F462149

General Info

Members Datasets Scaffolds Average Seq Length
547 294 1094 335

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0018918|Ga0495608_0018918_1682_2710
Length 342
Sequence MSELGLGQDKVENVIVVGGGPAGYTAALYTARANLEPLVFEGFQWGGQLQNTTDVENYPGYPEGIMGPEMMNQFRAQAERFGTRFVSDDVDRVELSTDGGVHRVFLGDEEHVAKTVILAMGAEPRRLGIPGEMELSGCGVSTCGVCDGAFFKGKKVIVIGGGDSAMEDAIFVSKFASELTIVNRRDEFRASKIMRERAAERPNIEFKTPFVPEEFVAAEGEPKLDHVRLRNAETGETEDFGTEGAFVAIGHIPRSEIVAGQVDTDEDGYIRTEPGSTKTNLPGVFAVGDVVDHTYRQAVTAAGTGCMGALDAEWYLRDTPPMPEAHWLPGGEPTEIAPTPGS

Samples

Sample ID Description Type Environment
1 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
141 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
213 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
287 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
288 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
289 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
290 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
294 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0.91
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.66
Nodule 0
Rhizoplane 12.25
Rhizosphere 81.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495608_0018918 3300046511 Bacteria 4747
2 LJQas_1006601 3300000549 Bacteria 1442
3 JGI24746J21847_1002058 3300001977 Bacteria 3209
4 JGI24748J21848_1000356 3300002074 Bacteria 5272
5 JGI24034J26672_10000216 3300002239 Bacteria 7622
6 Ga0070683_100023947 3300005329 Bacteria 5465
7 Ga0070666_10009188 3300005335 Bacteria 6162
8 Ga0070682_100000023 3300005337 Bacteria 206016
9 Ga0070682_100000026 3300005337 Bacteria 191388
10 Ga0068868_100000694 3300005338 Bacteria 22626
11 Ga0068868_100072591 3300005338 Bacteria 2746
12 Ga0070689_100081610 3300005340 Bacteria 2539
13 Ga0070689_100210380 3300005340 Bacteria 1591
14 Ga0070691_10000004 3300005341 Bacteria 80156
15 Ga0070691_10000970 3300005341 Bacteria 11707
16 Ga0070687_100012467 3300005343 Bacteria 3756
17 Ga0070661_100000004 3300005344 Bacteria 243876
18 Ga0070668_100010212 3300005347 Bacteria 6964
19 Ga0070668_100019643 3300005347 Bacteria 5087
20 Ga0070675_100000050 3300005354 Bacteria 72016
21 Ga0070674_100000002 3300005356 Bacteria 271088
22 Ga0070674_100000141 3300005356 Bacteria 33366
23 Ga0070673_100100925 3300005364 Bacteria 2377
24 Ga0070688_100000686 3300005365 Bacteria 16820
25 Ga0070688_100076412 3300005365 Bacteria 2155
26 Ga0070659_100000852 3300005366 Bacteria 22251
27 Ga0070659_100003678 3300005366 Bacteria 10933
28 Ga0070667_100003085 3300005367 Bacteria 14325
29 Ga0070667_100068631 3300005367 Bacteria 3017
30 Ga0070714_100004088 3300005435 Bacteria 10971
31 Ga0070714_100356459 3300005435 Bacteria 1374
32 Ga0070713_100000503 3300005436 Bacteria 24991
33 Ga0070713_100119207 3300005436 Bacteria 2312
34 Ga0070711_100016216 3300005439 Bacteria 4729
35 Ga0070711_100036952 3300005439 Bacteria 3275
36 Ga0070663_100021932 3300005455 Bacteria 4259
37 Ga0070678_100226970 3300005456 Bacteria 1555
38 Ga0070662_100000001 3300005457 Bacteria 317995
39 Ga0070681_10080275 3300005458 Bacteria 3218
40 Ga0068867_100000078 3300005459 Bacteria 59729
41 Ga0068867_100007697 3300005459 Bacteria 7621
42 Ga0070685_10000010 3300005466 Bacteria 146946
43 Ga0070685_10001080 3300005466 Bacteria 14623
44 Ga0070679_100000424 3300005530 Bacteria 35927
45 Ga0070679_100000471 3300005530 Bacteria 34374
46 Ga0070684_100012351 3300005535 Bacteria 6842
47 Ga0070684_100048102 3300005535 Bacteria 3699
48 Ga0070684_100048700 3300005535 Bacteria 3676
49 Ga0070684_100143343 3300005535 Bacteria 2162
50 Ga0070672_100000031 3300005543 Bacteria 62241
51 Ga0070693_100001579 3300005547 Bacteria 10264
52 Ga0070665_100000022 3300005548 Bacteria 379286
53 Ga0070665_100002868 3300005548 Bacteria 18629
54 Ga0070665_100652886 3300005548 Bacteria 1065
55 Ga0070664_100193884 3300005564 Bacteria 1811
56 Ga0070664_100212796 3300005564 Bacteria 1728
57 Ga0068854_100000082 3300005578 Bacteria 68340
58 Ga0068854_100021369 3300005578 Bacteria 4392
59 Ga0068856_100000136 3300005614 Bacteria 74026
60 Ga0068856_100005657 3300005614 Bacteria 12302
61 Ga0068852_100064550 3300005616 Bacteria 3192
62 Ga0068864_100000090 3300005618 Bacteria 96213
63 Ga0068866_10000004 3300005718 Bacteria 202810
64 Ga0068866_10004817 3300005718 Bacteria 5540
65 Ga0068851_10002105 3300005834 Bacteria 8758
66 Ga0068851_10083118 3300005834 Bacteria 1675
67 Ga0068863_100000261 3300005841 Bacteria 55053
68 Ga0068863_100008832 3300005841 Bacteria 9842
69 Ga0068863_100268176 3300005841 Bacteria 1652
70 Ga0068858_100000046 3300005842 Bacteria 127519
71 Ga0068858_100001180 3300005842 Bacteria 27065
72 Ga0068860_100003017 3300005843 Bacteria 17389
73 Ga0068862_100001309 3300005844 Bacteria 23179
74 Ga0068862_100202398 3300005844 Bacteria 1791
75 Ga0081455_10009497 3300005937 Bacteria 9997
76 Ga0081455_10010690 3300005937 Bacteria 9284
77 Ga0081455_10016053 3300005937 Bacteria 7244
78 Ga0081455_10047858 3300005937 Bacteria 3699
79 Ga0081455_10113472 3300005937 Bacteria 2149
80 Ga0081538_10000814 3300005981 Bacteria 33848
81 Ga0081538_10053974 3300005981 Bacteria 2382
82 Ga0081540_1000174 3300005983 Bacteria 67477
83 Ga0081540_1000557 3300005983 Bacteria 36162
84 Ga0081539_10000776 3300005985 Bacteria 62705
85 Ga0075365_10001651 3300006038 Bacteria 10306
86 Ga0075365_10006453 3300006038 Bacteria 6455
87 Ga0075365_10008059 3300006038 Bacteria 5949
88 Ga0075365_10012400 3300006038 Bacteria 5062
89 Ga0075365_10043160 3300006038 Bacteria 2951
90 Ga0075363_100009258 3300006048 Bacteria 4626
91 Ga0075364_10004153 3300006051 Bacteria 8301
92 Ga0075364_10068807 3300006051 Bacteria 2329
93 Ga0070715_10000008 3300006163 Bacteria 189899
94 Ga0075367_10125368 3300006178 Bacteria 1584
