F462155

General Info

Members Datasets Scaffolds Average Seq Length
547 274 1094 163

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0572752|Ga0496126_0572752_156_704
Length 182
Sequence MGYPDNALAAGEQIVLHRHPHWKRLIWPIVIFVLVTGLAAFGSGYVNSTHWQQLAKNIIFGVVWGIWLVIIGWLTLWPLLTWLTTHFVVTNRRVMYRHGVLTRSGIDIPVARINSVEFRDKVWERMFRTGTLIIESASQDPLEFYDIPRVEQVHSLLYHEVFDTLGGDEADSRTHNQRRPPG

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
149 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
157 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
160 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
161 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
162 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
163 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
255 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
256 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
257 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
258 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
259 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
260 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
263 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
264 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
269 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
270 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
271 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
272 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
273 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
274 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0
Isolates 1.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.1
Nodule 0
Rhizoplane 12.98
Rhizosphere 56.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0572752 3300048929 Bacteria 893
2 JGI24739J22299_10033735 3300001989 Bacteria 1749
3 JGI24737J22298_10113916 3300001990 Bacteria 799
4 JGI24750J21931_1003926 3300002070 Bacteria 1792
5 JGI24749J21850_1007053 3300002076 Bacteria 1563
6 rootH2_10075376 3300003320 Bacteria 4994
7 Ga0055540_1000100 3300003792 Bacteria 96138
8 Ga0055540_1003155 3300003792 Bacteria 8144
9 Ga0070676_10011349 3300005328 Bacteria 4843
10 Ga0070683_100192695 3300005329 Bacteria 1936
11 Ga0070670_100061999 3300005331 Bacteria 3210
12 Ga0068869_100015359 3300005334 Bacteria 5134
13 Ga0070666_10197027 3300005335 Bacteria 1416
14 Ga0070682_100111140 3300005337 Bacteria 1826
15 Ga0068868_100005128 3300005338 Bacteria 9200
16 Ga0068868_101054571 3300005338 Bacteria 746
17 Ga0070689_100038446 3300005340 Bacteria 3661
18 Ga0070691_10006518 3300005341 Bacteria 5336
19 Ga0070692_10076290 3300005345 Bacteria 1796
20 Ga0070668_100000209 3300005347 Bacteria 38393
21 Ga0070668_100438844 3300005347 Bacteria 1120
22 Ga0070668_100968985 3300005347 Bacteria 763
23 Ga0070669_100002355 3300005353 Bacteria 13657
24 Ga0070669_100374814 3300005353 Bacteria 1160
25 Ga0070671_100054861 3300005355 Bacteria 3314
26 Ga0070674_100001562 3300005356 Bacteria 12273
27 Ga0070674_100077978 3300005356 Bacteria 2360
28 Ga0070667_100000027 3300005367 Bacteria 181315
29 Ga0070667_100000433 3300005367 Bacteria 44023
30 Ga0070667_100259513 3300005367 Bacteria 1555
31 Ga0070703_10047822 3300005406 Bacteria 1356
32 Ga0070709_10440777 3300005434 Bacteria 979
33 Ga0070713_100410614 3300005436 Bacteria 1266
34 Ga0070710_10001053 3300005437 Bacteria 13107
35 Ga0070710_10387208 3300005437 Bacteria 934
36 Ga0070701_10006565 3300005438 Bacteria 4904
37 Ga0070711_100003217 3300005439 Bacteria 9481
38 Ga0070705_100017992 3300005440 Bacteria 3696
39 Ga0070700_100004150 3300005441 Bacteria 7554
40 Ga0070694_100027340 3300005444 Bacteria 3704
41 Ga0070708_101241556 3300005445 Bacteria 697
42 Ga0070663_101000465 3300005455 Bacteria 727
43 Ga0070678_100002565 3300005456 Bacteria 9976
44 Ga0070678_100027656 3300005456 Bacteria 3854
45 Ga0070662_100013613 3300005457 Bacteria 5415
46 Ga0068867_100003320 3300005459 Bacteria 11334
47 Ga0070684_100061103 3300005535 Bacteria 3297
48 Ga0068853_100043081 3300005539 Bacteria 3862
49 Ga0068853_100274834 3300005539 Bacteria 1552
50 Ga0070686_100340293 3300005544 Bacteria 1124
51 Ga0070686_100458757 3300005544 Bacteria 981
52 Ga0070695_100483296 3300005545 Bacteria 955
53 Ga0070693_101015634 3300005547 Bacteria 628
54 Ga0070665_100005485 3300005548 Bacteria 13075
55 Ga0070704_100000086 3300005549 Bacteria 31885
56 Ga0068855_100323430 3300005563 Bacteria 1704
57 Ga0068854_100000670 3300005578 Bacteria 20461
58 Ga0070702_100001271 3300005615 Bacteria 10230
59 Ga0068859_100000860 3300005617 Bacteria 30921
60 Ga0068859_100000968 3300005617 Bacteria 29395
61 Ga0068864_101080537 3300005618 Bacteria 798
62 Ga0068866_10000540 3300005718 Bacteria 17290
63 Ga0068861_100009657 3300005719 Bacteria 6665
64 Ga0068863_100000960 3300005841 Bacteria 28955
65 Ga0068863_100002556 3300005841 Bacteria 18062
66 Ga0068858_100038871 3300005842 Bacteria 4414
67 Ga0068858_100200031 3300005842 Bacteria 1889
68 Ga0068860_100000141 3300005843 Bacteria 117843
69 Ga0068860_100001099 3300005843 Bacteria 29763
70 Ga0068862_100000177 3300005844 Bacteria 70443
