F462162

General Info

Members Datasets Scaffolds Average Seq Length
547 322 1094 337

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_16581_c1|nmdc:mga0k408_16581_c1_1450_2634
Length 394
Sequence MAGRLGSGPALGPPPIRPLLIPDPHKDRQKPSLDGCADLLSIRALSSNRQPTLPAAMFPILRSPVRRLLVAAAATLSLPAFAATTLLNVSYDVARELYKEINPAFQKSWKASTGEDLTINQSHGGSSKQARSVLDGLEADVVTMNQSSDIDVLATRGKLIPADWAKRLPNNAAPTTSVTVILVRKGNPKGIKDWPDLAKAGTSVVIPNPKITGNGRYTYVAAWGSAIKAGGTPAQARELVQKIFANVPVFDGGGRAATTTFAQRGIGDALATFESEVNLIKSEFGDHFDVVYPSSTILAENPVSVVDKVVDKKGTRKQAEAYLKFLWSDEAQEIAAKHQLRPRSAALLAKYTKDFPKVTTFTIDEVFGGWTQAQKEHFDDGAIYDQILAAGKKQ

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
176 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
196 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
211 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
212 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
213 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
214 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
215 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
216 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
242 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
245 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
278 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
279 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
280 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
281 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
282 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
283 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
284 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
293 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
294 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
297 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
298 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
299 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
300 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
301 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
302 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
303 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
304 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
305 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
306 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
307 2547132512 Azospira oryzae 6a3 Isolate Unclassified
308 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
309 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
310 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
311 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
312 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
313 2643221585 Pelomonas sp. Root662 Isolate Unclassified
314 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
315 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
316 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
317 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
318 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
319 2643221656 Pelomonas sp. Root405 Isolate Unclassified