95 Ga0068871_100086946 3300006358 Bacteria 2598
96 Ga0075428_100024481 3300006844 Bacteria 6681
97 Ga0075428_100243017 3300006844 Bacteria 1942
98 Ga0075430_100019608 3300006846 Bacteria 5753
99 Ga0075430_100026320 3300006846 Bacteria 4950
100 Ga0075431_100003746 3300006847 Bacteria 14770
101 Ga0075431_100022444 3300006847 Bacteria 6452
102 Ga0075433_10000337 3300006852 Bacteria 29062
103 Ga0075433_10185196 3300006852 Bacteria 1852
104 Ga0075434_100001338 3300006871 Bacteria 20649
105 Ga0075434_100012705 3300006871 Bacteria 7987
106 Ga0068865_100054085 3300006881 Bacteria 2788
107 Ga0068865_100078856 3300006881 Bacteria 2357
108 Ga0075436_100151343 3300006914 Bacteria 1633
109 Ga0111539_10352080 3300009094 Bacteria 1714
110 Ga0105245_10000040 3300009098 Bacteria 144005
111 Ga0105245_10000117 3300009098 Bacteria 76863
112 Ga0105245_10000629 3300009098 Bacteria 32084
113 Ga0105245_10006841 3300009098 Bacteria 10002
114 Ga0105245_10009368 3300009098 Bacteria 8539
115 Ga0105247_10000131 3300009101 Bacteria 72578
116 Ga0114129_10030345 3300009147 Bacteria 7650
117 Ga0114129_10125475 3300009147 Bacteria 3530
118 Ga0114129_10284908 3300009147 Bacteria 2206
119 Ga0105243_10010381 3300009148 Bacteria 7071
120 Ga0105243_10010662 3300009148 Bacteria 6970
121 Ga0105243_10180684 3300009148 Bacteria 1834
122 Ga0105242_10000063 3300009176 Bacteria 74721
123 Ga0105242_10000428 3300009176 Bacteria 33565
124 Ga0105248_10192317 3300009177 Bacteria 2299
125 Ga0105237_10030852 3300009545 Bacteria 5439
126 Ga0105237_10237342 3300009545 Bacteria 1824
127 Ga0105238_10000033 3300009551 Bacteria 172981
128 Ga0105249_10000218 3300009553 Bacteria 65480
129 Ga0105249_10004038 3300009553 Bacteria 12662
130 Ga0105249_10143982 3300009553 Bacteria 2288
131 Ga0105249_10563279 3300009553 Bacteria 1191
132 Ga0105239_10030284 3300010375 Bacteria 5949
133 Ga0105239_10210502 3300010375 Bacteria 2179
134 Ga0105239_10549574 3300010375 Bacteria 1315
135 Ga0105246_10326253 3300011119 Bacteria 1249
136 Ga0157370_10004940 3300013104 Bacteria 15093
137 Ga0157374_10001719 3300013296 Bacteria 18377
138 Ga0157374_10203473 3300013296 Bacteria 1939
139 Ga0157378_10018349 3300013297 Bacteria 6144
140 Ga0157378_10023605 3300013297 Bacteria 5409
141 Ga0157378_10101111 3300013297 Bacteria 2633
142 Ga0157372_10000146 3300013307 Bacteria 77952
143 Ga0157375_10000492 3300013308 Bacteria 35821
144 Ga0157375_10030090 3300013308 Bacteria 5115
145 Ga0157375_10067540 3300013308 Bacteria 3573
146 Ga0157380_10000007 3300014326 Bacteria 157634
147 Ga0157380_10001343 3300014326 Bacteria 16023
148 Ga0157379_10049463 3300014968 Bacteria 3754
149 Ga0157379_10063407 3300014968 Bacteria 3304
150 Ga0157379_10246886 3300014968 Bacteria 1620
151 Ga0157376_10010885 3300014969 Bacteria 6680
152 Ga0163161_10000027 3300017792 Bacteria 197774
153 Ga0206350_10333991 3300020080 Bacteria 1967
154 Ga0206354_10497300 3300020081 Bacteria 2909
155 Ga0206354_11031077 3300020081 Bacteria 2079
156 Ga0206353_11807736 3300020082 Bacteria 4842
157 Ga0224712_10022571 3300022467 Bacteria 2171
158 Ga0207656_10002076 3300025321 Bacteria 6694
159 Ga0207642_10000005 3300025899 Bacteria 401934
160 Ga0207642_10000737 3300025899 Bacteria 10119
161 Ga0207642_10003444 3300025899 Bacteria 4997
162 Ga0207710_10000268 3300025900 Bacteria 42956
163 Ga0207680_10004865 3300025903 Bacteria 6390
164 Ga0207685_10000012 3300025905 Bacteria 189900
165 Ga0207707_10023616 3300025912 Bacteria 5378
166 Ga0207695_10251788 3300025913 Bacteria 1665
167 Ga0207671_10084315 3300025914 Bacteria 2386
168 Ga0207693_10014431 3300025915 Bacteria 6352
169 Ga0207693_10015147 3300025915 Bacteria 6188
170 Ga0207663_10004985 3300025916 Bacteria 6655
171 Ga0207662_10034095 3300025918 Bacteria 2971
172 Ga0207657_10007235 3300025919 Bacteria 11401
173 Ga0207649_10000003 3300025920 Bacteria 388908
174 Ga0207652_10000232 3300025921 Bacteria 58473
175 Ga0207652_10000412 3300025921 Bacteria 44366
176 Ga0207694_10000012 3300025924 Bacteria 411218
177 Ga0207659_10000055 3300025926 Bacteria 74252
178 Ga0207687_10000046 3300025927 Bacteria 99576
179 Ga0207687_10000070 3300025927 Bacteria 77432
180 Ga0207687_10000095 3300025927 Bacteria 64664
181 Ga0207687_10006279 3300025927 Bacteria 7862
182 Ga0207687_10101546 3300025927 Bacteria 2117
183 Ga0207700_10000003 3300025928 Bacteria 500797
184 Ga0207664_10000006 3300025929 Bacteria 408702
185 Ga0207644_10152774 3300025931 Bacteria 1788
186 Ga0207690_10002537 3300025932 Bacteria 11031
187 Ga0207690_10112859 3300025932 Bacteria 1960
188 Ga0207706_10000003 3300025933 Bacteria 345011
189 Ga0207686_10000124 3300025934 Bacteria 62335
190 Ga0207686_10000395 3300025934 Bacteria 30349
191 Ga0207670_10142256 3300025936 Bacteria 1770
192 Ga0207669_10000003 3300025937 Bacteria 252239
193 Ga0207669_10000021 3300025937 Bacteria 100327
194 Ga0207704_10000104 3300025938 Bacteria 46614
195 Ga0207704_10026478 3300025938 Bacteria 3183
196 Ga0207691_10000178 3300025940 Bacteria 60110
197 Ga0207691_10003769 3300025940 Bacteria 14721
198 Ga0207711_10000011 3300025941 Bacteria 518817
199 Ga0207711_10073917 3300025941 Bacteria 2964
200 Ga0207661_10002170 3300025944 Bacteria 13522
201 Ga0207661_10003560 3300025944 Bacteria 10827
202 Ga0207661_10005006 3300025944 Bacteria 9292
203 Ga0207661_10180341 3300025944 Bacteria 1844
204 Ga0207679_10128408 3300025945 Bacteria 2030
205 Ga0207667_10470726 3300025949 Bacteria 1276
206 Ga0207651_10032078 3300025960 Bacteria 3369
207 Ga0207712_10000027 3300025961 Bacteria 263739
208 Ga0207712_10019638 3300025961 Bacteria 4417
209 Ga0207712_10282739 3300025961 Bacteria 1354
210 Ga0207668_10006557 3300025972 Bacteria 6879
211 Ga0207640_10000054 3300025981 Bacteria 95136
212 Ga0207658_10015937 3300025986 Bacteria 5161
