_14_943 309
15 3300044694 Ga0466963_0001502 Ga0466963_0001502_3375_4430 309
16 3300045976 Ga0466967_0021502 Ga0466967_0021502_23_970 309
17 3300031911 Ga0307412_10539612 Ga0307412_105396121 310
18 3300046515 Ga0495620_0068781 Ga0495620_0068781_507_1439 310
19 3300046536 Ga0495587_0067723 Ga0495587_0067723_12_944 310
20 3300031548 Ga0307408_100154686 Ga0307408_1001546862 313
21 3300041491 Ga0451833_0361120 Ga0451833_0361120_3301_4275 313
22 3300049704 Ga0501221_021181 Ga0501221_021181_187_1140 313
23 3300009098 Ga0105245_10230421 Ga0105245_102304212 314
24 3300049583 Ga0501067_0130520 Ga0501067_0130520_122_1117 315
25 3300049586 Ga0501070_0107233 Ga0501070_0107233_1006_2001 315
26 3300049588 Ga0501072_0273002 Ga0501072_0273002_216_1211 315
27 3300049590 Ga0501074_0182095 Ga0501074_0182095_194_1189 315
28 3300049593 Ga0501077_0088351 Ga0501077_0088351_188_1183 315
29 3300054114 Ga0501084_0178234 Ga0501084_0178234_97_1092 315
30 3300060353 Ga0501082_0169154 Ga0501082_0169154_681_1676 315
31 3300045976 Ga0466967_0052107 Ga0466967_0052107_2144_3139 317
32 3300044683 Ga0466965_0069545 Ga0466965_0069545_720_1733 318
33 3300044735 Ga0466968_0019078 Ga0466968_0019078_642_1613 318
34 3300044765 Ga0466970_0007430 Ga0466970_0007430_2559_3530 318
35 3300045049 Ga0466959_0077858 Ga0466959_0077858_434_1405 318
36 3300045976 Ga0466967_0031168 Ga0466967_0031168_1445_2416 318
37 3300045976 Ga0466967_0263158 Ga0466967_0263158_598_1605 318
38 3300009093 Ga0105240_10108746 Ga0105240_101087462 319
39 3300037418 Ga0395900_0175999 Ga0395900_0175999_1123_2136 320
40 3300061734 Ga0530510_0215846 Ga0530510_0215846_50_1015 321
41 3300041406 Ga0439439_0032932 Ga0439439_0032932_334_1305 322
42 3300044842 Ga0466957_0038708 Ga0466957_0038708_1267_2295 323
43 3300014497 Ga0182008_10072794 Ga0182008_100727941 324
44 3300048915 Ga0496112_0071118 Ga0496112_0071118_99_1073 324
45 3300032002 Ga0307416_100194965 Ga0307416_1001949652 325
46 3300032005 Ga0307411_10259162 Ga0307411_102591622 325
47 3300014497 Ga0182008_10011923 Ga0182008_100119231 326
48 3300021388 Ga0213875_10005541 Ga0213875_100055414 326
49 3300037418 Ga0395900_0332386 Ga0395900_0332386_447_1460 326
50 3300037853 Ga0436364_1302924 Ga0436364_1302924_4156_5154 326
51 3300039450 Ga0436363_1491085 Ga0436363_1491085_72_1070 326
52 3300005937 Ga0081455_10061842 Ga0081455_100618422 328
53 3300046536 Ga0495587_0179272 Ga0495587_0179272_82_1071 328
54 3300046615 Ga0495656_0044724 Ga0495656_0044724_215_1201 328
55 3300005563 Ga0068855_100031317 Ga0068855_1000313177 329
56 3300006871 Ga0075434_100145556 Ga0075434_1001455563 329
57 3300025904 Ga0207647_10131174 Ga0207647_101311742 329
58 iso_pu_bacteria 2861520306 2861524636 329
59 iso_pu_bacteria 8057568493 8057569656 329
60 3300005337 Ga0070682_100125164 Ga0070682_1001251641 330
61 3300005347 Ga0070668_100142944 Ga0070668_1001429442 330
62 3300005455 Ga0070663_100310982 Ga0070663_1003109821 330
63 3300005456 Ga0070678_100347807 Ga0070678_1003478071 330
64 3300005617 Ga0068859_100135758 Ga0068859_1001357583 330
65 3300006931 Ga0097620_100135758 Ga0097620_1001357582 330
66 3300009094 Ga0111539_10005889 Ga0111539_1000588913 330
67 3300014969 Ga0157376_10146413 Ga0157376_101464132 330
68 3300025918 Ga0207662_10104077 Ga0207662_101040772 330
69 3300025934 Ga0207686_10195976 Ga0207686_101959762 330
70 3300026118 Ga0207675_100032684 Ga0207675_1000326842 330
71 3300026121 Ga0207683_10077668 Ga0207683_100776683 330
72 3300026121 Ga0207683_10115631 Ga0207683_101156312 330
73 3300027907 Ga0207428_10022540 Ga0207428_100225403 330
74 3300041452 Ga0451793_0603958 Ga0451793_0603958_847_1839 330
75 3300041486 Ga0451807_2443037 Ga0451807_2443037_408_1400 330
76 3300041491 Ga0451833_0991290 Ga0451833_0991290_1190_2182 330
77 3300041509 Ga0451843_1203602 Ga0451843_1203602_177_1169 330
78 3300041512 Ga0451853_3248538 Ga0451853_3248538_5116_6108 330
79 3300046453 Ga0495627_051707 Ga0495627_051707_42_1037 330
80 3300046648 Ga0495611_0089041 Ga0495611_0089041_163_1158 330
81 3300046691 Ga0495670_0087230 Ga0495670_0087230_55_1050 330
82 3300047318 Ga0495636_0042508 Ga0495636_0042508_819_1814 330
83 3300047445 Ga0495677_0018581 Ga0495677_0018581_1236_2231 330
84 3300048908 Ga0496105_0416042 Ga0496105_0416042_52_1050 330
85 3300050511 nmdc:mga08y16_88870_c1 nmdc:mga08y16_88870_c1_1921_2916 330