320 2643221660 Methylibium sp. Root1272 Isolate Unclassified
321 2738541337 Pelomonas sp. BT06 Isolate Unclassified
322 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.16
Metatranscriptomes 0.91
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.43
Nodule 0.37
Rhizoplane 4.57
Rhizosphere 75.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_16581_c1 3300050493 Bacteria 4090
2 JGI24744J21845_10009649 3300002077 Bacteria 1981
3 JGI25156J39149_1010588 3300002705 Bacteria 2156
4 JGI25153J46596_10001786 3300003215 Bacteria 12758
5 rootH2_10029312 3300003320 Bacteria 9084
6 rootL2_10019891 3300003322 Bacteria 13677
7 rootL2_10131798 3300003322 Bacteria 3742
8 rootH1_10012734 3300003323 Bacteria 15075
9 rootH1_10185320 3300003323 Bacteria 4318
10 Ga0055533_1000011 3300003756 Bacteria 467893
11 Ga0055525_1000468 3300003759 Bacteria 22440
12 Ga0055535_1000107 3300003761 Bacteria 89840
13 Ga0055529_1000111 3300003763 Bacteria 118734
14 Ga0055526_1000070 3300003771 Bacteria 96845
15 Ga0055526_1003988 3300003771 Bacteria 9085
16 Ga0055524_1000227 3300003775 Bacteria 59891
17 Ga0055530_10008633 3300003791 Bacteria 4040
18 Ga0055540_1000112 3300003792 Bacteria 88200
19 Ga0055540_1011087 3300003792 Bacteria 2941
20 Ga0055531_10000021 3300003794 Bacteria 167213
21 Ga0055531_10021676 3300003794 Bacteria 2481
22 Ga0065165_1000707 3300005262 Bacteria 47352
23 Ga0065715_10009227 3300005293 Bacteria 4164
24 Ga0070658_10087406 3300005327 Bacteria 2566
25 Ga0070658_10253365 3300005327 Bacteria 1493
26 Ga0070658_10370031 3300005327 Bacteria 1228
27 Ga0070676_10008107 3300005328 Bacteria 5650
28 Ga0070676_10040392 3300005328 Bacteria 2702
29 Ga0070676_10041692 3300005328 Bacteria 2663
30 Ga0070683_100064962 3300005329 Bacteria 3397
31 Ga0070683_100088191 3300005329 Bacteria 2910
32 Ga0070683_100198468 3300005329 Bacteria 1905
33 Ga0070690_100057470 3300005330 Bacteria 2497
34 Ga0070670_100006130 3300005331 Bacteria 10167
35 Ga0070670_100015540 3300005331 Bacteria 6537
36 Ga0070670_100077509 3300005331 Bacteria 2855
37 Ga0070670_100081313 3300005331 Bacteria 2784
38 Ga0070677_10017591 3300005333 Bacteria 2561
39 Ga0068869_100003187 3300005334 Bacteria 10022
40 Ga0068869_100042093 3300005334 Bacteria 3274
41 Ga0068869_100045356 3300005334 Bacteria 3164
42 Ga0070666_10001924 3300005335 Bacteria 12627
43 Ga0070666_10221256 3300005335 Bacteria 1335
44 Ga0070666_10233765 3300005335 Bacteria 1299
45 Ga0070680_100005902 3300005336 Bacteria 9301
46 Ga0068868_100001433 3300005338 Bacteria 16455
47 Ga0068868_100003192 3300005338 Bacteria 11404
48 Ga0070660_100243605 3300005339 Bacteria 1465
49 Ga0070689_100346599 3300005340 Bacteria 1245
50 Ga0070687_100054457 3300005343 Bacteria 2085
51 Ga0070661_100012722 3300005344 Bacteria 5889
52 Ga0070661_100128726 3300005344 Bacteria 1900
53 Ga0070661_100141862 3300005344 Bacteria 1811
54 Ga0070661_100322578 3300005344 Bacteria 1206
55 Ga0070668_100019089 3300005347 Bacteria 5154
56 Ga0070669_100030933 3300005353 Bacteria 3864
57 Ga0070669_100193271 3300005353 Bacteria 1597
58 Ga0070675_100004634 3300005354 Bacteria 10501