213 Ga0207677_10001111 3300026023 Bacteria 14662
214 Ga0207703_10000020 3300026035 Bacteria 251603
215 Ga0207703_10000042 3300026035 Bacteria 161459
216 Ga0207678_10001975 3300026067 Bacteria 18688
217 Ga0207678_10002172 3300026067 Bacteria 17730
218 Ga0207708_10225037 3300026075 Bacteria 1504
219 Ga0207702_10000105 3300026078 Bacteria 97835
220 Ga0207702_10001788 3300026078 Bacteria 21174
221 Ga0207641_10000062 3300026088 Bacteria 159982
222 Ga0207641_10006453 3300026088 Bacteria 9884
223 Ga0207648_10013215 3300026089 Bacteria 7692
224 Ga0207676_10000016 3300026095 Bacteria 311561
225 Ga0207674_10050746 3300026116 Bacteria 4237
226 Ga0207674_10414054 3300026116 Bacteria 1302
227 Ga0207675_100160315 3300026118 Bacteria 2145
228 Ga0207683_10033719 3300026121 Bacteria 4449
229 Ga0207698_10000015 3300026142 Bacteria 207368
230 Ga0207428_10013276 3300027907 Bacteria 7201
231 Ga0268266_10000029 3300028379 Bacteria 424015
232 Ga0268266_10000526 3300028379 Bacteria 53404
233 Ga0268266_10000990 3300028379 Bacteria 35791
234 Ga0268266_10081443 3300028379 Bacteria 2823
235 Ga0268265_10008679 3300028380 Bacteria 6869
236 Ga0268264_10001191 3300028381 Bacteria 25160
237 Ga0268264_10024255 3300028381 Bacteria 4952
238 Ga0265337_1001256 3300028556 Bacteria 12773
239 Ga0265326_10000127 3300028558 Bacteria 39017
240 Ga0265319_1000010 3300028563 Bacteria 188773
241 Ga0265322_10000005 3300028654 Bacteria 246112
242 Ga0265336_10026744 3300028666 Bacteria 1811
243 Ga0265338_10000287 3300028800 Bacteria 90818
244 Ga0265328_10019084 3300031239 Bacteria 2637
245 Ga0265320_10000010 3300031240 Bacteria 250501
246 Ga0265325_10051053 3300031241 Bacteria 2127
247 Ga0265329_10001050 3300031242 Bacteria 13701
248 Ga0265339_10016752 3300031249 Bacteria 4361
249 Ga0265331_10000217 3300031250 Bacteria 69142
250 Ga0265327_10000040 3300031251 Bacteria 291052
251 Ga0265316_10035110 3300031344 Bacteria 4067
252 Ga0265314_10000491 3300031711 Bacteria 51373
253 Ga0265342_10059103 3300031712 Bacteria 2265
254 Ga0316576_10000603 3300031727 Bacteria 17236
255 Ga0307406_10112797 3300031901 Bacteria 1875
256 Ga0307409_100453414 3300031995 Bacteria 1238
257 Ga0307415_100011748 3300032126 Bacteria 5028
258 Ga0316583_10056789 3300032133 Bacteria 1375
259 Ga0316574_0024095 3300035398 Bacteria 3639
260 Ga0316574_0082417 3300035398 Bacteria 2044
261 Ga0316574_0118784 3300035398 Bacteria 1697
262 Ga0373937_0009257 3300036401 Bacteria 8551
263 Ga0395900_0008759 3300037418 Bacteria 10394
264 Ga0395900_0146668 3300037418 Bacteria 2413
265 Ga0395898_0032878 3300037466 Bacteria 5178
266 Ga0395898_0168643 3300037466 Bacteria 2093
267 Ga0395905_0029155 3300037471 Bacteria 5201
268 Ga0395901_0144181 3300038443 Bacteria 2503
269 Ga0395901_0345576 3300038443 Bacteria 1536
270 Ga0451853_1416621 3300041512 Bacteria 3684
271 Ga0466963_0000233 3300044694 Bacteria 24036
272 Ga0466970_0019251 3300044765 Bacteria 3538
273 Ga0466967_0000002 3300045976 Bacteria 219994
274 Ga0466967_0067231 3300045976 Bacteria 3196
275 Ga0495592_0000024 3300046454 Bacteria 136661
276 Ga0495603_0000102 3300046455 Bacteria 40074
277 Ga0495603_0001201 3300046455 Bacteria 15127
278 Ga0495603_0001271 3300046455 Bacteria 14685
279 Ga0495629_0000828 3300046459 Bacteria 25082
280 Ga0495629_0010841 3300046459 Bacteria 6627
281 Ga0495629_0070431 3300046459 Bacteria 2440
282 Ga0495641_0000004 3300046461 Bacteria 210501
283 Ga0495641_0016090 3300046461 Bacteria 3953
284 Ga0495651_0171738 3300046462 Bacteria 1543
285 Ga0495653_0077145 3300046463 Bacteria 2475
286 Ga0495653_0111487 3300046463 Bacteria 1965
287 Ga0495653_0167298 3300046463 Bacteria 1521
288 Ga0495582_0000003 3300046473 Bacteria 168880
289 Ga0495662_0001473 3300046476 Bacteria 11649
290 Ga0495662_0002109 3300046476 Bacteria 9973
291 Ga0495664_0035968 3300046477 Bacteria 2918
292 Ga0495594_0000009 3300046499 Bacteria 122139
293 Ga0495606_0000017 3300046507 Bacteria 284549
294 Ga0495608_0000013 3300046511 Bacteria 228481
295 Ga0495608_0000661 3300046511 Bacteria 23772
296 Ga0495608_0020565 3300046511 Bacteria 4537
297 Ga0495608_0080915 3300046511 Bacteria 2111
298 Ga0495618_0000267 3300046514 Bacteria 37924
299 Ga0495618_0181771 3300046514 Bacteria 1336
300 Ga0495620_0000041 3300046515 Bacteria 112605
301 Ga0495628_0000794 3300046516 Bacteria 29108
302 Ga0495628_0035805 3300046516 Bacteria 3988
303 Ga0495628_0089356 3300046516 Bacteria 2386
304 Ga0495628_0122167 3300046516 Bacteria 1997
305 Ga0495628_0243944 3300046516 Bacteria 1343
306 Ga0495630_0000026 3300046517 Bacteria 147084
307 Ga0495630_0000032 3300046517 Bacteria 134425
308 Ga0495630_0007095 3300046517 Bacteria 7981
309 Ga0495644_0002837 3300046523 Bacteria 6867
310 Ga0495652_0000018 3300046529 Bacteria 201634
311 Ga0495652_0086425 3300046529 Bacteria 2575
312 Ga0495586_0000254 3300046535 Bacteria 35015
313 Ga0495587_0000272 3300046536 Bacteria 36939
314 Ga0495598_0002543 3300046537 Bacteria 3771
315 Ga0495645_0006138 3300046543 Bacteria 8316
316 Ga0495645_0118566 3300046543 Bacteria 1865
317 Ga0495622_0000097 3300046557 Bacteria 76953
318 Ga0495667_0000038 3300046559 Bacteria 131349
319 Ga0495667_0060775 3300046559 Bacteria 2478
320 Ga0495634_0000002 3300046642 Bacteria 247842
321 Ga0495634_0001691 3300046642 Bacteria 19214
322 Ga0495634_0010144 3300046642 Bacteria 6911
323 Ga0495625_0000243 3300046660 Bacteria 85589
324 Ga0495635_0000005 3300046663 Bacteria 302178
325 Ga0495588_0000073 3300046674 Bacteria 219005
326 Ga0495588_0073193 3300046674 Bacteria 1784
327 Ga0495657_0000003 3300046675 Bacteria 279680
328 Ga0495657_0021495 3300046675 Bacteria 4629
329 Ga0495599_0005867 3300046678 Bacteria 7377
330 Ga0495599_0118123 3300046678 Bacteria 1649
331 Ga0495647_0000005 3300046681 Bacteria 125996
332 Ga0495647_0007800 3300046681 Bacteria 3594