86 3300005327 Ga0070658_10211907 Ga0070658_102119072 331
87 3300005329 Ga0070683_100027111 Ga0070683_1000271114 331
88 3300005577 Ga0068857_100000575 Ga0068857_10000057527 331
89 3300005937 Ga0081455_10020972 Ga0081455_100209727 331
90 3300006844 Ga0075428_100178561 Ga0075428_1001785612 331
91 3300009094 Ga0111539_10069242 Ga0111539_100692424 331
92 3300011119 Ga0105246_10131361 Ga0105246_101313612 331
93 3300025904 Ga0207647_10093262 Ga0207647_100932621 331
94 3300025942 Ga0207689_10061934 Ga0207689_100619342 331
95 3300025944 Ga0207661_10039494 Ga0207661_100394944 331
96 3300026116 Ga0207674_10001857 Ga0207674_1000185727 331
97 3300027907 Ga0207428_10014718 Ga0207428_100147184 331
98 3300044694 Ga0466963_0257594 Ga0466963_0257594_55_1062 331
99 3300046520 Ga0495637_0038544 Ga0495637_0038544_929_1927 331
100 3300046615 Ga0495656_0022000 Ga0495656_0022000_191_1189 331
101 3300046684 Ga0495669_0109471 Ga0495669_0109471_55_1053 331
102 3300046810 Ga0495660_0087562 Ga0495660_0087562_350_1348 331
103 3300048907 Ga0496104_0141551 Ga0496104_0141551_1111_2106 331
104 3300048912 Ga0496109_0003619 Ga0496109_0003619_3214_4209 331
105 3300048913 Ga0496110_0218836 Ga0496110_0218836_551_1546 331
106 3300048915 Ga0496112_0002691 Ga0496112_0002691_577_1572 331
107 3300048916 Ga0496113_0006068 Ga0496113_0006068_4463_5458 331
108 3300049583 Ga0501067_0042614 Ga0501067_0042614_614_1612 331
109 3300050509 nmdc:mga0qj67_45216_c1 nmdc:mga0qj67_45216_c1_1284_2297 331
110 3300050511 nmdc:mga08y16_22909_c1 nmdc:mga08y16_22909_c1_2836_3834 331
111 iso_pu_bacteria 2643221576 2643890217 331
112 iso_pu_bacteria 2643221590 2643959273 331
113 iso_pu_bacteria 2643221617 2644098206 331
114 iso_pu_bacteria 2643221620 2644119066 331
115 iso_pu_bacteria 2738541305 2738870016 331
116 3300025936 Ga0207670_10264501 Ga0207670_102645012 332
117 3300025937 Ga0207669_10370601 Ga0207669_103706011 332
118 3300049570 Ga0501033_0023846 Ga0501033_0023846_1666_2673 332
119 iso_pu_bacteria 2899370129 2899370393 332
120 iso_pu_bacteria 2915358134 2915363939 332
121 3300009098 Ga0105245_10238972 Ga0105245_102389722 333
122 3300026067 Ga0207678_10088391 Ga0207678_100883913 333
123 3300028794 Ga0307515_10005747 Ga0307515_1000574715 333
124 3300048913 Ga0496110_0035847 Ga0496110_0035847_55_1062 333
125 iso_pu_bacteria 8054472261 8054476665 333
126 3300005985 Ga0081539_10022222 Ga0081539_100222224 334
127 3300006844 Ga0075428_100020659 Ga0075428_1000206592 334
128 3300006846 Ga0075430_100013331 Ga0075430_1000133318 334
129 3300006880 Ga0075429_100023706 Ga0075429_1000237062 334
130 3300009147 Ga0114129_10000001 Ga0114129_10000001147 334
131 3300009147 Ga0114129_10000011 Ga0114129_10000011118 334
132 3300031616 Ga0307508_10244765 Ga0307508_102447652 334
133 3300044694 Ga0466963_0106794 Ga0466963_0106794_411_1421 334
134 3300044765 Ga0466970_0008918 Ga0466970_0008918_1639_2649 334
135 3300050507 nmdc:mga05p37_1189_c1 nmdc:mga05p37_1189_c1_9200_10249 334
136 3300050507 nmdc:mga05p37_22178_c1 nmdc:mga05p37_22178_c1_6468_7487 334
137 3300050508 nmdc:mga09592_233_c1 nmdc:mga09592_233_c1_5946_6965 334
138 3300050509 nmdc:mga0qj67_19422_c1 nmdc:mga0qj67_19422_c1_350_1378 334
139 3300050509 nmdc:mga0qj67_275_c1 nmdc:mga0qj67_275_c1_1222_2241 334
140 3300050510 nmdc:mga06r32_169_c1 nmdc:mga06r32_169_c1_20122_21141 334
141 iso_pu_bacteria 8033684223 8033688982 334
142 3300009094 Ga0111539_10463350 Ga0111539_104633502 335
143 3300025909 Ga0207705_10241395 Ga0207705_102413952 335
144 3300028794 Ga0307515_10000088 Ga0307515_1000008843 335
145 3300028794 Ga0307515_10020175 Ga0307515_100201755 335
146 3300031730 Ga0307516_10009338 Ga0307516_100093388 335
147 3300031730 Ga0307516_10036509 Ga0307516_100365092 335
148 3300031731 Ga0307405_10051056 Ga0307405_100510562 335
149 3300031903 Ga0307407_10010167 Ga0307407_100101674 335
150 3300031995 Ga0307409_100053408 Ga0307409_1000534084 335
151 3300032126 Ga0307415_100010436 Ga0307415_1000104362 335
152 3300042439 Ga0439464_0030652 Ga0439464_0030652_146_1198 335
153 3300046674 Ga0495588_0105136 Ga0495588_0105136_254_1273 335
154 3300050511 nmdc:mga08y16_380893_c1 nmdc:mga08y16_380893_c1_190_1209 335
155 3300005327 Ga0070658_10095301 Ga0070658_100953012 336
156 3300005337 Ga0070682_100020716 Ga0070682_1000207162 336
157 3300005338 Ga0068868_100111841 Ga0068868_1001118411 336