59 Ga0070675_100012627 3300005354 Bacteria 6624
60 Ga0070675_100018720 3300005354 Bacteria 5512
61 Ga0070675_100196771 3300005354 Bacteria 1748
62 Ga0070675_100236953 3300005354 Bacteria 1593
63 Ga0070671_100028423 3300005355 Bacteria 4604
64 Ga0070671_100325800 3300005355 Bacteria 1309
65 Ga0070674_100010654 3300005356 Bacteria 5570
66 Ga0070674_100147199 3300005356 Bacteria 1774
67 Ga0070673_100015595 3300005364 Bacteria 5344
68 Ga0070673_100034120 3300005364 Bacteria 3847
69 Ga0070688_100010026 3300005365 Bacteria 5206
70 Ga0070659_100002488 3300005366 Bacteria 13084
71 Ga0070659_100015279 3300005366 Bacteria 5748
72 Ga0070659_100263807 3300005366 Bacteria 1429
73 Ga0070659_100339730 3300005366 Bacteria 1258
74 Ga0070667_100003252 3300005367 Bacteria 13886
75 Ga0070667_100011203 3300005367 Bacteria 7419
76 Ga0070700_100021791 3300005441 Bacteria 3728
77 Ga0070663_100267990 3300005455 Bacteria 1357
78 Ga0070678_100013316 3300005456 Bacteria 5152
79 Ga0070678_100064748 3300005456 Bacteria 2710
80 Ga0070662_100001070 3300005457 Bacteria 16689
81 Ga0070662_100002870 3300005457 Bacteria 10690
82 Ga0070662_100045787 3300005457 Bacteria 3140
83 Ga0070662_100165515 3300005457 Bacteria 1732
84 Ga0068867_100000036 3300005459 Bacteria 81113
85 Ga0068867_100015847 3300005459 Bacteria 5350
86 Ga0068867_100046698 3300005459 Bacteria 3181
87 Ga0070706_100355960 3300005467 Bacteria 1364
88 Ga0070679_100017484 3300005530 Bacteria 6941
89 Ga0070684_100129983 3300005535 Bacteria 2271
90 Ga0068853_100003281 3300005539 Bacteria 12370
91 Ga0068853_100090822 3300005539 Bacteria 2684
92 Ga0068853_100307180 3300005539 Bacteria 1467
93 Ga0070672_100001996 3300005543 Bacteria 12809
94 Ga0070672_100036630 3300005543 Bacteria 3738
95 Ga0070672_100105390 3300005543 Bacteria 2292
96 Ga0070672_100108461 3300005543 Bacteria 2260
97 Ga0070672_100230853 3300005543 Bacteria 1555
98 Ga0070686_100061741 3300005544 Bacteria 2422
99 Ga0070693_100018518 3300005547 Bacteria 3639
100 Ga0068855_100007253 3300005563 Bacteria 13442
101 Ga0068855_100079641 3300005563 Bacteria 3799
102 Ga0070664_100190400 3300005564 Bacteria 1827
103 Ga0070664_100208800 3300005564 Bacteria 1745
104 Ga0068857_100039125 3300005577 Bacteria 4200
105 Ga0068857_100144011 3300005577 Bacteria 2155
106 Ga0068854_100022165 3300005578 Bacteria 4322
107 Ga0068854_100220463 3300005578 Bacteria 1500
108 Ga0068856_100470658 3300005614 Bacteria 1277
109 Ga0070702_100069884 3300005615 Bacteria 2071
110 Ga0070702_100123254 3300005615 Bacteria 1626
111 Ga0068852_100045093 3300005616 Bacteria 3748
112 Ga0068852_100082887 3300005616 Bacteria 2851
113 Ga0068852_100116127 3300005616 Bacteria 2441
114 Ga0068852_100199145 3300005616 Bacteria 1894
115 Ga0068859_100003467 3300005617 Bacteria 16040
116 Ga0068859_100021684 3300005617 Bacteria 6447
117 Ga0068864_100001208 3300005618 Bacteria 21454
118 Ga0068864_100011910 3300005618 Bacteria 7182
119 Ga0068864_100032262 3300005618 Bacteria 4449
120 Ga0068864_100036794 3300005618 Bacteria 4174
121 Ga0068864_100058060 3300005618 Bacteria 3343