333 Ga0495658_0000001 3300046683 Bacteria 385362
334 Ga0495658_0002091 3300046683 Bacteria 10135
335 Ga0495669_0000483 3300046684 Bacteria 18439
336 Ga0495669_0084535 3300046684 Bacteria 1459
337 Ga0495613_0000027 3300046689 Bacteria 146674
338 Ga0495613_0009561 3300046689 Bacteria 7202
339 Ga0495613_0112287 3300046689 Bacteria 1963
340 Ga0495624_0000123 3300046690 Bacteria 54291
341 Ga0495624_0000691 3300046690 Bacteria 26457
342 Ga0495624_0025621 3300046690 Bacteria 3871
343 Ga0495649_0004688 3300046694 Bacteria 8878
344 Ga0495600_0032852 3300046809 Bacteria 3367
345 Ga0495604_0000100 3300047317 Bacteria 72995
346 Ga0495604_0000723 3300047317 Bacteria 27948
347 Ga0495604_0032236 3300047317 Bacteria 4155
348 Ga0495674_0000039 3300047319 Bacteria 97645
349 Ga0495676_0007903 3300047321 Bacteria 9752
350 Ga0495676_0016441 3300047321 Bacteria 6568
351 Ga0495676_0028720 3300047321 Bacteria 4746
352 Ga0495680_0000007 3300047322 Bacteria 152053
353 Ga0495680_0000929 3300047322 Bacteria 32526
354 Ga0495680_0001001 3300047322 Bacteria 31451
355 Ga0495675_0000002 3300047444 Bacteria 216469
356 Ga0495675_0046104 3300047444 Bacteria 2776
357 Ga0495679_006392 3300047446 Bacteria 5081
358 Ga0495685_032826 3300047447 Bacteria 1784
359 Ga0495593_0068616 3300047673 Bacteria 1845
360 Ga0495602_0000034 3300048088 Bacteria 140722
361 Ga0495602_0006995 3300048088 Bacteria 11843
362 Ga0496100_0000001 3300048903 Bacteria 530179
363 Ga0496100_0000024 3300048903 Bacteria 116138
364 Ga0496100_0002659 3300048903 Bacteria 9113
365 Ga0496101_0000028 3300048904 Bacteria 198664
366 Ga0496101_0000072 3300048904 Bacteria 116138
367 Ga0496101_0001403 3300048904 Bacteria 14427
368 Ga0496101_0024877 3300048904 Bacteria 4150
369 Ga0496102_0000749 3300048905 Bacteria 31723
370 Ga0496102_0090421 3300048905 Bacteria 2833
371 Ga0496102_0098336 3300048905 Bacteria 2715
372 Ga0496102_0099089 3300048905 Bacteria 2705
373 Ga0496103_0000481 3300048906 Bacteria 33518
374 Ga0496103_0023194 3300048906 Bacteria 3741
375 Ga0496103_0152873 3300048906 Bacteria 1479
376 Ga0496104_0000008 3300048907 Bacteria 516976
377 Ga0496104_0000010 3300048907 Bacteria 475255
378 Ga0496104_0000579 3300048907 Bacteria 31244
379 Ga0496104_0034784 3300048907 Bacteria 4699
380 Ga0496105_0000003 3300048908 Bacteria 713251
381 Ga0496105_0000005 3300048908 Bacteria 475797
382 Ga0496105_0000051 3300048908 Bacteria 90365
383 Ga0496106_0000040 3300048909 Bacteria 108754
384 Ga0496106_0000042 3300048909 Bacteria 106662
385 Ga0496106_0000218 3300048909 Bacteria 40075
386 Ga0496106_0013759 3300048909 Bacteria 5977
387 Ga0496107_0000002 3300048910 Bacteria 320871
388 Ga0496107_0000025 3300048910 Bacteria 116138
389 Ga0496107_0021126 3300048910 Bacteria 4601
390 Ga0496107_0151562 3300048910 Bacteria 1715
391 Ga0496108_0000004 3300048911 Bacteria 545055
392 Ga0496108_0000005 3300048911 Bacteria 535059
393 Ga0496108_0014805 3300048911 Bacteria 6364
394 Ga0496108_0024629 3300048911 Bacteria 4956
395 Ga0496108_0030741 3300048911 Bacteria 4450
396 Ga0496108_0149035 3300048911 Bacteria 2018
397 Ga0496109_0000002 3300048912 Bacteria 443393
398 Ga0496109_0000013 3300048912 Bacteria 227469
399 Ga0496109_0000221 3300048912 Bacteria 56054
400 Ga0496109_0000378 3300048912 Bacteria 40469
401 Ga0496109_0067263 3300048912 Bacteria 3282
402 Ga0496109_0099553 3300048912 Bacteria 2696
403 Ga0496109_0300487 3300048912 Bacteria 1513
404 Ga0496110_0000052 3300048913 Bacteria 58549
405 Ga0496110_0032719 3300048913 Bacteria 4494
406 Ga0496110_0118739 3300048913 Bacteria 2381
407 Ga0496110_0321698 3300048913 Bacteria 1409
408 Ga0496110_0367488 3300048913 Bacteria 1311
409 Ga0496110_0419505 3300048913 Bacteria 1220
410 Ga0496111_0000121 3300048914 Bacteria 33902
411 Ga0496111_0026764 3300048914 Bacteria 4074
412 Ga0496112_0000026 3300048915 Bacteria 144758
413 Ga0496112_0000173 3300048915 Bacteria 41090
414 Ga0496112_0012664 3300048915 Bacteria 7755
415 Ga0496112_0081801 3300048915 Bacteria 3194
416 Ga0496113_0000005 3300048916 Bacteria 105956
417 Ga0496113_0012533 3300048916 Bacteria 5703
418 Ga0496113_0019903 3300048916 Bacteria 4706
419 Ga0496113_0024909 3300048916 Bacteria 4260
420 Ga0496113_0063062 3300048916 Bacteria 2801
421 Ga0496113_0206548 3300048916 Bacteria 1562
422 Ga0496114_0000003 3300048917 Bacteria 630981
423 Ga0496114_0012219 3300048917 Bacteria 6871
424 Ga0496114_0190191 3300048917 Bacteria 1796
425 Ga0496114_0267600 3300048917 Bacteria 1506
426 Ga0496115_0000016 3300048918 Bacteria 187067
427 Ga0496115_0051024 3300048918 Bacteria 3317
428 Ga0496116_0001008 3300048919 Bacteria 34374
429 Ga0496117_0006601 3300048920 Bacteria 11660
430 Ga0496117_0074704 3300048920 Bacteria 2255
431 Ga0496119_0004936 3300048922 Bacteria 13043
432 Ga0496119_0015223 3300048922 Bacteria 5946
433 Ga0496119_0015990 3300048922 Bacteria 5736
434 Ga0496120_0009403 3300048923 Bacteria 6944
435 Ga0496121_0021469 3300048924 Bacteria 6321
436 Ga0496121_0022580 3300048924 Bacteria 6097
437 Ga0496121_0167567 3300048924 Bacteria 1599
438 Ga0496124_0026458 3300048927 Bacteria 5230
439 Ga0496124_0237578 3300048927 Bacteria 1357
440 Ga0495682_0089528 3300049460 Bacteria 1106
441 Ga0501031_0006509 3300049568 Bacteria 7613
442 Ga0501032_0007300 3300049569 Bacteria 8084
443 Ga0501033_0001901 3300049570 Bacteria 18171
444 Ga0501034_0007803 3300049571 Bacteria 11386
445 Ga0501034_0030315 3300049571 Bacteria 5498
446 Ga0501036_0001783 3300049572 Bacteria 16706
447 Ga0501037_0001034 3300049573 Bacteria 20571
448 Ga0501038_0002131 3300049574 Bacteria 18372
449 Ga0501039_0023575 3300049575 Bacteria 4723
450 Ga0501039_0045783 3300049575 Bacteria 3380
451 Ga0501040_0075248 3300049576 Bacteria 2333
452 Ga0501042_0077366 3300049578 Bacteria 2382