158 3300005548 Ga0070665_100006227 Ga0070665_10000622713 336
159 3300005616 Ga0068852_100231975 Ga0068852_1002319752 336
160 3300005843 Ga0068860_100013199 Ga0068860_10001319910 336
161 3300013296 Ga0157374_10083843 Ga0157374_100838432 336
162 3300013308 Ga0157375_10576354 Ga0157375_105763541 336
163 3300021358 Ga0213873_10000055 Ga0213873_100000554 336
164 3300021384 Ga0213876_10045684 Ga0213876_100456842 336
165 3300025918 Ga0207662_10253670 Ga0207662_102536701 336
166 3300025932 Ga0207690_10136024 Ga0207690_101360242 336
167 3300025986 Ga0207658_10043005 Ga0207658_100430054 336
168 3300026023 Ga0207677_10033194 Ga0207677_100331941 336
169 3300028379 Ga0268266_10027110 Ga0268266_100271102 336
170 3300028381 Ga0268264_10009405 Ga0268264_100094051 336
171 3300037853 Ga0436364_0522243 Ga0436364_0522243_13392_14426 336
172 3300039437 Ga0436365_0130473 Ga0436365_0130473_1900_2934 336
173 3300039453 Ga0436362_1300112 Ga0436362_1300112_3084_4118 336
174 3300044684 Ga0466966_0002733 Ga0466966_0002733_5902_6936 336
175 3300044694 Ga0466963_0001454 Ga0466963_0001454_7277_8311 336
176 3300044842 Ga0466957_0000398 Ga0466957_0000398_16700_17734 336
177 3300045049 Ga0466959_0001790 Ga0466959_0001790_11145_12179 336
178 3300045836 Ga0466958_0000850 Ga0466958_0000850_7323_8357 336
179 3300045976 Ga0466967_0022687 Ga0466967_0022687_2828_3862 336
180 3300045976 Ga0466967_0075238 Ga0466967_0075238_834_1868 336
181 3300005327 Ga0070658_10004179 Ga0070658_1000417911 337
182 3300005336 Ga0070680_100063810 Ga0070680_1000638103 337
183 3300005344 Ga0070661_100145773 Ga0070661_1001457732 337
184 3300005366 Ga0070659_100312283 Ga0070659_1003122831 337
185 3300005466 Ga0070685_10036277 Ga0070685_100362774 337
186 3300005530 Ga0070679_100011314 Ga0070679_1000113146 337
187 3300005718 Ga0068866_10203781 Ga0068866_102037811 337
188 3300006058 Ga0075432_10072543 Ga0075432_100725431 337
189 3300006881 Ga0068865_100119861 Ga0068865_1001198612 337
190 3300009093 Ga0105240_10083203 Ga0105240_100832033 337
191 3300013104 Ga0157370_10054518 Ga0157370_100545182 337
192 3300013105 Ga0157369_10140464 Ga0157369_101404642 337
193 3300025912 Ga0207707_10307067 Ga0207707_103070671 337
194 3300026089 Ga0207648_10251056 Ga0207648_102510561 337
195 3300026116 Ga0207674_10098646 Ga0207674_100986463 337
196 3300044658 Ga0466972_0015874 Ga0466972_0015874_705_1754 337
197 3300044683 Ga0466965_0010511 Ga0466965_0010511_1762_2811 337
198 3300044901 Ga0466960_0017309 Ga0466960_0017309_773_1822 337
199 3300048907 Ga0496104_0308320 Ga0496104_0308320_373_1398 337
200 3300005616 Ga0068852_100197544 Ga0068852_1001975442 338
201 3300006048 Ga0075363_100022234 Ga0075363_1000222342 338
202 3300031616 Ga0307508_10130730 Ga0307508_101307302 338
203 3300048905 Ga0496102_0015193 Ga0496102_0015193_3360_4385 338
204 3300049579 Ga0501043_0076409 Ga0501043_0076409_475_1500 338
205 3300049580 Ga0501046_0000383 Ga0501046_0000383_5228_6253 338
206 3300050490 nmdc:mga03n38_14638_c1 nmdc:mga03n38_14638_c1_25_1044 338
207 iso_pu_bacteria 2767802112 2768646568 338
208 iso_pu_bacteria 2990044586 2990048410 338
209 3300005937 Ga0081455_10006760 Ga0081455_100067606 339
210 3300005937 Ga0081455_10045134 Ga0081455_100451344 339
211 3300037418 Ga0395900_0021103 Ga0395900_0021103_1074_2102 339
212 iso_pu_bacteria 2582581312 2585296277 339
213 iso_pu_bacteria 2616644941 2616900238 339
214 iso_pu_bacteria 2643221548 2643763718 339
215 iso_pu_bacteria 2643221578 2643903292 339
216 iso_pu_bacteria 2643221673 2644404197 339
217 iso_pu_bacteria 2643221682 2644461847 339
218 iso_pu_bacteria 2731639228 2731905640 339
219 iso_pu_bacteria 2784132148 2784590075 339
220 iso_pu_bacteria 2799112218 2799185526 339
221 iso_pu_bacteria 2802429296 2804845090 339
222 iso_pu_bacteria 2808606982 2811844740 339
223 iso_pu_bacteria 2818991463 2819694917 339
224 iso_pu_bacteria 2862178590 2862185000 339
225 iso_pu_bacteria 2867346516 2867350307 339
226 iso_pu_bacteria 2873151551 2873154390 339
227 iso_pu_bacteria 2875391855 2875396367 339
228 iso_pu_bacteria 2912757875 2912762465 339
229 iso_pu_bacteria 2946045630 2946048226 339
230 iso_pu_bacteria 2966598605 2966601149 339
231 iso_pu_bacteria 2990088156 2990089185 339
232 iso_pu_bacteria 3006425503 3006429543 339
233 iso_pu_bacteria 3006493962 3006498714 339
234 iso_pu_bacteria 8025413630 8025417954 339