71 Ga0068862_100002319 3300005844 Bacteria 16991
72 Ga0081455_10019739 3300005937 Bacteria 6366
73 Ga0081538_10055649 3300005981 Bacteria 2326
74 Ga0081540_1041975 3300005983 Bacteria 2365
75 Ga0075365_10044396 3300006038 Bacteria 2912
76 Ga0075365_10082718 3300006038 Bacteria 2177
77 Ga0075365_10145223 3300006038 Bacteria 1648
78 Ga0075365_10382264 3300006038 Bacteria 993
79 Ga0075368_10036290 3300006042 Bacteria 1926
80 Ga0075363_100020309 3300006048 Bacteria 3330
81 Ga0075363_100089034 3300006048 Bacteria 1697
82 Ga0075363_100104543 3300006048 Bacteria 1570
83 Ga0075363_100104825 3300006048 Bacteria 1568
84 Ga0075363_100107833 3300006048 Bacteria 1546
85 Ga0075363_100447481 3300006048 Bacteria 763
86 Ga0075364_10000108 3300006051 Bacteria 33962
87 Ga0075364_10004868 3300006051 Bacteria 7780
88 Ga0075364_10025455 3300006051 Bacteria 3766
89 Ga0075364_10027011 3300006051 Bacteria 3664
90 Ga0075364_10112511 3300006051 Bacteria 1818
91 Ga0075364_10164289 3300006051 Bacteria 1499
92 Ga0075364_10259179 3300006051 Bacteria 1182
93 Ga0070715_10001054 3300006163 Bacteria 7799
94 Ga0070716_100000791 3300006173 Bacteria 13599
95 Ga0070712_100005332 3300006175 Bacteria 7958
96 Ga0075362_10068291 3300006177 Bacteria 1619
97 Ga0075362_10226937 3300006177 Bacteria 914
98 Ga0075367_10013766 3300006178 Bacteria 4361
99 Ga0075367_10041233 3300006178 Bacteria 2698
100 Ga0075367_10249319 3300006178 Bacteria 1113
101 Ga0075369_10000202 3300006186 Bacteria 17447
102 Ga0075369_10001962 3300006186 Bacteria 7228
103 Ga0075369_10007005 3300006186 Bacteria 4280
104 Ga0075369_10015603 3300006186 Bacteria 3052
105 Ga0075369_10146357 3300006186 Bacteria 1079
106 Ga0075369_10168359 3300006186 Bacteria 1005
107 Ga0075369_10208269 3300006186 Bacteria 903
108 Ga0075366_10093837 3300006195 Bacteria 1799
109 Ga0075370_10011565 3300006353 Bacteria 4640
110 Ga0075370_10051122 3300006353 Bacteria 2344
111 Ga0068865_100001804 3300006881 Bacteria 12577
112 Ga0097620_100000860 3300006931 Bacteria 30921
113 Ga0097620_100000968 3300006931 Bacteria 29395
114 Ga0105251_10093623 3300009011 Bacteria 1378
115 Ga0105240_10425321 3300009093 Bacteria 1491
116 Ga0111539_10504164 3300009094 Bacteria 1410
117 Ga0105245_10004474 3300009098 Bacteria 12356
118 Ga0105245_10744273 3300009098 Bacteria 1016
119 Ga0105247_10000113 3300009101 Bacteria 81617
120 Ga0105247_10000167 3300009101 Bacteria 64475
121 Ga0105243_10004592 3300009148 Bacteria 10886
122 Ga0105243_11651377 3300009148 Bacteria 669
123 Ga0105241_10079798 3300009174 Bacteria 2560
124 Ga0105241_10979724 3300009174 Bacteria 790
125 Ga0105242_10004395 3300009176 Bacteria 10962
126 Ga0105242_11451455 3300009176 Bacteria 715
127 Ga0105248_10000054 3300009177 Bacteria 143260
128 Ga0105248_10007029 3300009177 Bacteria 12331
129 Ga0105248_10156503 3300009177 Bacteria 2572
130 Ga0105248_10643306 3300009177 Bacteria 1196
131 Ga0105237_10000454 3300009545 Bacteria 58115
132 Ga0105237_10023217 3300009545 Bacteria 6358
133 Ga0105237_10053563 3300009545 Bacteria 4046
134 Ga0105238_11257602 3300009551 Bacteria 765
135 Ga0105249_10000013 3300009553 Bacteria 283609
136 Ga0105249_10005325 3300009553 Bacteria 11104
137 Ga0105249_10658309 3300009553 Bacteria 1105
138 Ga0105249_12231188 3300009553 Bacteria 620
139 Ga0105239_10002147 3300010375 Bacteria 25383
140 Ga0105239_10065223 3300010375 Bacteria 3999
141 Ga0105239_10122111 3300010375 Bacteria 2894
142 Ga0105239_11027589 3300010375 Bacteria 948
143 Ga0157369_10814151 3300013105 Bacteria 959
144 Ga0157378_10002364 3300013297 Bacteria 16759
145 Ga0163162_10000963 3300013306 Bacteria 26727
146 Ga0163162_10031082 3300013306 Bacteria 5294
147 Ga0163162_10325621 3300013306 Bacteria 1669
148 Ga0163162_10738670 3300013306 Bacteria 1104
149 Ga0163162_11122644 3300013306 Bacteria 891
150 Ga0157372_10005749 3300013307 Bacteria 13212
151 Ga0157375_10003089 3300013308 Bacteria 14450
152 Ga0157375_10074133 3300013308 Bacteria 3424
153 Ga0163163_10019797 3300014325 Bacteria 6328
154 Ga0163163_10477258 3300014325 Bacteria 1308
155 Ga0157380_10005119 3300014326 Bacteria 9162
156 Ga0157380_10324535 3300014326 Bacteria 1429
157 Ga0157379_10079565 3300014968 Bacteria 2935
158 Ga0157379_10555568 3300014968 Bacteria 1068
159 Ga0163161_10003273 3300017792 Bacteria 11385
160 Ga0213876_10001254 3300021384 Bacteria 16033
161 Ga0213876_10028520 3300021384 Bacteria 2944
162 Ga0213875_10060033 3300021388 Bacteria 1779
163 Ga0213875_10079930 3300021388 Bacteria 1526
164 Ga0209673_1016649 3300025273 Bacteria 2738
165 Ga0209051_1000188 3300025303 Bacteria 109245
166 Ga0209051_1001003 3300025303 Bacteria 27110
167 Ga0209051_1001047 3300025303 Bacteria 26073
168 Ga0209051_1003728 3300025303 Bacteria 9815
169 Ga0209051_1031581 3300025303 Bacteria 2035
170 Ga0207692_10012336 3300025898 Bacteria 3668
171 Ga0207692_10414664 3300025898 Bacteria 842
172 Ga0207642_10000213 3300025899 Bacteria 17157
173 Ga0207710_10000141 3300025900 Bacteria 82771
174 Ga0207710_10002872 3300025900 Bacteria 7833
175 Ga0207680_10711802 3300025903 Bacteria 720
176 Ga0207647_10088352 3300025904 Bacteria 1851