453 Ga0501042_0087641 3300049578 Bacteria 2233
454 Ga0501043_0009548 3300049579 Bacteria 7604
455 Ga0501046_0011259 3300049580 Bacteria 7656
456 Ga0501047_0013797 3300049581 Bacteria 7674
457 Ga0501047_0015422 3300049581 Bacteria 7279
458 Ga0501047_0075389 3300049581 Bacteria 3246
459 Ga0501047_0200521 3300049581 Bacteria 1856
460 Ga0501048_0008391 3300049582 Bacteria 7811
461 Ga0501067_0201205 3300049583 Bacteria 1109
462 Ga0501069_0014098 3300049585 Bacteria 4268
463 Ga0501069_0047144 3300049585 Bacteria 2391
464 Ga0501070_0001885 3300049586 Bacteria 18541
465 Ga0501071_0009677 3300049587 Bacteria 6433
466 Ga0501071_0058417 3300049587 Bacteria 2789
467 Ga0501071_0215211 3300049587 Bacteria 1445
468 Ga0501072_0011549 3300049588 Bacteria 6749
469 Ga0501072_0223007 3300049588 Bacteria 1502
470 Ga0501073_0022180 3300049589 Bacteria 4575
471 Ga0501075_0068758 3300049591 Bacteria 2676
472 Ga0501076_0018024 3300049592 Bacteria 5373
473 Ga0501076_0025434 3300049592 Bacteria 4581
474 Ga0501077_0051369 3300049593 Bacteria 2620
475 Ga0501079_0013207 3300049741 Bacteria 6298
476 Ga0501079_0080196 3300049741 Bacteria 2524
477 Ga0501079_0106903 3300049741 Bacteria 2171
478 Ga0501080_0332763 3300049742 Bacteria 1373
479 Ga0501081_0054753 3300049743 Bacteria 2756
480 Ga0501083_0009544 3300049744 Bacteria 6854
481 Ga0501083_0032875 3300049744 Bacteria 3554
482 Ga0501083_0076030 3300049744 Bacteria 2229
483 Ga0501035_0012533 3300049822 Bacteria 7831
484 Ga0501035_0314754 3300049822 Bacteria 1316
485 Ga0501044_0017031 3300049823 Bacteria 7798
486 Ga0501044_0059974 3300049823 Bacteria 3897
487 Ga0501044_0243704 3300049823 Bacteria 1740
488 Ga0501045_0082876 3300049824 Bacteria 2365
489 Ga0501045_0198254 3300049824 Bacteria 1496
490 nmdc:mga03n38_11283_c1 3300050490 Bacteria 3322
491 nmdc:mga00v17_23670_c1 3300050491 Bacteria 3555
492 nmdc:mga00v17_3816_c1 3300050491 Bacteria 7772
493 nmdc:mga0yw44_152169_c1 3300050492 Bacteria 1510
494 nmdc:mga0yw44_76137_c1 3300050492 Bacteria 2094
495 nmdc:mga06z11_43922_c1 3300050494 Bacteria 2251
496 nmdc:mga05p37_105886_c1 3300050507 Bacteria 3459
497 nmdc:mga05p37_122843_c1 3300050507 Bacteria 3189
498 nmdc:mga05p37_19674_c1 3300050507 Bacteria 8168
499 nmdc:mga09592_331972_c1 3300050508 Bacteria 1316
500 nmdc:mga0qj67_36725_c1 3300050509 Bacteria 3835
501 nmdc:mga0qj67_84895_c1 3300050509 Bacteria 2539
502 nmdc:mga06r32_15234_c1 3300050510 Bacteria 6984
503 nmdc:mga06r32_34834_c1 3300050510 Bacteria 4749
504 nmdc:mga08y16_2963_c1 3300050511 Bacteria 17497
505 nmdc:mga08y16_911352_c1 3300050511 Bacteria 864
506 nmdc:mga0n895_150585_c1 3300050512 Bacteria 2357
507 nmdc:mga0n895_25001_c1 3300050512 Bacteria 5637
508 nmdc:mga08x19_234741_c1 3300050514 Bacteria 1263
509 nmdc:mga0a205_219773_c1 3300050515 Bacteria 1786
510 nmdc:mga0a205_4_c1 3300050515 Bacteria 168154
511 nmdc:mga0a205_61369_c1 3300050515 Bacteria 3631
512 Ga0495601_0000017 3300053077 Bacteria 204209
513 Ga0495601_0000318 3300053077 Bacteria 25520
514 Ga0495601_0024434 3300053077 Bacteria 3721
515 Ga0495601_0028110 3300053077 Bacteria 3481
516 Ga0495601_0038538 3300053077 Bacteria 2990
517 Ga0495601_0048712 3300053077 Bacteria 2669
518 Ga0495601_0084681 3300053077 Bacteria 2037
519 Ga0495601_0201060 3300053077 Bacteria 1302
520 Ga0495612_0000155 3300053078 Bacteria 28711
521 Ga0495612_0003068 3300053078 Bacteria 6928
522 Ga0495612_0020692 3300053078 Bacteria 2637
523 Ga0495612_0084839 3300053078 Bacteria 1334
524 Ga0495655_0000005 3300053083 Bacteria 257472
525 Ga0495595_0000007 3300053084 Bacteria 228504
526 Ga0495595_0000378 3300053084 Bacteria 16864
527 Ga0495595_0036298 3300053084 Bacteria 2236
528 Ga0495595_0058305 3300053084 Bacteria 1803
529 Ga0495619_0000001 3300053085 Bacteria 586054
530 Ga0495619_0000026 3300053085 Bacteria 167387
531 Ga0495619_0000088 3300053085 Bacteria 69615
532 Ga0495619_0000127 3300053085 Bacteria 55995
533 Ga0495619_0000346 3300053085 Bacteria 32476
534 Ga0495619_0006101 3300053085 Bacteria 7631
535 Ga0495619_0039095 3300053085 Bacteria 3096
536 Ga0495619_0127908 3300053085 Bacteria 1744
537 Ga0500566_0001830 3300053094 Bacteria 12505
538 Ga0500641_0000873 3300053096 Bacteria 10782
539 Ga0500595_014028 3300053119 Bacteria 3052
540 Ga0500614_001618 3300053123 Bacteria 5307
541 Ga0500628_000013 3300053129 Bacteria 106419
542 Ga0501084_0023130 3300054114 Bacteria 5188
543 Ga0501082_0079130 3300060353 Bacteria 2836
544 Ga0501082_0146498 3300060353 Bacteria 2050
545 Ga0501082_0187661 3300060353 Bacteria 1799
546 Ga0530510_0046085 3300061734 Bacteria 3149
547 2787438033 2786546517 Bacteria 6614109
548 Ga0495608_0018918
549 LJQas_1006601
550 JGI24746J21847_1002058
551 JGI24748J21848_1000356
552 JGI24034J26672_10000216
553 Ga0070683_100023947
554 Ga0070666_10009188
555 Ga0070682_100000023
556 Ga0070682_100000026
557 Ga0068868_100000694
558 Ga0068868_100072591
559 Ga0070689_100081610
560 Ga0070689_100210380
561 Ga0070691_10000004
562 Ga0070691_10000970
563 Ga0070687_100012467
564 Ga0070661_100000004
565 Ga0070668_100010212
566 Ga0070668_100019643
567 Ga0070675_100000050
568 Ga0070674_100000002
569 Ga0070674_100000141
570 Ga0070673_100100925
571 Ga0070688_100000686
572 Ga0070688_100076412
573 Ga0070659_100000852
574 Ga0070659_100003678
575 Ga0070667_100003085
576 Ga0070667_100068631
577 Ga0070714_100004088
578 Ga0070714_100356459
579 Ga0070713_100000503
580 Ga0070713_100119207
581 Ga0070711_100016216
582 Ga0070711_100036952
583 Ga0070663_100021932
584 Ga0070678_100226970
585 Ga0070662_100000001
586 Ga0070681_10080275
587 Ga0068867_100000078
588 Ga0068867_100007697
589 Ga0070685_10000010
590 Ga0070685_10001080
591 Ga0070679_100000424
592 Ga0070679_100000471
593 Ga0070684_100012351
594 Ga0070684_100048102
595 Ga0070684_100048700