122 Ga0068861_100008773 3300005719 Bacteria 6962
123 Ga0068861_100011385 3300005719 Bacteria 6181
124 Ga0068863_100002785 3300005841 Bacteria 17318
125 Ga0068863_100022314 3300005841 Bacteria 6043
126 Ga0068858_100000436 3300005842 Bacteria 43518
127 Ga0068858_100016124 3300005842 Bacteria 7019
128 Ga0068858_100027483 3300005842 Bacteria 5285
129 Ga0068858_100063430 3300005842 Bacteria 3419
130 Ga0068860_100001260 3300005843 Bacteria 27630
131 Ga0068860_100022605 3300005843 Bacteria 6080
132 Ga0068860_100280612 3300005843 Bacteria 1628
133 Ga0068862_100030222 3300005844 Bacteria 4565
134 Ga0075363_100033553 3300006048 Bacteria 2674
135 Ga0075366_10000823 3300006195 Bacteria 14890
136 Ga0075366_10030750 3300006195 Bacteria 3158
137 Ga0075366_10055154 3300006195 Bacteria 2360
138 Ga0075366_10140097 3300006195 Bacteria 1462
139 Ga0075366_10146802 3300006195 Bacteria 1427
140 Ga0097621_100010262 3300006237 Bacteria 6843
141 Ga0097621_100041421 3300006237 Bacteria 3708
142 Ga0097621_100167092 3300006237 Bacteria 1894
143 Ga0097621_100287171 3300006237 Bacteria 1449
144 Ga0075370_10031514 3300006353 Bacteria 2960
145 Ga0068871_100078765 3300006358 Bacteria 2725
146 Ga0075430_100100883 3300006846 Bacteria 2410
147 Ga0075430_100208152 3300006846 Bacteria 1623
148 Ga0075429_100000756 3300006880 Bacteria 25403
149 Ga0097620_100003467 3300006931 Bacteria 16040
150 Ga0097620_100021684 3300006931 Bacteria 6447
151 Ga0079104_1000024 3300006946 Bacteria 219543
152 Ga0105240_10068912 3300009093 Bacteria 4381
153 Ga0105240_10209141 3300009093 Bacteria 2281
154 Ga0111539_10423514 3300009094 Bacteria 1550
155 Ga0105245_10363798 3300009098 Bacteria 1436
156 Ga0105247_10047738 3300009101 Bacteria 2630
157 Ga0105243_10001240 3300009148 Bacteria 22981
158 Ga0105243_10022977 3300009148 Bacteria 4743
159 Ga0105243_10118756 3300009148 Bacteria 2226
160 Ga0105241_10067363 3300009174 Bacteria 2771
161 Ga0105242_10194341 3300009176 Bacteria 1798
162 Ga0105242_10207958 3300009176 Bacteria 1742
163 Ga0105248_10006273 3300009177 Bacteria 13041
164 Ga0105248_10024158 3300009177 Bacteria 6755
165 Ga0105248_10047429 3300009177 Bacteria 4817
166 Ga0105248_10102510 3300009177 Bacteria 3225
167 Ga0105248_10247246 3300009177 Bacteria 2008
168 Ga0105237_10586999 3300009545 Bacteria 1121
169 Ga0105238_10216528 3300009551 Bacteria 1891
170 Ga0105238_10260369 3300009551 Bacteria 1714
171 Ga0105249_10008506 3300009553 Bacteria 8946
172 Ga0105249_10257469 3300009553 Bacteria 1732
173 Ga0105239_10146529 3300010375 Bacteria 2634
174 Ga0157373_10030122 3300013100 Bacteria 3905
175 Ga0157369_10188410 3300013105 Bacteria 2168
176 Ga0157374_10345981 3300013296 Bacteria 1477
177 Ga0163162_10007061 3300013306 Bacteria 10891
178 Ga0163162_10039424 3300013306 Bacteria 4720
179 Ga0163162_10069032 3300013306 Bacteria 3586
180 Ga0163162_10487707 3300013306 Bacteria 1363
181 Ga0157372_10267700 3300013307 Bacteria 1985
182 Ga0157375_10079578 3300013308 Bacteria 3313
183 Ga0157375_10108585 3300013308 Bacteria 2870
184 Ga0157375_10184820 3300013308 Bacteria 2237
185 Ga0157375_10869704 3300013308 Bacteria 1047