235 iso_pu_bacteria 8025530807 8025537622 339
236 3300044658 Ga0466972_0115961 Ga0466972_0115961_128_1159 340
237 3300048905 Ga0496102_0011487 Ga0496102_0011487_6482_7513 340
238 3300048911 Ga0496108_0113845 Ga0496108_0113845_515_1546 340
239 3300048913 Ga0496110_0287026 Ga0496110_0287026_50_1081 340
240 3300049583 Ga0501067_0004199 Ga0501067_0004199_6824_7855 340
241 3300049585 Ga0501069_0156959 Ga0501069_0156959_41_1072 340
242 3300053078 Ga0495612_0074325 Ga0495612_0074325_349_1398 340
243 iso_pu_bacteria 2862705112 2862708292 340
244 iso_pu_bacteria 8008485437 8008491272 340
245 iso_pu_bacteria 8025524527 8025530601 340
246 3300005327 Ga0070658_10210592 Ga0070658_102105922 341
247 3300005336 Ga0070680_100191285 Ga0070680_1001912852 341
248 3300005338 Ga0068868_100021122 Ga0068868_1000211224 341
249 3300005339 Ga0070660_100305612 Ga0070660_1003056121 341
250 3300005347 Ga0070668_100007434 Ga0070668_1000074343 341
251 3300005353 Ga0070669_100129871 Ga0070669_1001298712 341
252 3300005356 Ga0070674_100057908 Ga0070674_1000579082 341
253 3300005366 Ga0070659_100005120 Ga0070659_1000051208 341
254 3300005367 Ga0070667_100015311 Ga0070667_1000153117 341
255 3300005434 Ga0070709_10132920 Ga0070709_101329202 341
256 3300005435 Ga0070714_100000100 Ga0070714_10000010064 341
257 3300005435 Ga0070714_100022840 Ga0070714_1000228402 341
258 3300005439 Ga0070711_100010472 Ga0070711_1000104724 341
259 3300005456 Ga0070678_100067491 Ga0070678_1000674912 341
260 3300005457 Ga0070662_100305433 Ga0070662_1003054331 341
261 3300005536 Ga0070697_100117400 Ga0070697_1001174002 341
262 3300005547 Ga0070693_100006384 Ga0070693_1000063843 341
263 3300005549 Ga0070704_100033825 Ga0070704_1000338253 341
264 3300005563 Ga0068855_100010594 Ga0068855_1000105945 341
265 3300005578 Ga0068854_100089607 Ga0068854_1000896073 341
266 3300005614 Ga0068856_100221286 Ga0068856_1002212862 341
267 3300005617 Ga0068859_100119189 Ga0068859_1001191891 341
268 3300005718 Ga0068866_10001329 Ga0068866_100013299 341
269 3300005719 Ga0068861_100004889 Ga0068861_1000048893 341
270 3300005840 Ga0068870_10015215 Ga0068870_100152153 341
271 3300005843 Ga0068860_100070952 Ga0068860_1000709522 341
272 3300005844 Ga0068862_100032239 Ga0068862_1000322392 341
273 3300006028 Ga0070717_10186315 Ga0070717_101863152 341
274 3300006058 Ga0075432_10046768 Ga0075432_100467681 341
275 3300006175 Ga0070712_100021057 Ga0070712_1000210573 341
276 3300006237 Ga0097621_100048487 Ga0097621_1000484874 341
277 3300006358 Ga0068871_100291378 Ga0068871_1002913782 341
278 3300006846 Ga0075430_100041631 Ga0075430_1000416314 341
279 3300006847 Ga0075431_100068276 Ga0075431_1000682764 341
280 3300006852 Ga0075433_10028251 Ga0075433_100282514 341
281 3300006871 Ga0075434_100021172 Ga0075434_1000211723 341
282 3300006880 Ga0075429_100010493 Ga0075429_1000104933 341
283 3300006881 Ga0068865_100093373 Ga0068865_1000933732 341
284 3300006914 Ga0075436_100007844 Ga0075436_1000078444 341
285 3300006931 Ga0097620_100119184 Ga0097620_1001191841 341
286 3300009093 Ga0105240_10213225 Ga0105240_102132252 341
287 3300009098 Ga0105245_10037246 Ga0105245_100372463 341
288 3300009101 Ga0105247_10010785 Ga0105247_100107853 341
289 3300009147 Ga0114129_10022337 Ga0114129_100223374 341
290 3300009148 Ga0105243_10059524 Ga0105243_100595243 341
291 3300009176 Ga0105242_10007893 Ga0105242_100078935 341
292 3300009177 Ga0105248_10017673 Ga0105248_100176732 341
293 3300009545 Ga0105237_10098867 Ga0105237_100988673 341
294 3300009551 Ga0105238_10034972 Ga0105238_100349723 341
295 3300009551 Ga0105238_10200268 Ga0105238_102002682 341
296 3300009553 Ga0105249_10009542 Ga0105249_100095427 341
297 3300009988 Ga0105035_100397 Ga0105035_1003971 341
298 3300010375 Ga0105239_10038959 Ga0105239_100389593 341
299 3300013102 Ga0157371_10032061 Ga0157371_100320613 341
300 3300013104 Ga0157370_10010773 Ga0157370_100107737 341
301 3300013105 Ga0157369_10060752 Ga0157369_100607524 341
302 3300013296 Ga0157374_10245445 Ga0157374_102454452 341
303 3300013297 Ga0157378_10121661 Ga0157378_101216612 341
304 3300013306 Ga0163162_10011592 Ga0163162_100115927 341
305 3300013307 Ga0157372_10001746 Ga0157372_1000174619 341
306 3300013307 Ga0157372_10029416 Ga0157372_100294165 341
307 3300013308 Ga0157375_10067938 Ga0157375_100679383 341
308 3300014326 Ga0157380_10017791 Ga0157380_100177912 341