177 Ga0207685_10002626 3300025905 Bacteria 4169
178 Ga0207699_10150891 3300025906 Bacteria 1537
179 Ga0207699_10387075 3300025906 Bacteria 993
180 Ga0207671_10025142 3300025914 Bacteria 4474
181 Ga0207671_10060185 3300025914 Bacteria 2817
182 Ga0207671_10194056 3300025914 Bacteria 1584
183 Ga0207693_10001755 3300025915 Bacteria 19046
184 Ga0207663_10000247 3300025916 Bacteria 23908
185 Ga0207660_10993781 3300025917 Bacteria 684
186 Ga0207662_10298698 3300025918 Bacteria 1070
187 Ga0207681_10204357 3300025923 Bacteria 1518
188 Ga0207650_10045669 3300025925 Bacteria 3223
189 Ga0207687_10003511 3300025927 Bacteria 10550
190 Ga0207700_10010848 3300025928 Bacteria 5781
191 Ga0207700_10427852 3300025928 Bacteria 1164
192 Ga0207664_10188201 3300025929 Bacteria 1776
193 Ga0207644_10006427 3300025931 Bacteria 7659
194 Ga0207706_10002731 3300025933 Bacteria 17196
195 Ga0207686_10002291 3300025934 Bacteria 10490
196 Ga0207709_10002303 3300025935 Bacteria 12096
197 Ga0207670_10803588 3300025936 Bacteria 784
198 Ga0207669_10000631 3300025937 Bacteria 15211
199 Ga0207669_10111191 3300025937 Bacteria 1836
200 Ga0207704_10000979 3300025938 Bacteria 12677
201 Ga0207665_10002579 3300025939 Bacteria 12173
202 Ga0207711_10000226 3300025941 Bacteria 60471
203 Ga0207711_10004199 3300025941 Bacteria 12332
204 Ga0207711_11602604 3300025941 Bacteria 594
205 Ga0207667_10039170 3300025949 Bacteria 5053
206 Ga0207712_10000018 3300025961 Bacteria 317921
207 Ga0207712_10001400 3300025961 Bacteria 16463
208 Ga0207712_10443818 3300025961 Bacteria 1099
209 Ga0207712_11202315 3300025961 Bacteria 676
210 Ga0207668_10000605 3300025972 Bacteria 22299
211 Ga0207668_10002855 3300025972 Bacteria 10123
212 Ga0207640_10000692 3300025981 Bacteria 19625
213 Ga0207640_10541611 3300025981 Bacteria 976
214 Ga0207640_10786844 3300025981 Bacteria 823
215 Ga0207658_10000235 3300025986 Bacteria 58555
216 Ga0207658_10002314 3300025986 Bacteria 14030
217 Ga0207658_10050441 3300025986 Bacteria 3062
218 Ga0207677_10001530 3300026023 Bacteria 12238
219 Ga0207677_11064639 3300026023 Bacteria 736
220 Ga0207703_10006481 3300026035 Bacteria 9344
221 Ga0207703_10125065 3300026035 Bacteria 2213
222 Ga0207703_10239339 3300026035 Bacteria 1631
223 Ga0207703_10856104 3300026035 Bacteria 869
224 Ga0207639_10037405 3300026041 Bacteria 3604
225 Ga0207639_10245885 3300026041 Bacteria 1558
226 Ga0207678_10163337 3300026067 Bacteria 1902
227 Ga0207708_10287869 3300026075 Bacteria 1333
228 Ga0207641_10000971 3300026088 Bacteria 29358
229 Ga0207641_10001163 3300026088 Bacteria 26456
230 Ga0207676_11081121 3300026095 Bacteria 792
231 Ga0207675_100007493 3300026118 Bacteria 10310
232 Ga0207675_100027758 3300026118 Bacteria 5273
233 Ga0207683_10000437 3300026121 Bacteria 38578
234 Ga0209813_10108232 3300027866 Bacteria 954
235 Ga0268266_10006151 3300028379 Bacteria 11045
236 Ga0268266_10647773 3300028379 Bacteria 1017
237 Ga0268265_10000147 3300028380 Bacteria 88026
238 Ga0268265_10037636 3300028380 Bacteria 3552
239 Ga0268264_10000005 3300028381 Bacteria 934972
240 Ga0268264_10005637 3300028381 Bacteria 10610
241 Ga0307413_10320018 3300031824 Bacteria 1184
242 Ga0307410_10028593 3300031852 Bacteria 3539
243 Ga0307406_10135750 3300031901 Bacteria 1734
244 Ga0307409_100002091 3300031995 Bacteria 10266
245 Ga0307416_100002031 3300032002 Bacteria 11386
246 Ga0307415_100553391 3300032126 Bacteria 1016
247 Ga0373929_0022809 3300035085 Bacteria 1281
248 Ga0373952_0070293 3300035092 Bacteria 874
249 Ga0373961_0171759 3300035241 Bacteria 750
250 Ga0373962_0039447 3300035242 Bacteria 1325
251 Ga0373931_0037492 3300035691 Bacteria 2531
252 Ga0436364_0280818 3300037853 Bacteria 10081
253 Ga0436364_0508753 3300037853 Bacteria 674
254 Ga0436364_1311510 3300037853 Bacteria 8123
255 Ga0436365_0253392 3300039437 Bacteria 50314
256 Ga0436365_0761069 3300039437 Bacteria 7641
257 Ga0436365_1082709 3300039437 Bacteria 67183
258 Ga0436365_1148819 3300039437 Bacteria 1603
259 Ga0436365_1869405 3300039437 Bacteria 3709
260 Ga0436363_0331709 3300039450 Bacteria 2494
261 Ga0436363_1117517 3300039450 Bacteria 786
262 Ga0439461_0006560 3300041410 Bacteria 2032
263 Ga0439466_0002290 3300041411 Bacteria 7513
264 Ga0439466_0032914 3300041411 Bacteria 1764
265 Ga0439465_0021285 3300041413 Bacteria 2033
266 Ga0439465_0043633 3300041413 Bacteria 1455
267 Ga0451791_0767238 3300041451 Bacteria 600
268 Ga0451793_1407174 3300041452 Bacteria 1855
269 Ga0451795_0845723 3300041456 Bacteria 1254
270 Ga0451839_0584117 3300041496 Bacteria 848
271 Ga0451839_1241708 3300041496 Bacteria 587
272 Ga0451855_0130266 3300041511 Bacteria 806
273 Ga0451853_2532285 3300041512 Bacteria 806
274 Ga0439442_035238 3300042002 Bacteria 1046
275 Ga0439445_0016062 3300042004 Bacteria 1838
276 Ga0439448_0012683 3300042005 Bacteria 2526
277 Ga0439448_0126917 3300042005 Bacteria 878
278 Ga0439434_0008544 3300042435 Bacteria 3005
279 Ga0439459_0064988 3300042438 Bacteria 832
280 Ga0466969_0026960 3300044656 Bacteria 2945
281 Ga0466965_0004573 3300044683 Bacteria 6159
282 Ga0466965_0030883 3300044683 Bacteria 2611