186 Ga0163163_10104206 3300014325 Bacteria 2861
187 Ga0163163_10335187 3300014325 Bacteria 1568
188 Ga0157380_10033970 3300014326 Bacteria 3931
189 Ga0157380_10071692 3300014326 Bacteria 2803
190 Ga0157380_10103460 3300014326 Bacteria 2376
191 Ga0157377_10000010 3300014745 Bacteria 380929
192 Ga0157377_10002392 3300014745 Bacteria 8275
193 Ga0157379_10008733 3300014968 Bacteria 8832
194 Ga0157379_10008941 3300014968 Bacteria 8731
195 Ga0157379_10016132 3300014968 Bacteria 6570
196 Ga0157379_10021355 3300014968 Bacteria 5729
197 Ga0157376_10077274 3300014969 Bacteria 2847
198 Ga0157376_10189434 3300014969 Bacteria 1885
199 Ga0163161_10084417 3300017792 Bacteria 2342
200 Ga0163161_10094822 3300017792 Bacteria 2213
201 Ga0209674_100003 3300025226 Bacteria 2196646
202 Ga0209563_100010 3300025230 Bacteria 1337457
203 Ga0207427_100869 3300025231 Bacteria 13370
204 Ga0209258_100267 3300025242 Bacteria 89896
205 Ga0207425_1000328 3300025245 Bacteria 33571
206 Ga0209677_100068 3300025253 Bacteria 146135
207 Ga0209677_103116 3300025253 Bacteria 5635
208 Ga0209759_1000847 3300025256 Bacteria 23854
209 Ga0209759_1001246 3300025256 Bacteria 15442
210 Ga0209759_1002289 3300025256 Bacteria 8640
211 Ga0209759_1011814 3300025256 Bacteria 2456
212 Ga0209129_1000035 3300025258 Bacteria 329303
213 Ga0209565_1014805 3300025263 Bacteria 1779
214 Ga0209455_1000158 3300025272 Bacteria 118973
215 Ga0209673_1003283 3300025273 Bacteria 9734
216 Ga0209675_1011720 3300025291 Bacteria 2888
217 Ga0209564_1000024 3300025295 Bacteria 535041
218 Ga0209758_1000066 3300025297 Bacteria 298620
219 Ga0209758_1000213 3300025297 Bacteria 126745
220 Ga0209050_1000178 3300025298 Bacteria 145314
221 Ga0209050_1004228 3300025298 Bacteria 9879
222 Ga0209050_1004728 3300025298 Bacteria 9009
223 Ga0209256_1000011 3300025299 Bacteria 865309
224 Ga0209051_1000016 3300025303 Bacteria 541891
225 Ga0209051_1009600 3300025303 Bacteria 4969
226 Ga0209257_1000032 3300025304 Bacteria 680354
227 Ga0209257_1000510 3300025304 Bacteria 67777
228 Ga0209257_1017020 3300025304 Bacteria 2893
229 Ga0207697_10082366 3300025315 Bacteria 1357
230 Ga0207682_10048335 3300025893 Bacteria 1753
231 Ga0207642_10038849 3300025899 Bacteria 2063
232 Ga0207688_10081050 3300025901 Bacteria 1853
233 Ga0207680_10014016 3300025903 Bacteria 4134
234 Ga0207647_10137730 3300025904 Bacteria 1431
235 Ga0207685_10033492 3300025905 Bacteria 1857
236 Ga0207645_10016926 3300025907 Bacteria 4817
237 Ga0207645_10108134 3300025907 Bacteria 1799
238 Ga0207705_10237955 3300025909 Bacteria 1386
239 Ga0207695_10055277 3300025913 Bacteria 4138
240 Ga0207695_10117379 3300025913 Bacteria 2634
241 Ga0207695_10437014 3300025913 Bacteria 1192
242 Ga0207671_10001444 3300025914 Bacteria 27486
243 Ga0207660_10008400 3300025917 Bacteria 6680
244 Ga0207657_10022586 3300025919 Bacteria 5882
245 Ga0207649_10005583 3300025920 Bacteria 6803
246 Ga0207649_10160956 3300025920 Bacteria 1555
247 Ga0207652_10033780 3300025921 Bacteria 4308
248 Ga0207681_10004364 3300025923 Bacteria 8718
249 Ga0207681_10022723 3300025923 Bacteria 4003