309 3300014968 Ga0157379_10005138 Ga0157379_100051389 341
310 3300014969 Ga0157376_10266690 Ga0157376_102666901 341
311 3300017792 Ga0163161_10002295 Ga0163161_1000229510 341
312 3300025901 Ga0207688_10000941 Ga0207688_1000094113 341
313 3300025903 Ga0207680_10102740 Ga0207680_101027401 341
314 3300025906 Ga0207699_10009414 Ga0207699_100094144 341
315 3300025911 Ga0207654_10212842 Ga0207654_102128421 341
316 3300025913 Ga0207695_10160220 Ga0207695_101602203 341
317 3300025914 Ga0207671_10279785 Ga0207671_102797851 341
318 3300025915 Ga0207693_10001318 Ga0207693_100013189 341
319 3300025916 Ga0207663_10016373 Ga0207663_100163733 341
320 3300025919 Ga0207657_10009491 Ga0207657_100094919 341
321 3300025923 Ga0207681_10146869 Ga0207681_101468692 341
322 3300025929 Ga0207664_10000002 Ga0207664_10000002566 341
323 3300025932 Ga0207690_10027443 Ga0207690_100274433 341
324 3300025933 Ga0207706_10181755 Ga0207706_101817553 341
325 3300025938 Ga0207704_10145105 Ga0207704_101451052 341
326 3300025939 Ga0207665_10003129 Ga0207665_100031298 341
327 3300025942 Ga0207689_10009079 Ga0207689_100090794 341
328 3300025949 Ga0207667_10036970 Ga0207667_100369704 341
329 3300025972 Ga0207668_10008237 Ga0207668_100082373 341
330 3300026088 Ga0207641_10110399 Ga0207641_101103993 341
331 3300026121 Ga0207683_10004078 Ga0207683_1000407810 341
332 3300028379 Ga0268266_10119390 Ga0268266_101193903 341
333 3300032126 Ga0307415_100032745 Ga0307415_1000327453 341
334 3300035088 Ga0373940_0006858 Ga0373940_0006858_722_1765 341
335 3300035092 Ga0373952_0023488 Ga0373952_0023488_85_1128 341
336 3300035114 Ga0373939_0029640 Ga0373939_0029640_160_1203 341
337 3300035242 Ga0373962_0003315 Ga0373962_0003315_1595_2638 341
338 3300038443 Ga0395901_0027028 Ga0395901_0027028_1372_2406 341
339 3300039437 Ga0436365_1176999 Ga0436365_1176999_90_1211 341
340 3300044901 Ga0466960_0012861 Ga0466960_0012861_767_1801 341
341 3300044901 Ga0466960_0023774 Ga0466960_0023774_738_1772 341
342 3300045976 Ga0466967_0108145 Ga0466967_0108145_479_1513 341
343 3300047321 Ga0495676_0188180 Ga0495676_0188180_113_1156 341
344 3300048904 Ga0496101_0126841 Ga0496101_0126841_482_1525 341
345 3300048908 Ga0496105_0003371 Ga0496105_0003371_483_1526 341
346 3300048910 Ga0496107_0115758 Ga0496107_0115758_371_1414 341
347 3300048911 Ga0496108_0070505 Ga0496108_0070505_410_1453 341
348 3300048912 Ga0496109_0035105 Ga0496109_0035105_410_1453 341
349 3300048913 Ga0496110_0055580 Ga0496110_0055580_1846_2889 341
350 3300048915 Ga0496112_0035503 Ga0496112_0035503_1792_2835 341
351 3300048917 Ga0496114_0002375 Ga0496114_0002375_8673_9716 341
352 3300048918 Ga0496115_0003667 Ga0496115_0003667_9564_10607 341
353 3300049572 Ga0501036_0012063 Ga0501036_0012063_3521_4558 341
354 3300049573 Ga0501037_0033781 Ga0501037_0033781_2666_3703 341
355 3300049574 Ga0501038_0000471 Ga0501038_0000471_19341_20378 341
356 3300049575 Ga0501039_0109998 Ga0501039_0109998_758_1795 341
357 3300049581 Ga0501047_0004082 Ga0501047_0004082_10120_11157 341
358 3300049582 Ga0501048_0147690 Ga0501048_0147690_55_1092 341
359 3300049583 Ga0501067_0024484 Ga0501067_0024484_874_1908 341
360 3300050510 nmdc:mga06r32_4561_c1 nmdc:mga06r32_4561_c1_7219_8277 341
361 3300050512 nmdc:mga0n895_88197_c1 nmdc:mga0n895_88197_c1_1414_2457 341
362 3300050513 nmdc:mga0rr50_29935_c1 nmdc:mga0rr50_29935_c1_1732_2775 341
363 3300050514 nmdc:mga08x19_31945_c1 nmdc:mga08x19_31945_c1_519_1562 341
364 3300050515 nmdc:mga0a205_30421_c1 nmdc:mga0a205_30421_c1_646_1689 341
365 3300061734 Ga0530510_0155973 Ga0530510_0155973_305_1339 341
366 iso_pu_bacteria 2984576629 2984579759 341
367 iso_pu_bacteria 2990256926 2990257365 341
368 3300005327 Ga0070658_10043928 Ga0070658_100439283 342
369 3300005335 Ga0070666_10035831 Ga0070666_100358312 342
370 3300005441 Ga0070700_100000071 Ga0070700_10000007124 342
371 3300005445 Ga0070708_100381961 Ga0070708_1003819611 342
372 3300005548 Ga0070665_100010691 Ga0070665_1000106913 342
373 3300005548 Ga0070665_100070179 Ga0070665_1000701792 342
374 3300005841 Ga0068863_100000501 Ga0068863_1000005012 342
375 3300005842 Ga0068858_100042548 Ga0068858_1000425483 342
376 3300005843 Ga0068860_100000646 Ga0068860_10000064616 342
377 3300009093 Ga0105240_10152029 Ga0105240_101520292 342
378 3300011119 Ga0105246_10101774 Ga0105246_101017741 342