283 Ga0466965_0041625 3300044683 Bacteria 2264
284 Ga0466965_0159214 3300044683 Bacteria 1183
285 Ga0466965_0185290 3300044683 Bacteria 1099
286 Ga0466966_0003528 3300044684 Bacteria 10322
287 Ga0466966_0031782 3300044684 Bacteria 3423
288 Ga0466966_0034471 3300044684 Bacteria 3272
289 Ga0466961_0012843 3300044693 Bacteria 5359
290 Ga0466963_0067044 3300044694 Bacteria 2408
291 Ga0466963_0119849 3300044694 Bacteria 1810
292 Ga0466963_0220469 3300044694 Bacteria 1328
293 Ga0466964_0121250 3300044706 Bacteria 1179
294 Ga0466971_0032795 3300044719 Bacteria 2327
295 Ga0466971_0047764 3300044719 Bacteria 1924
296 Ga0466968_0011271 3300044735 Bacteria 3481
297 Ga0466968_0031765 3300044735 Bacteria 2192
298 Ga0466970_0044085 3300044765 Bacteria 2375
299 Ga0466957_0000658 3300044842 Bacteria 17539
300 Ga0466957_0212498 3300044842 Bacteria 1274
301 Ga0466957_0575890 3300044842 Bacteria 786
302 Ga0466957_1032545 3300044842 Bacteria 591
303 Ga0466960_0000193 3300044901 Bacteria 20996
304 Ga0466960_0015630 3300044901 Bacteria 3276
305 Ga0466960_0701611 3300044901 Bacteria 607
306 Ga0466959_0001475 3300045049 Bacteria 14418
307 Ga0466959_0091246 3300045049 Bacteria 2188
308 Ga0466958_0001827 3300045836 Bacteria 10350
309 Ga0466958_0044640 3300045836 Bacteria 2671
310 Ga0466958_0093012 3300045836 Bacteria 1867
311 Ga0466958_0126393 3300045836 Bacteria 1603
312 Ga0466958_0347507 3300045836 Bacteria 955
313 Ga0466967_0001001 3300045976 Bacteria 15413
314 Ga0466967_0005733 3300045976 Bacteria 8666
315 Ga0466967_0011761 3300045976 Bacteria 6654
316 Ga0466967_0016839 3300045976 Bacteria 5780
317 Ga0466967_0063192 3300045976 Bacteria 3289
318 Ga0466967_0085569 3300045976 Bacteria 2855
319 Ga0466967_1297576 3300045976 Bacteria 725
320 Ga0495629_0346593 3300046459 Bacteria 1014
321 Ga0495638_0051898 3300046460 Bacteria 2556
322 Ga0495638_0215353 3300046460 Bacteria 1076
323 Ga0495606_0107049 3300046507 Bacteria 1692
324 Ga0495628_0203299 3300046516 Bacteria 1492
325 Ga0495648_0001947 3300046524 Bacteria 19671
326 Ga0495654_0040340 3300046530 Bacteria 2327
327 Ga0495668_0021884 3300046616 Bacteria 3659
328 Ga0495611_0023699 3300046648 Bacteria 2666
329 Ga0495635_0135557 3300046663 Bacteria 1678
330 Ga0495624_0079930 3300046690 Bacteria 2027
331 Ga0495649_0049501 3300046694 Bacteria 2283
332 Ga0495672_0002451 3300047320 Bacteria 17075
333 Ga0495672_0007066 3300047320 Bacteria 8519
334 Ga0495672_0096663 3300047320 Bacteria 1610
335 Ga0495680_0225593 3300047322 Bacteria 1336
336 Ga0495673_0001110 3300047469 Bacteria 23152
337 Ga0495686_0001467 3300047472 Bacteria 25670
338 Ga0495686_0031067 3300047472 Bacteria 3466
339 Ga0495686_0223872 3300047472 Bacteria 1069
340 Ga0495593_0043441 3300047673 Bacteria 2408
341 Ga0496100_0000015 3300048903 Bacteria 167108
342 Ga0496100_0001264 3300048903 Bacteria 12337
343 Ga0496100_0004706 3300048903 Bacteria 7275
344 Ga0496100_0014188 3300048903 Bacteria 4619
345 Ga0496100_0246093 3300048903 Bacteria 1321
346 Ga0496100_0570166 3300048903 Bacteria 877
347 Ga0496100_0984235 3300048903 Bacteria 663
348 Ga0496101_0000008 3300048904 Bacteria 309720
349 Ga0496101_0000039 3300048904 Bacteria 164695
350 Ga0496101_0001780 3300048904 Bacteria 12951
351 Ga0496101_0011101 3300048904 Bacteria 5969
352 Ga0496101_0036047 3300048904 Bacteria 3502
353 Ga0496101_0044057 3300048904 Bacteria 3192
354 Ga0496101_0189591 3300048904 Bacteria 1586
355 Ga0496101_0437590 3300048904 Bacteria 1031
356 Ga0496101_0626641 3300048904 Bacteria 850
357 Ga0496102_0000005 3300048905 Bacteria 481937
358 Ga0496102_0000063 3300048905 Bacteria 164782
359 Ga0496102_0000770 3300048905 Bacteria 31194
360 Ga0496102_0000956 3300048905 Bacteria 27223
361 Ga0496102_0050313 3300048905 Bacteria 3794
362 Ga0496102_0170487 3300048905 Bacteria 2049
363 Ga0496102_0225271 3300048905 Bacteria 1768
364 Ga0496102_0402395 3300048905 Bacteria 1287
365 Ga0496103_0000002 3300048906 Bacteria 605387
366 Ga0496103_0000407 3300048906 Bacteria 38157
367 Ga0496103_0000827 3300048906 Bacteria 22736
368 Ga0496103_0001339 3300048906 Bacteria 16650
369 Ga0496103_0057200 3300048906 Bacteria 2421
370 Ga0496103_0626799 3300048906 Bacteria 684
371 Ga0496104_0023086 3300048907 Bacteria 5717
372 Ga0496104_0054764 3300048907 Bacteria 3770
373 Ga0496104_0154842 3300048907 Bacteria 2200
374 Ga0496105_0010213 3300048908 Bacteria 7379
375 Ga0496105_0014186 3300048908 Bacteria 6341
376 Ga0496106_0000621 3300048909 Bacteria 25372
377 Ga0496106_0002063 3300048909 Bacteria 15078
378 Ga0496106_0007781 3300048909 Bacteria 7929
379 Ga0496106_0220132 3300048909 Bacteria 1514
380 Ga0496106_0249006 3300048909 Bacteria 1420
381 Ga0496107_0000177 3300048910 Bacteria 33064
382 Ga0496107_0000615 3300048910 Bacteria 19946
383 Ga0496107_0002422 3300048910 Bacteria 12087
384 Ga0496107_0088211 3300048910 Bacteria 2265
385 Ga0496107_0319542 3300048910 Bacteria 1155
386 Ga0496108_0001006 3300048911 Bacteria 22009
387 Ga0496108_0669859 3300048911 Bacteria 901
388 Ga0496109_0000955 3300048912 Bacteria 23909
389 Ga0496109_0113201 3300048912 Bacteria 2524