596 Ga0070684_100143343
597 Ga0070672_100000031
598 Ga0070693_100001579
599 Ga0070665_100000022
600 Ga0070665_100002868
601 Ga0070665_100652886
602 Ga0070664_100193884
603 Ga0070664_100212796
604 Ga0068854_100000082
605 Ga0068854_100021369
606 Ga0068856_100000136
607 Ga0068856_100005657
608 Ga0068852_100064550
609 Ga0068864_100000090
610 Ga0068866_10000004
611 Ga0068866_10004817
612 Ga0068851_10002105
613 Ga0068851_10083118
614 Ga0068863_100000261
615 Ga0068863_100008832
616 Ga0068863_100268176
617 Ga0068858_100000046
618 Ga0068858_100001180
619 Ga0068860_100003017
620 Ga0068862_100001309
621 Ga0068862_100202398
622 Ga0081455_10009497
623 Ga0081455_10010690
624 Ga0081455_10016053
625 Ga0081455_10047858
626 Ga0081455_10113472
627 Ga0081538_10000814
628 Ga0081538_10053974
629 Ga0081540_1000174
630 Ga0081540_1000557
631 Ga0081539_10000776
632 Ga0075365_10001651
633 Ga0075365_10006453
634 Ga0075365_10008059
635 Ga0075365_10012400
636 Ga0075365_10043160
637 Ga0075363_100009258
638 Ga0075364_10004153
639 Ga0075364_10068807
640 Ga0070715_10000008
641 Ga0075367_10125368
642 Ga0068871_100086946
643 Ga0075428_100024481
644 Ga0075428_100243017
645 Ga0075430_100019608
646 Ga0075430_100026320
647 Ga0075431_100003746
648 Ga0075431_100022444
649 Ga0075433_10000337
650 Ga0075433_10185196
651 Ga0075434_100001338
652 Ga0075434_100012705
653 Ga0068865_100054085
654 Ga0068865_100078856
655 Ga0075436_100151343
656 Ga0111539_10352080
657 Ga0105245_10000040
658 Ga0105245_10000117
659 Ga0105245_10000629
660 Ga0105245_10006841
661 Ga0105245_10009368
662 Ga0105247_10000131
663 Ga0114129_10030345
664 Ga0114129_10125475
665 Ga0114129_10284908
666 Ga0105243_10010381
667 Ga0105243_10010662
668 Ga0105243_10180684
669 Ga0105242_10000063
670 Ga0105242_10000428
671 Ga0105248_10192317
672 Ga0105237_10030852
673 Ga0105237_10237342
674 Ga0105238_10000033
675 Ga0105249_10000218
676 Ga0105249_10004038
677 Ga0105249_10143982
678 Ga0105249_10563279
679 Ga0105239_10030284
680 Ga0105239_10210502
681 Ga0105239_10549574
682 Ga0105246_10326253
683 Ga0157370_10004940
684 Ga0157374_10001719
685 Ga0157374_10203473
686 Ga0157378_10018349
687 Ga0157378_10023605
688 Ga0157378_10101111
689 Ga0157372_10000146
690 Ga0157375_10000492
691 Ga0157375_10030090
692 Ga0157375_10067540
693 Ga0157380_10000007
694 Ga0157380_10001343
695 Ga0157379_10049463
696 Ga0157379_10063407
697 Ga0157379_10246886
698 Ga0157376_10010885
699 Ga0163161_10000027
700 Ga0206350_10333991
701 Ga0206354_10497300
702 Ga0206354_11031077
703 Ga0206353_11807736
704 Ga0224712_10022571
705 Ga0207656_10002076
706 Ga0207642_10000005
707 Ga0207642_10000737
708 Ga0207642_10003444
709 Ga0207710_10000268
710 Ga0207680_10004865
711 Ga0207685_10000012
712 Ga0207707_10023616
713 Ga0207695_10251788
714 Ga0207671_10084315
715 Ga0207693_10014431
716 Ga0207693_10015147
717 Ga0207663_10004985
718 Ga0207662_10034095
719 Ga0207657_10007235
720 Ga0207649_10000003
721 Ga0207652_10000232
722 Ga0207652_10000412
723 Ga0207694_10000012
724 Ga0207659_10000055
725 Ga0207687_10000046
726 Ga0207687_10000070
727 Ga0207687_10000095
728 Ga0207687_10006279
729 Ga0207687_10101546
730 Ga0207700_10000003
731 Ga0207664_10000006
732 Ga0207644_10152774
733 Ga0207690_10002537
734 Ga0207690_10112859
735 Ga0207706_10000003
736 Ga0207686_10000124
737 Ga0207686_10000395
738 Ga0207670_10142256
739 Ga0207669_10000003
740 Ga0207669_10000021
741 Ga0207704_10000104
742 Ga0207704_10026478
743 Ga0207691_10000178
744 Ga0207691_10003769
745 Ga0207711_10000011
746 Ga0207711_10073917
747 Ga0207661_10002170
748 Ga0207661_10003560
749 Ga0207661_10005006
750 Ga0207661_10180341
751 Ga0207679_10128408
752 Ga0207667_10470726
753 Ga0207651_10032078
754 Ga0207712_10000027
755 Ga0207712_10019638
756 Ga0207712_10282739
757 Ga0207668_10006557
758 Ga0207640_10000054
759 Ga0207658_10015937
760 Ga0207677_10001111
761 Ga0207703_10000020
762 Ga0207703_10000042
763 Ga0207678_10001975
764 Ga0207678_10002172
765 Ga0207708_10225037
766 Ga0207702_10000105
767 Ga0207702_10001788
768 Ga0207641_10000062
769 Ga0207641_10006453
770 Ga0207648_10013215
771 Ga0207676_10000016
772 Ga0207674_10050746
773 Ga0207674_10414054
774 Ga0207675_100160315
775 Ga0207683_10033719
776 Ga0207698_10000015
777 Ga0207428_10013276
778 Ga0268266_10000029
779 Ga0268266_10000526
780 Ga0268266_10000990
781 Ga0268266_10081443
782 Ga0268265_10008679
783 Ga0268264_10001191
784 Ga0268264_10024255
785 Ga0265337_1001256
786 Ga0265326_10000127
787 Ga0265319_1000010
788 Ga0265322_10000005
789 Ga0265336_10026744
790 Ga0265338_10000287
791 Ga0265328_10019084
792 Ga0265320_10000010
793 Ga0265325_10051053
794 Ga0265329_10001050
795 Ga0265339_10016752
796 Ga0265331_10000217
797 Ga0265327_10000040
798 Ga0265316_10035110
799 Ga0265314_10000491
800 Ga0265342_10059103
801 Ga0316576_10000603
802 Ga0307406_10112797
803 Ga0307409_100453414
804 Ga0307415_100011748
805 Ga0316583_10056789
806 Ga0316574_0024095
807 Ga0316574_0082417
808 Ga0316574_0118784
809 Ga0373937_0009257
810 Ga0395900_0008759
811 Ga0395900_0146668
812 Ga0395898_0032878
813 Ga0395898_0168643
814 Ga0395905_0029155
815 Ga0395901_0144181
816 Ga0395901_0345576
817 Ga0451853_1416621
818 Ga0466963_0000233
819 Ga0466970_0019251
820 Ga0466967_0000002
821 Ga0466967_0067231
822 Ga0495592_0000024
823 Ga0495603_0000102
824 Ga0495603_0001201
825 Ga0495603_0001271
826 Ga0495629_0000828
827 Ga0495629_0010841
828 Ga0495629_0070431
829 Ga0495641_0000004
830 Ga0495641_0016090
831 Ga0495651_0171738
832 Ga0495653_0077145
833 Ga0495653_0111487
834 Ga0495653_0167298
835 Ga0495582_0000003
836 Ga0495662_0001473
837 Ga0495662_0002109
838 Ga0495664_0035968
839 Ga0495594_0000009
840 Ga0495606_0000017
841 Ga0495608_0000013
842 Ga0495608_0000661
843 Ga0495608_0020565
844 Ga0495608_0080915
845 Ga0495618_0000267