379 3300013297 Ga0157378_10035336 Ga0157378_100353362 342
380 3300021388 Ga0213875_10062007 Ga0213875_100620072 342
381 3300025711 Ga0207696_1017156 Ga0207696_10171561 342
382 3300025903 Ga0207680_10002698 Ga0207680_1000269811 342
383 3300025909 Ga0207705_10235076 Ga0207705_102350761 342
384 3300025949 Ga0207667_10463829 Ga0207667_104638292 342
385 3300026035 Ga0207703_10032291 Ga0207703_100322913 342
386 3300026075 Ga0207708_10000029 Ga0207708_1000002924 342
387 3300026088 Ga0207641_10014067 Ga0207641_100140672 342
388 3300028379 Ga0268266_10214873 Ga0268266_102148731 342
389 3300028381 Ga0268264_10000530 Ga0268264_1000053035 342
390 3300030522 Ga0307512_10016907 Ga0307512_100169075 342
391 3300031507 Ga0307509_10091925 Ga0307509_100919253 342
392 3300031616 Ga0307508_10053527 Ga0307508_100535274 342
393 3300031616 Ga0307508_10143073 Ga0307508_101430732 342
394 3300031649 Ga0307514_10122442 Ga0307514_101224422 342
395 3300031730 Ga0307516_10069228 Ga0307516_100692283 342
396 3300031852 Ga0307410_10007244 Ga0307410_100072443 342
397 3300031995 Ga0307409_100238473 Ga0307409_1002384731 342
398 3300033179 Ga0307507_10096930 Ga0307507_100969301 342
399 3300035171 Ga0373946_0045792 Ga0373946_0045792_220_1302 342
400 3300037853 Ga0436364_0528793 Ga0436364_0528793_3098_4156 342
401 3300042007 Ga0439449_0001239 Ga0439449_0001239_933_1967 342
402 3300044684 Ga0466966_0085082 Ga0466966_0085082_95_1180 342
403 3300044693 Ga0466961_0122932 Ga0466961_0122932_25_1074 342
404 3300044694 Ga0466963_0001927 Ga0466963_0001927_6124_7191 342
405 3300044694 Ga0466963_0004764 Ga0466963_0004764_432_1496 342
406 3300044694 Ga0466963_0043317 Ga0466963_0043317_1527_2579 342
407 3300044694 Ga0466963_0070313 Ga0466963_0070313_1159_2217 342
408 3300044694 Ga0466963_0081455 Ga0466963_0081455_924_1973 342
409 3300044842 Ga0466957_0057316 Ga0466957_0057316_419_1471 342
410 3300045836 Ga0466958_0006064 Ga0466958_0006064_697_1749 342
411 3300045976 Ga0466967_0024563 Ga0466967_0024563_3266_4330 342
412 3300045976 Ga0466967_0060288 Ga0466967_0060288_833_1897 342
413 3300045976 Ga0466967_0065320 Ga0466967_0065320_1805_2869 342
414 3300045976 Ga0466967_0128919 Ga0466967_0128919_675_1733 342
415 3300045976 Ga0466967_0182311 Ga0466967_0182311_585_1649 342
416 3300045976 Ga0466967_0273227 Ga0466967_0273227_66_1124 342
417 3300046455 Ga0495603_0150111 Ga0495603_0150111_38_1069 342
418 3300046460 Ga0495638_0070098 Ga0495638_0070098_357_1397 342
419 3300046460 Ga0495638_0120781 Ga0495638_0120781_77_1108 342
420 3300046472 Ga0495580_0075503 Ga0495580_0075503_189_1235 342
421 3300046476 Ga0495662_0000926 Ga0495662_0000926_9923_10969 342
422 3300046476 Ga0495662_0109601 Ga0495662_0109601_48_1079 342
423 3300046476 Ga0495662_0147523 Ga0495662_0147523_80_1111 342
424 3300046477 Ga0495664_0005623 Ga0495664_0005623_4153_5199 342
425 3300046492 Ga0495585_0005584 Ga0495585_0005584_918_1949 342
426 3300046499 Ga0495594_0002599 Ga0495594_0002599_627_1658 342
427 3300046501 Ga0495607_0085623 Ga0495607_0085623_280_1320 342
428 3300046506 Ga0495583_0028250 Ga0495583_0028250_1128_2162 342
429 3300046511 Ga0495608_0009188 Ga0495608_0009188_3606_4652 342
430 3300046516 Ga0495628_0014685 Ga0495628_0014685_3089_4135 342
431 3300046522 Ga0495643_0006590 Ga0495643_0006590_847_1887 342
432 3300046526 Ga0495666_0003531 Ga0495666_0003531_747_1793 342
433 3300046531 Ga0495665_0005792 Ga0495665_0005792_3117_4163 342
434 3300046533 Ga0495640_0010941 Ga0495640_0010941_2541_3587 342
435 3300046533 Ga0495640_0021459 Ga0495640_0021459_2216_3247 342
436 3300046535 Ga0495586_0003398 Ga0495586_0003398_3992_5038 342
437 3300046557 Ga0495622_0014252 Ga0495622_0014252_366_1397 342
438 3300046559 Ga0495667_0015255 Ga0495667_0015255_1265_2311 342
439 3300046674 Ga0495588_0038485 Ga0495588_0038485_110_1141 342
440 3300046678 Ga0495599_0099807 Ga0495599_0099807_747_1793 342
441 3300046689 Ga0495613_0009131 Ga0495613_0009131_2901_3932 342
442 3300046689 Ga0495613_0012112 Ga0495613_0012112_3597_4643 342
443 3300046689 Ga0495613_0105233 Ga0495613_0105233_213_1253 342
444 3300046689 Ga0495613_0165598 Ga0495613_0165598_460_1491 342
445 3300046691 Ga0495670_0001259 Ga0495670_0001259_8127_9167 342
446 3300046691 Ga0495670_0112015 Ga0495670_0112015_298_1329 342
447 3300046794 Ga0495589_0012158 Ga0495589_0012158_1879_2919 342