390 Ga0496109_0400307 3300048912 Bacteria 1297
391 Ga0496110_0001159 3300048913 Bacteria 18681
392 Ga0496110_0138487 3300048913 Bacteria 2200
393 Ga0496111_0080822 3300048914 Bacteria 2372
394 Ga0496112_0018279 3300048915 Bacteria 6598
395 Ga0496112_1190524 3300048915 Bacteria 679
396 Ga0496113_0021297 3300048916 Bacteria 4571
397 Ga0496113_0404026 3300048916 Bacteria 1097
398 Ga0496113_0842516 3300048916 Bacteria 727
399 Ga0496114_0000091 3300048917 Bacteria 64989
400 Ga0496114_0000431 3300048917 Bacteria 30939
401 Ga0496114_0005466 3300048917 Bacteria 9941
402 Ga0496114_0180396 3300048917 Bacteria 1844
403 Ga0496114_0734347 3300048917 Bacteria 864
404 Ga0496115_0002689 3300048918 Bacteria 12753
405 Ga0496115_0005795 3300048918 Bacteria 8994
406 Ga0496115_0058385 3300048918 Bacteria 3105
407 Ga0496115_0256714 3300048918 Bacteria 1438
408 Ga0496115_0323026 3300048918 Bacteria 1262
409 Ga0496116_0000034 3300048919 Bacteria 409567
410 Ga0496116_0004066 3300048919 Bacteria 14146
411 Ga0496116_0027615 3300048919 Bacteria 4129
412 Ga0496117_0000003 3300048920 Bacteria 1881097
413 Ga0496117_0000390 3300048920 Bacteria 75361
414 Ga0496117_0081151 3300048920 Bacteria 2129
415 Ga0496118_0000001 3300048921 Bacteria 1881100
416 Ga0496118_0001073 3300048921 Bacteria 42720
417 Ga0496118_0003587 3300048921 Bacteria 19314
418 Ga0496118_0011216 3300048921 Bacteria 8775
419 Ga0496118_0293102 3300048921 Bacteria 898
420 Ga0496119_0000127 3300048922 Bacteria 107730
421 Ga0496119_0001863 3300048922 Bacteria 24354
422 Ga0496119_0003625 3300048922 Bacteria 15880
423 Ga0496119_0076384 3300048922 Bacteria 1944
424 Ga0496120_0000357 3300048923 Bacteria 75146
425 Ga0496120_0005894 3300048923 Bacteria 9557
426 Ga0496120_0010743 3300048923 Bacteria 6350
427 Ga0496120_0137999 3300048923 Bacteria 1241
428 Ga0496121_0000002 3300048924 Bacteria 1494588
429 Ga0496121_0000120 3300048924 Bacteria 174571
430 Ga0496121_0001494 3300048924 Bacteria 39376
431 Ga0496121_0269811 3300048924 Bacteria 1170
432 Ga0496122_0000051 3300048925 Bacteria 265104
433 Ga0496122_0022321 3300048925 Bacteria 5630
434 Ga0496122_0104817 3300048925 Bacteria 1877
435 Ga0496123_0010315 3300048926 Bacteria 8281
436 Ga0496123_0031348 3300048926 Bacteria 3870
437 Ga0496124_0000002 3300048927 Bacteria 1494588
438 Ga0496124_0030127 3300048927 Bacteria 4821
439 Ga0496125_0000002 3300048928 Bacteria 1480920
440 Ga0496125_0167176 3300048928 Bacteria 1484
441 Ga0496125_0187854 3300048928 Bacteria 1368
442 Ga0496125_0437243 3300048928 Bacteria 753
443 Ga0496126_0000011 3300048929 Bacteria 744275
444 Ga0496126_0000936 3300048929 Bacteria 50340
445 Ga0496126_0005743 3300048929 Bacteria 14041
446 Ga0496126_0009172 3300048929 Bacteria 10554
447 Ga0496126_0011595 3300048929 Bacteria 9098
448 Ga0496126_0419161 3300048929 Bacteria 1083
449 Ga0501032_0004163 3300049569 Bacteria 10960
450 Ga0501033_0090990 3300049570 Bacteria 2232
451 Ga0501033_0223308 3300049570 Bacteria 1340
452 Ga0501034_0006488 3300049571 Bacteria 12594
453 Ga0501034_0066958 3300049571 Bacteria 3605
454 Ga0501034_0082519 3300049571 Bacteria 3216
455 Ga0501034_0175654 3300049571 Bacteria 2108
456 Ga0501034_0728557 3300049571 Bacteria 888
457 Ga0501036_0092003 3300049572 Bacteria 2562
458 Ga0501037_0002468 3300049573 Bacteria 13367
459 Ga0501037_0225766 3300049573 Bacteria 1316
460 Ga0501043_0223131 3300049579 Bacteria 1457
461 Ga0501046_0000859 3300049580 Bacteria 29548
462 Ga0501046_0367081 3300049580 Bacteria 1043
463 Ga0501047_0002076 3300049581 Bacteria 19174
464 Ga0501048_0005405 3300049582 Bacteria 9713
465 Ga0501069_0031625 3300049585 Bacteria 2912
466 Ga0501070_0000442 3300049586 Bacteria 37746
467 Ga0501070_0622141 3300049586 Bacteria 859
468 Ga0501070_0628320 3300049586 Bacteria 854
469 Ga0501073_0040558 3300049589 Bacteria 3294
470 Ga0501073_0104977 3300049589 Bacteria 1961
471 Ga0501079_0282617 3300049741 Bacteria 1298
472 Ga0501080_0475054 3300049742 Bacteria 1119
473 Ga0501035_0000682 3300049822 Bacteria 37176
474 Ga0501035_0001142 3300049822 Bacteria 27764
475 Ga0501035_0534566 3300049822 Bacteria 962
476 Ga0501044_0002164 3300049823 Bacteria 22527
477 Ga0501044_0020308 3300049823 Bacteria 7090
478 Ga0501044_0021605 3300049823 Bacteria 6862
479 nmdc:mga03683_115755_c1 3300050489 Bacteria 1189
480 nmdc:mga03683_393659_c1 3300050489 Bacteria 661
481 nmdc:mga03683_66070_c1 3300050489 Bacteria 1537
482 nmdc:mga03683_96966_c1 3300050489 Bacteria 1292
483 nmdc:mga03n38_101805_c1 3300050490 Bacteria 1386
484 nmdc:mga03n38_282684_c1 3300050490 Bacteria 886
485 nmdc:mga03n38_6068_c1 3300050490 Bacteria 4170
486 nmdc:mga03n38_796_c1 3300050490 Bacteria 8380
487 nmdc:mga03n38_91641_c1 3300050490 Bacteria 1448
488 nmdc:mga00v17_23052_c1 3300050491 Bacteria 3598
489 nmdc:mga00v17_335523_c1 3300050491 Bacteria 983
490 nmdc:mga00v17_369_c1 3300050491 Bacteria 25559
491 nmdc:mga00v17_48577_c1 3300050491 Bacteria 2572
492 nmdc:mga00v17_4980_c1 3300050491 Bacteria 6970
493 nmdc:mga00v17_5233_c1 3300050491 Bacteria 6831
494 nmdc:mga00v17_79227_c1 3300050491 Bacteria 1229
495 nmdc:mga00v17_893741_c1 3300050491 Bacteria 563