846 Ga0495618_0181771
847 Ga0495620_0000041
848 Ga0495628_0000794
849 Ga0495628_0035805
850 Ga0495628_0089356
851 Ga0495628_0122167
852 Ga0495628_0243944
853 Ga0495630_0000026
854 Ga0495630_0000032
855 Ga0495630_0007095
856 Ga0495644_0002837
857 Ga0495652_0000018
858 Ga0495652_0086425
859 Ga0495586_0000254
860 Ga0495587_0000272
861 Ga0495598_0002543
862 Ga0495645_0006138
863 Ga0495645_0118566
864 Ga0495622_0000097
865 Ga0495667_0000038
866 Ga0495667_0060775
867 Ga0495634_0000002
868 Ga0495634_0001691
869 Ga0495634_0010144
870 Ga0495625_0000243
871 Ga0495635_0000005
872 Ga0495588_0000073
873 Ga0495588_0073193
874 Ga0495657_0000003
875 Ga0495657_0021495
876 Ga0495599_0005867
877 Ga0495599_0118123
878 Ga0495647_0000005
879 Ga0495647_0007800
880 Ga0495658_0000001
881 Ga0495658_0002091
882 Ga0495669_0000483
883 Ga0495669_0084535
884 Ga0495613_0000027
885 Ga0495613_0009561
886 Ga0495613_0112287
887 Ga0495624_0000123
888 Ga0495624_0000691
889 Ga0495624_0025621
890 Ga0495649_0004688
891 Ga0495600_0032852
892 Ga0495604_0000100
893 Ga0495604_0000723
894 Ga0495604_0032236
895 Ga0495674_0000039
896 Ga0495676_0007903
897 Ga0495676_0016441
898 Ga0495676_0028720
899 Ga0495680_0000007
900 Ga0495680_0000929
901 Ga0495680_0001001
902 Ga0495675_0000002
903 Ga0495675_0046104
904 Ga0495679_006392
905 Ga0495685_032826
906 Ga0495593_0068616
907 Ga0495602_0000034
908 Ga0495602_0006995
909 Ga0496100_0000001
910 Ga0496100_0000024
911 Ga0496100_0002659
912 Ga0496101_0000028
913 Ga0496101_0000072
914 Ga0496101_0001403
915 Ga0496101_0024877
916 Ga0496102_0000749
917 Ga0496102_0090421
918 Ga0496102_0098336
919 Ga0496102_0099089
920 Ga0496103_0000481
921 Ga0496103_0023194
922 Ga0496103_0152873
923 Ga0496104_0000008
924 Ga0496104_0000010
925 Ga0496104_0000579
926 Ga0496104_0034784
927 Ga0496105_0000003
928 Ga0496105_0000005
929 Ga0496105_0000051
930 Ga0496106_0000040
931 Ga0496106_0000042
932 Ga0496106_0000218
933 Ga0496106_0013759
934 Ga0496107_0000002
935 Ga0496107_0000025
936 Ga0496107_0021126
937 Ga0496107_0151562
938 Ga0496108_0000004
939 Ga0496108_0000005
940 Ga0496108_0014805
941 Ga0496108_0024629
942 Ga0496108_0030741
943 Ga0496108_0149035
944 Ga0496109_0000002
945 Ga0496109_0000013
946 Ga0496109_0000221
947 Ga0496109_0000378
948 Ga0496109_0067263
949 Ga0496109_0099553
950 Ga0496109_0300487
951 Ga0496110_0000052
952 Ga0496110_0032719
953 Ga0496110_0118739
954 Ga0496110_0321698
955 Ga0496110_0367488
956 Ga0496110_0419505
957 Ga0496111_0000121
958 Ga0496111_0026764
959 Ga0496112_0000026
960 Ga0496112_0000173
961 Ga0496112_0012664
962 Ga0496112_0081801
963 Ga0496113_0000005
964 Ga0496113_0012533
965 Ga0496113_0019903
966 Ga0496113_0024909
967 Ga0496113_0063062
968 Ga0496113_0206548
969 Ga0496114_0000003
970 Ga0496114_0012219
971 Ga0496114_0190191
972 Ga0496114_0267600
973 Ga0496115_0000016
974 Ga0496115_0051024
975 Ga0496116_0001008
976 Ga0496117_0006601
977 Ga0496117_0074704
978 Ga0496119_0004936
979 Ga0496119_0015223
980 Ga0496119_0015990
981 Ga0496120_0009403
982 Ga0496121_0021469
983 Ga0496121_0022580
984 Ga0496121_0167567
985 Ga0496124_0026458
986 Ga0496124_0237578
987 Ga0495682_0089528
988 Ga0501031_0006509
989 Ga0501032_0007300
990 Ga0501033_0001901
991 Ga0501034_0007803
992 Ga0501034_0030315
993 Ga0501036_0001783
994 Ga0501037_0001034
995 Ga0501038_0002131
996 Ga0501039_0023575
997 Ga0501039_0045783
998 Ga0501040_0075248
999 Ga0501042_0077366
1000 Ga0501042_0087641
1001 Ga0501043_0009548
1002 Ga0501046_0011259
1003 Ga0501047_0013797
1004 Ga0501047_0015422
1005 Ga0501047_0075389
1006 Ga0501047_0200521
1007 Ga0501048_0008391
1008 Ga0501067_0201205
1009 Ga0501069_0014098
1010 Ga0501069_0047144
1011 Ga0501070_0001885
1012 Ga0501071_0009677
1013 Ga0501071_0058417
1014 Ga0501071_0215211
1015 Ga0501072_0011549
1016 Ga0501072_0223007
1017 Ga0501073_0022180
1018 Ga0501075_0068758
1019 Ga0501076_0018024
1020 Ga0501076_0025434
1021 Ga0501077_0051369
1022 Ga0501079_0013207
1023 Ga0501079_0080196
1024 Ga0501079_0106903
1025 Ga0501080_0332763
1026 Ga0501081_0054753
1027 Ga0501083_0009544
1028 Ga0501083_0032875
1029 Ga0501083_0076030
1030 Ga0501035_0012533
1031 Ga0501035_0314754
1032 Ga0501044_0017031
1033 Ga0501044_0059974
1034 Ga0501044_0243704
1035 Ga0501045_0082876
1036 Ga0501045_0198254
1037 nmdc:mga03n38_11283_c1
1038 nmdc:mga00v17_23670_c1
1039 nmdc:mga00v17_3816_c1
1040 nmdc:mga0yw44_152169_c1
1041 nmdc:mga0yw44_76137_c1
1042 nmdc:mga06z11_43922_c1
1043 nmdc:mga05p37_105886_c1
1044 nmdc:mga05p37_122843_c1
1045 nmdc:mga05p37_19674_c1
1046 nmdc:mga09592_331972_c1
1047 nmdc:mga0qj67_36725_c1
1048 nmdc:mga0qj67_84895_c1
1049 nmdc:mga06r32_15234_c1
1050 nmdc:mga06r32_34834_c1
1051 nmdc:mga08y16_2963_c1
1052 nmdc:mga08y16_911352_c1
1053 nmdc:mga0n895_150585_c1
1054 nmdc:mga0n895_25001_c1
1055 nmdc:mga08x19_234741_c1
1056 nmdc:mga0a205_219773_c1
1057 nmdc:mga0a205_4_c1
1058 nmdc:mga0a205_61369_c1
1059 Ga0495601_0000017
1060 Ga0495601_0000318
1061 Ga0495601_0024434
1062 Ga0495601_0028110
1063 Ga0495601_0038538
1064 Ga0495601_0048712
1065 Ga0495601_0084681
1066 Ga0495601_0201060
1067 Ga0495612_0000155
1068 Ga0495612_0003068
1069 Ga0495612_0020692
1070 Ga0495612_0084839
1071 Ga0495655_0000005
1072 Ga0495595_0000007
1073 Ga0495595_0000378
1074 Ga0495595_0036298
1075 Ga0495595_0058305
1076 Ga0495619_0000001
1077 Ga0495619_0000026
1078 Ga0495619_0000088
1079 Ga0495619_0000127
1080 Ga0495619_0000346
1081 Ga0495619_0006101
1082 Ga0495619_0039095
1083 Ga0495619_0127908
1084 Ga0500566_0001830
1085 Ga0500641_0000873
1086 Ga0500595_014028
1087 Ga0500614_001618
1088 Ga0500628_000013
1089 Ga0501084_0023130
1090 Ga0501082_0079130
1091 Ga0501082_0146498
1092 Ga0501082_0187661
1093 Ga0530510_0046085
1094 2787438033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