448 3300046810 Ga0495660_0021129 Ga0495660_0021129_1572_2612 342
449 3300047315 Ga0495581_0014046 Ga0495581_0014046_3470_4516 342
450 3300047315 Ga0495581_0081810 Ga0495581_0081810_795_1826 342
451 3300047317 Ga0495604_0003003 Ga0495604_0003003_4049_5095 342
452 3300047317 Ga0495604_0015964 Ga0495604_0015964_217_1248 342
453 3300047319 Ga0495674_0070038 Ga0495674_0070038_594_1640 342
454 3300047444 Ga0495675_0019073 Ga0495675_0019073_2981_4027 342
455 3300047444 Ga0495675_0040841 Ga0495675_0040841_283_1314 342
456 3300047447 Ga0495685_000133 Ga0495685_000133_15389_16429 342
457 3300047470 Ga0495681_0001292 Ga0495681_0001292_9073_10113 342
458 3300047472 Ga0495686_0033794 Ga0495686_0033794_1896_2936 342
459 3300047673 Ga0495593_0058280 Ga0495593_0058280_698_1729 342
460 3300047673 Ga0495593_0061602 Ga0495593_0061602_136_1182 342
461 3300048089 Ga0495614_0001285 Ga0495614_0001285_1469_2500 342
462 3300048905 Ga0496102_0001153 Ga0496102_0001153_13840_14886 342
463 3300048906 Ga0496103_0077361 Ga0496103_0077361_176_1222 342
464 3300048922 Ga0496119_0000125 Ga0496119_0000125_59180_60238 342
465 3300048923 Ga0496120_0000695 Ga0496120_0000695_37076_38134 342
466 3300049568 Ga0501031_0115908 Ga0501031_0115908_46_1080 342
467 3300049568 Ga0501031_0130385 Ga0501031_0130385_346_1377 342
468 3300049569 Ga0501032_0217991 Ga0501032_0217991_146_1183 342
469 3300049570 Ga0501033_0050660 Ga0501033_0050660_1451_2482 342
470 3300049571 Ga0501034_0015676 Ga0501034_0015676_1772_2803 342
471 3300049572 Ga0501036_0039797 Ga0501036_0039797_1380_2411 342
472 3300049572 Ga0501036_0076055 Ga0501036_0076055_644_1678 342
473 3300049573 Ga0501037_0013360 Ga0501037_0013360_2776_3813 342
474 3300049574 Ga0501038_0002494 Ga0501038_0002494_9299_10333 342
475 3300049574 Ga0501038_0018948 Ga0501038_0018948_4455_5486 342
476 3300049575 Ga0501039_0047923 Ga0501039_0047923_1808_2845 342
477 3300049579 Ga0501043_0090324 Ga0501043_0090324_1319_2353 342
478 3300049580 Ga0501046_0132657 Ga0501046_0132657_681_1718 342
479 3300049581 Ga0501047_0010581 Ga0501047_0010581_3432_4469 342
480 3300049581 Ga0501047_0077092 Ga0501047_0077092_1611_2642 342
481 3300049582 Ga0501048_0005189 Ga0501048_0005189_5329_6366 342
482 3300049582 Ga0501048_0083234 Ga0501048_0083234_65_1102 342
483 3300049589 Ga0501073_0088646 Ga0501073_0088646_1018_2052 342
484 3300049589 Ga0501073_0260024 Ga0501073_0260024_38_1075 342
485 3300049742 Ga0501080_0140412 Ga0501080_0140412_1137_2171 342
486 3300049822 Ga0501035_0146391 Ga0501035_0146391_443_1477 342
487 3300049822 Ga0501035_0306983 Ga0501035_0306983_234_1265 342
488 3300049823 Ga0501044_0048397 Ga0501044_0048397_3309_4343 342
489 3300049823 Ga0501044_0079363 Ga0501044_0079363_2266_3297 342
490 3300049824 Ga0501045_0307231 Ga0501045_0307231_130_1167 342
491 3300053086 Ga0500578_0031007 Ga0500578_0031007_1703_2743 342
492 3300053087 Ga0500643_001854 Ga0500643_001854_3815_4846 342
493 3300053099 Ga0500654_020895 Ga0500654_020895_415_1455 342
494 3300053109 Ga0500569_009784 Ga0500569_009784_40_1080 342
495 3300053123 Ga0500614_010502 Ga0500614_010502_880_1920 342
496 3300053126 Ga0500621_026732 Ga0500621_026732_747_1787 342
497 3300053131 Ga0500652_006446 Ga0500652_006446_1436_2476 342
498 3300053134 Ga0500658_0003265 Ga0500658_0003265_713_1753 342
499 3300053143 Ga0500579_088696 Ga0500579_088696_471_1511 342
500 3300053149 Ga0500600_0030685 Ga0500600_0030685_55_1095 342
501 3300053153 Ga0500616_0003280 Ga0500616_0003280_9900_10940 342
502 3300053732 Ga0500656_001643 Ga0500656_001643_846_1886 342
503 3300053739 Ga0500587_002331 Ga0500587_002331_34_1074 342
504 3300061719 Ga0466962_0008836 Ga0466962_0008836_1754_2818 342
505 3300061719 Ga0466962_0048291 Ga0466962_0048291_642_1694 342
506 3300049569 Ga0501032_0012126 Ga0501032_0012126_796_1851 343
507 3300049570 Ga0501033_0008599 Ga0501033_0008599_332_1387 343
508 3300049571 Ga0501034_0007333 Ga0501034_0007333_6152_7207 343
509 3300049572 Ga0501036_0015369 Ga0501036_0015369_4542_5597 343
510 3300049573 Ga0501037_0011964 Ga0501037_0011964_796_1851 343
511 3300049574 Ga0501038_0009405 Ga0501038_0009405_1647_2702 343
512 3300049575 Ga0501039_0016284 Ga0501039_0016284_1757_2812 343
513 3300049576 Ga0501040_0010606 Ga0501040_0010606_349_1404 343
514 3300049576 Ga0501040_0030212 Ga0501040_0030212_2019_3062 343
515 3300049577 Ga0501041_0000679 Ga0501041_0000679_6622_7677 343