496 nmdc:mga0yw44_12438_c1 3300050492 Bacteria 4436
497 nmdc:mga0yw44_185548_c1 3300050492 Bacteria 1370
498 nmdc:mga0yw44_228120_c1 3300050492 Bacteria 1236
499 nmdc:mga0yw44_35397_c1 3300050492 Bacteria 2934
500 nmdc:mga0yw44_488505_c1 3300050492 Bacteria 835
501 nmdc:mga0yw44_63952_c1 3300050492 Bacteria 2263
502 nmdc:mga0yw44_70581_c1 3300050492 Bacteria 2166
503 nmdc:mga0k408_39990_c1 3300050493 Bacteria 2696
504 nmdc:mga06z11_165312_c1 3300050494 Bacteria 1267
505 nmdc:mga06z11_234094_c1 3300050494 Bacteria 1077
506 nmdc:mga06z11_4458_c1 3300050494 Bacteria 5510
507 nmdc:mga06z11_76957_c1 3300050494 Bacteria 1780
508 nmdc:mga04h51_241971_c1 3300050495 Bacteria 721
509 nmdc:mga07m45_5902_c1 3300050496 Bacteria 6145
510 nmdc:mga07m45_7858_c1 3300050496 Bacteria 5460
511 nmdc:mga07m45_8372_c1 3300050496 Bacteria 5314
512 nmdc:mga08y16_224134_c1 3300050511 Bacteria 1945
513 nmdc:mga0n895_573931_c1 3300050512 Bacteria 1132
514 nmdc:mga0sz30_124559_c1 3300050516 Bacteria 1133
515 nmdc:mga0sz30_133622_c1 3300050516 Bacteria 1094
516 nmdc:mga0sz30_134749_c1 3300050516 Bacteria 1089
517 nmdc:mga0sz30_1466_c1 3300050516 Bacteria 8417
518 nmdc:mga0sz30_30405_c1 3300050516 Bacteria 2231
519 nmdc:mga0sz30_7549_c1 3300050516 Bacteria 4081
520 Ga0495601_0077510 3300053077 Bacteria 2129
521 Ga0500610_0001520 3300053079 Bacteria 7963
522 Ga0500610_0131374 3300053079 Bacteria 1273
523 Ga0500635_0075059 3300053080 Bacteria 1206
524 Ga0500643_005443 3300053087 Bacteria 5486
525 Ga0500643_011892 3300053087 Bacteria 3146
526 Ga0500583_0106311 3300053092 Bacteria 1379
527 Ga0500641_0035640 3300053096 Bacteria 1986
528 Ga0500650_0087745 3300053098 Bacteria 1456
529 Ga0500556_0042981 3300053104 Bacteria 1601
530 Ga0500556_0079039 3300053104 Bacteria 1240
531 Ga0500562_033102 3300053108 Bacteria 1365
532 Ga0500652_001609 3300053131 Bacteria 6877
533 Ga0500652_002684 3300053131 Bacteria 5375
534 Ga0500559_0228505 3300053136 Bacteria 877
535 Ga0500568_0094853 3300053139 Bacteria 1123
536 Ga0500616_0010589 3300053153 Bacteria 5508
537 Ga0500616_0037696 3300053153 Bacteria 2616
538 Ga0500611_062091 3300053727 Bacteria 888
539 Ga0466962_0036184 3300061719 Bacteria 2362
540 Ga0466962_0130128 3300061719 Bacteria 1216
541 2644489642 2643221687 Bacteria 6500351
542 2644635847 2643221715 Bacteria 6671032
543 2902799334 2902792274 Bacteria 7270173
544 2902813303 2902810491 Bacteria 6794147
545 2902842413 2902837492 Bacteria 6697721
546 2929214173 2929212328 Bacteria 7708288
547 2939587942 2939582691 Bacteria 7088898
548 Ga0496126_0572752
549 JGI24739J22299_10033735
550 JGI24737J22298_10113916
551 JGI24750J21931_1003926
552 JGI24749J21850_1007053
553 rootH2_10075376
554 Ga0055540_1000100
555 Ga0055540_1003155
556 Ga0070676_10011349
557 Ga0070683_100192695
558 Ga0070670_100061999
559 Ga0068869_100015359
560 Ga0070666_10197027
561 Ga0070682_100111140
562 Ga0068868_100005128
563 Ga0068868_101054571
564 Ga0070689_100038446
565 Ga0070691_10006518
566 Ga0070692_10076290
567 Ga0070668_100000209
568 Ga0070668_100438844
569 Ga0070668_100968985
570 Ga0070669_100002355
571 Ga0070669_100374814
572 Ga0070671_100054861
573 Ga0070674_100001562
574 Ga0070674_100077978
575 Ga0070667_100000027
576 Ga0070667_100000433
577 Ga0070667_100259513
578 Ga0070703_10047822
579 Ga0070709_10440777
580 Ga0070713_100410614
581 Ga0070710_10001053
582 Ga0070710_10387208
583 Ga0070701_10006565
584 Ga0070711_100003217
585 Ga0070705_100017992
586 Ga0070700_100004150
587 Ga0070694_100027340
588 Ga0070708_101241556
589 Ga0070663_101000465
590 Ga0070678_100002565
591 Ga0070678_100027656
592 Ga0070662_100013613
593 Ga0068867_100003320
594 Ga0070684_100061103
595 Ga0068853_100043081
596 Ga0068853_100274834
597 Ga0070686_100340293
598 Ga0070686_100458757
599 Ga0070695_100483296
600 Ga0070693_101015634
601 Ga0070665_100005485
602 Ga0070704_100000086
603 Ga0068855_100323430
604 Ga0068854_100000670
605 Ga0070702_100001271
606 Ga0068859_100000860
607 Ga0068859_100000968
608 Ga0068864_101080537
609 Ga0068866_10000540
610 Ga0068861_100009657
611 Ga0068863_100000960
612 Ga0068863_100002556
613 Ga0068858_100038871
614 Ga0068858_100200031
615 Ga0068860_100000141
616 Ga0068860_100001099
617 Ga0068862_100000177
618 Ga0068862_100002319
619 Ga0081455_10019739
620 Ga0081538_10055649
621 Ga0081540_1041975
622 Ga0075365_10044396
623 Ga0075365_10082718
624 Ga0075365_10145223
625 Ga0075365_10382264
626 Ga0075368_10036290
627 Ga0075363_100020309
628 Ga0075363_100089034
629 Ga0075363_100104543
630 Ga0075363_100104825
631 Ga0075363_100107833
632 Ga0075363_100447481
633 Ga0075364_10000108
634 Ga0075364_10004868
635 Ga0075364_10025455
636 Ga0075364_10027011
637 Ga0075364_10112511
638 Ga0075364_10164289
639 Ga0075364_10259179
640 Ga0070715_10001054
641 Ga0070716_100000791
642 Ga0070712_100005332
643 Ga0075362_10068291
644 Ga0075362_10226937
645 Ga0075367_10013766
646 Ga0075367_10041233
647 Ga0075367_10249319
648 Ga0075369_10000202
649 Ga0075369_10001962
650 Ga0075369_10007005
651 Ga0075369_10015603
652 Ga0075369_10146357
653 Ga0075369_10168359
654 Ga0075369_10208269
655 Ga0075366_10093837