155

234

0.89

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

12

305

0.87

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

56

288

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ccr-assembly2.cif.gz_D crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor 0.907 9 316
3zdn-assembly2.cif.gz_D d11-c mutant of monoamine oxidase from aspergillus niger 0.899 9 40
4ccr-assembly2.cif.gz_D crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor 0.8978 9 316
5mh4-assembly1.cif.gz_A crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) 0.8907 11 316
4up3-assembly1.cif.gz_B crystal structure of the mutant c140s,c286q thioredoxin reductase from entamoeba histolytica 0.886 9 316
ID Description Score Start End Superfamily
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9879 123 247 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9808 123 247 3.50.50.60
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.98 123 247 3.50.50.60
4zn0C02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9748 123 247 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9725 123 247 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3C0YJU2-F1-model_v4 deleted 0.9932 141 207
AF-A0A6B3EPH4-F1-model_v4 FAD-dependent oxidoreductase 0.9846 119 233 GO:0016668
AF-A0A6N6X486-F1-model_v4 deleted 0.9573 119 243
AF-A0A3D5UWY6-F1-model_v4 Thioredoxin-disulfide reductase 0.9565 148 238 GO:0016491
AF-A0A2H9SVM5-F1-model_v4 Thioredoxin-disulfide reductase 0.9492 8 314 GO:0016491

Map