250 Ga0207681_10063833 3300025923 Bacteria 2541
251 Ga0207694_10091166 3300025924 Bacteria 2405
252 Ga0207694_10096331 3300025924 Bacteria 2340
253 Ga0207650_10001175 3300025925 Bacteria 19267
254 Ga0207650_10092072 3300025925 Bacteria 2318
255 Ga0207659_10001653 3300025926 Bacteria 13245
256 Ga0207659_10004285 3300025926 Bacteria 8626
257 Ga0207659_10007056 3300025926 Bacteria 6893
258 Ga0207644_10006285 3300025931 Bacteria 7739
259 Ga0207644_10143772 3300025931 Bacteria 1839
260 Ga0207690_10007581 3300025932 Bacteria 6439
261 Ga0207690_10041443 3300025932 Bacteria 3017
262 Ga0207690_10045373 3300025932 Bacteria 2903
263 Ga0207690_10082677 3300025932 Bacteria 2246
264 Ga0207706_10007806 3300025933 Bacteria 9877
265 Ga0207706_10021986 3300025933 Bacteria 5725
266 Ga0207706_10030321 3300025933 Bacteria 4825
267 Ga0207706_10191472 3300025933 Bacteria 1795
268 Ga0207686_10152492 3300025934 Bacteria 1610
269 Ga0207686_10288811 3300025934 Bacteria 1213
270 Ga0207709_10001721 3300025935 Bacteria 14755
271 Ga0207709_10031240 3300025935 Bacteria 3108
272 Ga0207709_10059906 3300025935 Bacteria 2371
273 Ga0207670_10008723 3300025936 Bacteria 5741
274 Ga0207669_10025495 3300025937 Bacteria 3197
275 Ga0207669_10111422 3300025937 Bacteria 1835
276 Ga0207669_10123838 3300025937 Bacteria 1761
277 Ga0207669_10227133 3300025937 Bacteria 1375
278 Ga0207691_10070596 3300025940 Bacteria 3153
279 Ga0207691_10082895 3300025940 Bacteria 2879
280 Ga0207711_10044076 3300025941 Bacteria 3807
281 Ga0207711_10065978 3300025941 Bacteria 3129
282 Ga0207711_10113253 3300025941 Bacteria 2415
283 Ga0207711_10176853 3300025941 Bacteria 1939
284 Ga0207689_10007748 3300025942 Bacteria 9399
285 Ga0207689_10018156 3300025942 Bacteria 5939
286 Ga0207689_10043151 3300025942 Bacteria 3728
287 Ga0207689_10140581 3300025942 Bacteria 1988
288 Ga0207661_10059056 3300025944 Bacteria 3089
289 Ga0207679_10007653 3300025945 Bacteria 6862
290 Ga0207679_10011113 3300025945 Bacteria 5813
291 Ga0207679_10168631 3300025945 Bacteria 1800
292 Ga0207679_10238516 3300025945 Bacteria 1539
293 Ga0207667_10005517 3300025949 Bacteria 15432
294 Ga0207667_10343829 3300025949 Bacteria 1522
295 Ga0207651_10015996 3300025960 Bacteria 4378
296 Ga0207651_10270416 3300025960 Bacteria 1399
297 Ga0207712_10019737 3300025961 Bacteria 4405
298 Ga0207668_10017174 3300025972 Bacteria 4529
299 Ga0207668_10030692 3300025972 Bacteria 3534
300 Ga0207640_10039484 3300025981 Bacteria 2988
301 Ga0207658_10000458 3300025986 Bacteria 38200
302 Ga0207658_10114517 3300025986 Bacteria 2138
303 Ga0207677_10006505 3300026023 Bacteria 6418
304 Ga0207677_10067696 3300026023 Bacteria 2503
305 Ga0207677_10127528 3300026023 Bacteria 1926
306 Ga0207677_10137769 3300026023 Bacteria 1864
307 Ga0207703_10004646 3300026035 Bacteria 11216
308 Ga0207703_10016146 3300026035 Bacteria 5820
309 Ga0207703_10021127 3300026035 Bacteria 5095
310 Ga0207703_10081579 3300026035 Bacteria 2696
311 Ga0207639_10010143 3300026041 Bacteria 6517
312 Ga0207639_10107749 3300026041 Bacteria 2264
313 Ga0207678_10000924 3300026067 Bacteria 26847