656 Ga0075370_10011565
657 Ga0075370_10051122
658 Ga0068865_100001804
659 Ga0097620_100000860
660 Ga0097620_100000968
661 Ga0105251_10093623
662 Ga0105240_10425321
663 Ga0111539_10504164
664 Ga0105245_10004474
665 Ga0105245_10744273
666 Ga0105247_10000113
667 Ga0105247_10000167
668 Ga0105243_10004592
669 Ga0105243_11651377
670 Ga0105241_10079798
671 Ga0105241_10979724
672 Ga0105242_10004395
673 Ga0105242_11451455
674 Ga0105248_10000054
675 Ga0105248_10007029
676 Ga0105248_10156503
677 Ga0105248_10643306
678 Ga0105237_10000454
679 Ga0105237_10023217
680 Ga0105237_10053563
681 Ga0105238_11257602
682 Ga0105249_10000013
683 Ga0105249_10005325
684 Ga0105249_10658309
685 Ga0105249_12231188
686 Ga0105239_10002147
687 Ga0105239_10065223
688 Ga0105239_10122111
689 Ga0105239_11027589
690 Ga0157369_10814151
691 Ga0157378_10002364
692 Ga0163162_10000963
693 Ga0163162_10031082
694 Ga0163162_10325621
695 Ga0163162_10738670
696 Ga0163162_11122644
697 Ga0157372_10005749
698 Ga0157375_10003089
699 Ga0157375_10074133
700 Ga0163163_10019797
701 Ga0163163_10477258
702 Ga0157380_10005119
703 Ga0157380_10324535
704 Ga0157379_10079565
705 Ga0157379_10555568
706 Ga0163161_10003273
707 Ga0213876_10001254
708 Ga0213876_10028520
709 Ga0213875_10060033
710 Ga0213875_10079930
711 Ga0209673_1016649
712 Ga0209051_1000188
713 Ga0209051_1001003
714 Ga0209051_1001047
715 Ga0209051_1003728
716 Ga0209051_1031581
717 Ga0207692_10012336
718 Ga0207692_10414664
719 Ga0207642_10000213
720 Ga0207710_10000141
721 Ga0207710_10002872
722 Ga0207680_10711802
723 Ga0207647_10088352
724 Ga0207685_10002626
725 Ga0207699_10150891
726 Ga0207699_10387075
727 Ga0207671_10025142
728 Ga0207671_10060185
729 Ga0207671_10194056
730 Ga0207693_10001755
731 Ga0207663_10000247
732 Ga0207660_10993781
733 Ga0207662_10298698
734 Ga0207681_10204357
735 Ga0207650_10045669
736 Ga0207687_10003511
737 Ga0207700_10010848
738 Ga0207700_10427852
739 Ga0207664_10188201
740 Ga0207644_10006427
741 Ga0207706_10002731
742 Ga0207686_10002291
743 Ga0207709_10002303
744 Ga0207670_10803588
745 Ga0207669_10000631
746 Ga0207669_10111191
747 Ga0207704_10000979
748 Ga0207665_10002579
749 Ga0207711_10000226
750 Ga0207711_10004199
751 Ga0207711_11602604
752 Ga0207667_10039170
753 Ga0207712_10000018
754 Ga0207712_10001400
755 Ga0207712_10443818
756 Ga0207712_11202315
757 Ga0207668_10000605
758 Ga0207668_10002855
759 Ga0207640_10000692
760 Ga0207640_10541611
761 Ga0207640_10786844
762 Ga0207658_10000235
763 Ga0207658_10002314
764 Ga0207658_10050441
765 Ga0207677_10001530
766 Ga0207677_11064639
767 Ga0207703_10006481
768 Ga0207703_10125065
769 Ga0207703_10239339
770 Ga0207703_10856104
771 Ga0207639_10037405
772 Ga0207639_10245885
773 Ga0207678_10163337
774 Ga0207708_10287869
775 Ga0207641_10000971
776 Ga0207641_10001163
777 Ga0207676_11081121
778 Ga0207675_100007493
779 Ga0207675_100027758
780 Ga0207683_10000437
781 Ga0209813_10108232
782 Ga0268266_10006151
783 Ga0268266_10647773
784 Ga0268265_10000147
785 Ga0268265_10037636
786 Ga0268264_10000005
787 Ga0268264_10005637
788 Ga0307413_10320018
789 Ga0307410_10028593
790 Ga0307406_10135750
791 Ga0307409_100002091
792 Ga0307416_100002031
793 Ga0307415_100553391
794 Ga0373929_0022809
795 Ga0373952_0070293
796 Ga0373961_0171759
797 Ga0373962_0039447
798 Ga0373931_0037492
799 Ga0436364_0280818
800 Ga0436364_0508753
801 Ga0436364_1311510
802 Ga0436365_0253392
803 Ga0436365_0761069
804 Ga0436365_1082709
805 Ga0436365_1148819
806 Ga0436365_1869405
807 Ga0436363_0331709
808 Ga0436363_1117517
809 Ga0439461_0006560
810 Ga0439466_0002290
811 Ga0439466_0032914
812 Ga0439465_0021285
813 Ga0439465_0043633
814 Ga0451791_0767238
815 Ga0451793_1407174
816 Ga0451795_0845723
817 Ga0451839_0584117
818 Ga0451839_1241708
819 Ga0451855_0130266
820 Ga0451853_2532285
821 Ga0439442_035238
822 Ga0439445_0016062
823 Ga0439448_0012683
824 Ga0439448_0126917
825 Ga0439434_0008544
826 Ga0439459_0064988
827 Ga0466969_0026960
828 Ga0466965_0004573
829 Ga0466965_0030883
830 Ga0466965_0041625
831 Ga0466965_0159214
832 Ga0466965_0185290
833 Ga0466966_0003528
834 Ga0466966_0031782
835 Ga0466966_0034471
836 Ga0466961_0012843
837 Ga0466963_0067044
838 Ga0466963_0119849
839 Ga0466963_0220469
840 Ga0466964_0121250
841 Ga0466971_0032795
842 Ga0466971_0047764
843 Ga0466968_0011271
844 Ga0466968_0031765
845 Ga0466970_0044085
846 Ga0466957_0000658
847 Ga0466957_0212498
848 Ga0466957_0575890
849 Ga0466957_1032545
850 Ga0466960_0000193
851 Ga0466960_0015630
852 Ga0466960_0701611
853 Ga0466959_0001475
854 Ga0466959_0091246
855 Ga0466958_0001827
856 Ga0466958_0044640
857 Ga0466958_0093012
858 Ga0466958_0126393
859 Ga0466958_0347507
860 Ga0466967_0001001
861 Ga0466967_0005733
862 Ga0466967_0011761
863 Ga0466967_0016839
864 Ga0466967_0063192
865 Ga0466967_0085569
866 Ga0466967_1297576
867 Ga0495629_0346593
868 Ga0495638_0051898
869 Ga0495638_0215353
870 Ga0495606_0107049
871 Ga0495628_0203299
872 Ga0495648_0001947
873 Ga0495654_0040340
874 Ga0495668_0021884
875 Ga0495611_0023699
876 Ga0495635_0135557
877 Ga0495624_0079930
878 Ga0495649_0049501
879 Ga0495672_0002451