516 3300049578 Ga0501042_0055823 Ga0501042_0055823_1117_2172 343
517 3300049579 Ga0501043_0005544 Ga0501043_0005544_4542_5597 343
518 3300049580 Ga0501046_0041235 Ga0501046_0041235_1365_2420 343
519 3300049581 Ga0501047_0002816 Ga0501047_0002816_9406_10461 343
520 3300049582 Ga0501048_0006173 Ga0501048_0006173_4741_5796 343
521 3300049582 Ga0501048_0298391 Ga0501048_0298391_13_1056 343
522 3300049583 Ga0501067_0000518 Ga0501067_0000518_13843_14898 343
523 3300049584 Ga0501068_0002033 Ga0501068_0002033_5015_6070 343
524 3300049586 Ga0501070_0002118 Ga0501070_0002118_3374_4429 343
525 3300049587 Ga0501071_0000762 Ga0501071_0000762_7453_8508 343
526 3300049588 Ga0501072_0001374 Ga0501072_0001374_10697_11752 343
527 3300049589 Ga0501073_0014911 Ga0501073_0014911_4364_5419 343
528 3300049590 Ga0501074_0102317 Ga0501074_0102317_775_1830 343
529 3300049592 Ga0501076_0089568 Ga0501076_0089568_708_1763 343
530 3300049593 Ga0501077_0034240 Ga0501077_0034240_256_1311 343
531 3300049741 Ga0501079_0006612 Ga0501079_0006612_4659_5714 343
532 3300049741 Ga0501079_0023409 Ga0501079_0023409_1229_2272 343
533 3300049742 Ga0501080_0025423 Ga0501080_0025423_1117_2172 343
534 3300049744 Ga0501083_0005784 Ga0501083_0005784_3324_4379 343
535 3300049822 Ga0501035_0010403 Ga0501035_0010403_4542_5597 343
536 3300049823 Ga0501044_0085434 Ga0501044_0085434_769_1824 343
537 3300049824 Ga0501045_0001401 Ga0501045_0001401_9247_10302 343
538 3300054114 Ga0501084_0043180 Ga0501084_0043180_943_1998 343
539 3300060353 Ga0501082_0004519 Ga0501082_0004519_6527_7582 343
540 3300061734 Ga0530510_0022871 Ga0530510_0022871_788_1843 343
541 3300005327 Ga0070658_10002571 Ga0070658_100025717 344
542 3300009098 Ga0105245_10050607 Ga0105245_100506075 344
543 3300025909 Ga0207705_10033923 Ga0207705_100339232 344
544 3300025927 Ga0207687_10087823 Ga0207687_100878232 344
545 3300038443 Ga0395901_0034091 Ga0395901_0034091_2441_3499 344
546 3300044684 Ga0466966_0011711 Ga0466966_0011711_3211_4275 344
547 3300045976 Ga0466967_0002518 Ga0466967_0002518_758_1858 344

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03320

FBPase_glpX

Bacterial fructose-1,6-bisphosphatase, glpX-encoded

46

353

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
7txb-assembly2.cif.gz_A structure of the class ii fructose-1,6-bisphophatase from mycobacterium tuberculosis complexed with substrate f1,6bp 0.9796 25 328
7txb-assembly2.cif.gz_A structure of the class ii fructose-1,6-bisphophatase from mycobacterium tuberculosis complexed with substrate f1,6bp 0.9733 25 328
3roj-assembly1.cif.gz_B d-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase of synechocystis sp. pcc 6803 0.9577 17 327
5a5l-assembly1.cif.gz_A structure of dual function fbpase sbpase from thermosynechococcus elongatus 0.9564 16 327
2r8t-assembly1.cif.gz_A crystal structure of the fructose 1,6-bisphosphatase glpx from e.coli in the complex with fructose 1,6-bisphosphate 0.9554 18 328
ID Description Score Start End Superfamily
af_P9WN21_138_292_3.40.190.90 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9876 126 279 3.40.190.90
af_P9WN21_138_292_3.40.190.90 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9751 126 279 3.40.190.90
3rplA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9456 126 279 3.40.190.90
2r8tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9415 126 280 3.40.190.90
1ni9A01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9283 17 328 3.30.540.10
ID Description Score Start End GO Terms
AF-A0A7K3DBZ6-F1-model_v4 Fructose-1,6-bisphosphatase class 2 (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase class 2) 0.9992 123 234 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132
AF-A0A2V6AHL6-F1-model_v4 fructose-bisphosphatase (EC 3.1.3.11) 0.9986 283 328 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132
AF-A0A7Y0WYT6-F1-model_v4 deleted 0.9965 285 330
AF-A0A2M7PVF3-F1-model_v4 fructose-bisphosphatase (EC 3.1.3.11) 0.9919 138 224 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132
AF-A0A350RIR2-F1-model_v4 Fructose-1,6-bisphosphatase class 2 (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase class 2) 0.9914 125 256 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132

Feature Viewer

pLDDT pTM Quality
90.74 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map