880 Ga0495672_0007066
881 Ga0495672_0096663
882 Ga0495680_0225593
883 Ga0495673_0001110
884 Ga0495686_0001467
885 Ga0495686_0031067
886 Ga0495686_0223872
887 Ga0495593_0043441
888 Ga0496100_0000015
889 Ga0496100_0001264
890 Ga0496100_0004706
891 Ga0496100_0014188
892 Ga0496100_0246093
893 Ga0496100_0570166
894 Ga0496100_0984235
895 Ga0496101_0000008
896 Ga0496101_0000039
897 Ga0496101_0001780
898 Ga0496101_0011101
899 Ga0496101_0036047
900 Ga0496101_0044057
901 Ga0496101_0189591
902 Ga0496101_0437590
903 Ga0496101_0626641
904 Ga0496102_0000005
905 Ga0496102_0000063
906 Ga0496102_0000770
907 Ga0496102_0000956
908 Ga0496102_0050313
909 Ga0496102_0170487
910 Ga0496102_0225271
911 Ga0496102_0402395
912 Ga0496103_0000002
913 Ga0496103_0000407
914 Ga0496103_0000827
915 Ga0496103_0001339
916 Ga0496103_0057200
917 Ga0496103_0626799
918 Ga0496104_0023086
919 Ga0496104_0054764
920 Ga0496104_0154842
921 Ga0496105_0010213
922 Ga0496105_0014186
923 Ga0496106_0000621
924 Ga0496106_0002063
925 Ga0496106_0007781
926 Ga0496106_0220132
927 Ga0496106_0249006
928 Ga0496107_0000177
929 Ga0496107_0000615
930 Ga0496107_0002422
931 Ga0496107_0088211
932 Ga0496107_0319542
933 Ga0496108_0001006
934 Ga0496108_0669859
935 Ga0496109_0000955
936 Ga0496109_0113201
937 Ga0496109_0400307
938 Ga0496110_0001159
939 Ga0496110_0138487
940 Ga0496111_0080822
941 Ga0496112_0018279
942 Ga0496112_1190524
943 Ga0496113_0021297
944 Ga0496113_0404026
945 Ga0496113_0842516
946 Ga0496114_0000091
947 Ga0496114_0000431
948 Ga0496114_0005466
949 Ga0496114_0180396
950 Ga0496114_0734347
951 Ga0496115_0002689
952 Ga0496115_0005795
953 Ga0496115_0058385
954 Ga0496115_0256714
955 Ga0496115_0323026
956 Ga0496116_0000034
957 Ga0496116_0004066
958 Ga0496116_0027615
959 Ga0496117_0000003
960 Ga0496117_0000390
961 Ga0496117_0081151
962 Ga0496118_0000001
963 Ga0496118_0001073
964 Ga0496118_0003587
965 Ga0496118_0011216
966 Ga0496118_0293102
967 Ga0496119_0000127
968 Ga0496119_0001863
969 Ga0496119_0003625
970 Ga0496119_0076384
971 Ga0496120_0000357
972 Ga0496120_0005894
973 Ga0496120_0010743
974 Ga0496120_0137999
975 Ga0496121_0000002
976 Ga0496121_0000120
977 Ga0496121_0001494
978 Ga0496121_0269811
979 Ga0496122_0000051
980 Ga0496122_0022321
981 Ga0496122_0104817
982 Ga0496123_0010315
983 Ga0496123_0031348
984 Ga0496124_0000002
985 Ga0496124_0030127
986 Ga0496125_0000002
987 Ga0496125_0167176
988 Ga0496125_0187854
989 Ga0496125_0437243
990 Ga0496126_0000011
991 Ga0496126_0000936
992 Ga0496126_0005743
993 Ga0496126_0009172
994 Ga0496126_0011595
995 Ga0496126_0419161
996 Ga0501032_0004163
997 Ga0501033_0090990
998 Ga0501033_0223308
999 Ga0501034_0006488
1000 Ga0501034_0066958
1001 Ga0501034_0082519
1002 Ga0501034_0175654
1003 Ga0501034_0728557
1004 Ga0501036_0092003
1005 Ga0501037_0002468
1006 Ga0501037_0225766
1007 Ga0501043_0223131
1008 Ga0501046_0000859
1009 Ga0501046_0367081
1010 Ga0501047_0002076
1011 Ga0501048_0005405
1012 Ga0501069_0031625
1013 Ga0501070_0000442
1014 Ga0501070_0622141
1015 Ga0501070_0628320
1016 Ga0501073_0040558
1017 Ga0501073_0104977
1018 Ga0501079_0282617
1019 Ga0501080_0475054
1020 Ga0501035_0000682
1021 Ga0501035_0001142
1022 Ga0501035_0534566
1023 Ga0501044_0002164
1024 Ga0501044_0020308
1025 Ga0501044_0021605
1026 nmdc:mga03683_115755_c1
1027 nmdc:mga03683_393659_c1
1028 nmdc:mga03683_66070_c1
1029 nmdc:mga03683_96966_c1
1030 nmdc:mga03n38_101805_c1
1031 nmdc:mga03n38_282684_c1
1032 nmdc:mga03n38_6068_c1
1033 nmdc:mga03n38_796_c1
1034 nmdc:mga03n38_91641_c1
1035 nmdc:mga00v17_23052_c1
1036 nmdc:mga00v17_335523_c1
1037 nmdc:mga00v17_369_c1
1038 nmdc:mga00v17_48577_c1
1039 nmdc:mga00v17_4980_c1
1040 nmdc:mga00v17_5233_c1
1041 nmdc:mga00v17_79227_c1
1042 nmdc:mga00v17_893741_c1
1043 nmdc:mga0yw44_12438_c1
1044 nmdc:mga0yw44_185548_c1
1045 nmdc:mga0yw44_228120_c1
1046 nmdc:mga0yw44_35397_c1
1047 nmdc:mga0yw44_488505_c1
1048 nmdc:mga0yw44_63952_c1
1049 nmdc:mga0yw44_70581_c1
1050 nmdc:mga0k408_39990_c1
1051 nmdc:mga06z11_165312_c1
1052 nmdc:mga06z11_234094_c1
1053 nmdc:mga06z11_4458_c1
1054 nmdc:mga06z11_76957_c1
1055 nmdc:mga04h51_241971_c1
1056 nmdc:mga07m45_5902_c1
1057 nmdc:mga07m45_7858_c1
1058 nmdc:mga07m45_8372_c1
1059 nmdc:mga08y16_224134_c1
1060 nmdc:mga0n895_573931_c1
1061 nmdc:mga0sz30_124559_c1
1062 nmdc:mga0sz30_133622_c1
1063 nmdc:mga0sz30_134749_c1
1064 nmdc:mga0sz30_1466_c1
1065 nmdc:mga0sz30_30405_c1
1066 nmdc:mga0sz30_7549_c1
1067 Ga0495601_0077510
1068 Ga0500610_0001520
1069 Ga0500610_0131374
1070 Ga0500635_0075059
1071 Ga0500643_005443
1072 Ga0500643_011892
1073 Ga0500583_0106311
1074 Ga0500641_0035640
1075 Ga0500650_0087745
1076 Ga0500556_0042981
1077 Ga0500556_0079039
1078 Ga0500562_033102
1079 Ga0500652_001609
1080 Ga0500652_002684
1081 Ga0500559_0228505
1082 Ga0500568_0094853
1083 Ga0500616_0010589
1084 Ga0500616_0037696
1085 Ga0500611_062091
1086 Ga0466962_0036184
1087 Ga0466962_0130128
1088 2644489642
1089 2644635847
1090 2902799334
1091 2902813303
1092 2902842413
1093 2929214173
1094 2939587942

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03703

bPH_2

Bacterial PH domain

82

157

0.97

Map