314 Ga0207678_10078251 3300026067 Bacteria 2832
315 Ga0207708_10023923 3300026075 Bacteria 4619
316 Ga0207702_10013557 3300026078 Bacteria 6771
317 Ga0207702_10253805 3300026078 Bacteria 1653
318 Ga0207641_10012454 3300026088 Bacteria 6973
319 Ga0207641_10104424 3300026088 Bacteria 2501
320 Ga0207641_10169855 3300026088 Bacteria 1989
321 Ga0207648_10000037 3300026089 Bacteria 120856
322 Ga0207676_10000221 3300026095 Bacteria 49106
323 Ga0207676_10009712 3300026095 Bacteria 6841
324 Ga0207676_10036213 3300026095 Bacteria 3752
325 Ga0207676_10076456 3300026095 Bacteria 2705
326 Ga0207676_10459123 3300026095 Bacteria 1202
327 Ga0207674_10033930 3300026116 Bacteria 5339
328 Ga0207674_10227592 3300026116 Bacteria 1813
329 Ga0207674_10255040 3300026116 Bacteria 1701
330 Ga0207675_100001459 3300026118 Bacteria 23702
331 Ga0207675_100008112 3300026118 Bacteria 9895
332 Ga0207683_10025002 3300026121 Bacteria 5149
333 Ga0207683_10128341 3300026121 Bacteria 2280
334 Ga0207683_10191247 3300026121 Bacteria 1858
335 Ga0207698_10006139 3300026142 Bacteria 7478
336 Ga0207698_10045436 3300026142 Bacteria 3309
337 Ga0209281_1000104 3300027111 Bacteria 221056
338 Ga0209974_10002408 3300027876 Bacteria 6779
339 Ga0268266_10220107 3300028379 Bacteria 1745
340 Ga0268265_10200089 3300028380 Bacteria 1732
341 Ga0268265_10284748 3300028380 Bacteria 1480
342 Ga0268264_10000963 3300028381 Bacteria 29539
343 Ga0268264_10037911 3300028381 Bacteria 3976
344 Ga0307515_10005576 3300028794 Bacteria 25454
345 Ga0307515_10013844 3300028794 Bacteria 15023
346 Ga0307515_10054018 3300028794 Bacteria 5908
347 Ga0307515_10066151 3300028794 Bacteria 5012
348 Ga0307515_10174440 3300028794 Bacteria 2126
349 Ga0265324_10000232 3300029957 Bacteria 42039
350 Ga0307512_10060993 3300030522 Bacteria 2910
351 Ga0265332_10000030 3300031238 Bacteria 175141
352 Ga0265328_10008511 3300031239 Bacteria 4226
353 Ga0265331_10007217 3300031250 Bacteria 6451
354 Ga0265327_10026013 3300031251 Bacteria 3398
355 Ga0265316_10000180 3300031344 Bacteria 71764
356 Ga0307513_10026447 3300031456 Bacteria 6689
357 Ga0307513_10164049 3300031456 Bacteria 2109
358 Ga0307408_100000056 3300031548 Bacteria 140709
359 Ga0307408_100098777 3300031548 Bacteria 2220
360 Ga0307508_10000142 3300031616 Bacteria 85288
361 Ga0307514_10025162 3300031649 Bacteria 4813
362 Ga0307516_10000517 3300031730 Bacteria 51613
363 Ga0307516_10007360 3300031730 Bacteria 12668
364 Ga0307516_10217260 3300031730 Bacteria 1623
365 Ga0307413_10219676 3300031824 Bacteria 1387
366 Ga0307410_10271308 3300031852 Bacteria 1327
367 Ga0307412_10236148 3300031911 Bacteria 1411
368 Ga0307409_100006655 3300031995 Bacteria 6822
369 Ga0307416_100019732 3300032002 Bacteria 4788
370 Ga0307416_100073360 3300032002 Bacteria 2853
371 Ga0307414_10006110 3300032004 Bacteria 6687
372 Ga0307411_10000184 3300032005 Bacteria 20004
373 Ga0307411_10004105 3300032005 Bacteria 6908
374 Ga0307415_100042363 3300032126 Bacteria 3029
375 Ga0307507_10141672 3300033179 Bacteria 1841
376 Ga0373959_0021180 3300034820 Bacteria 1246
377 Ga0373939_0000063 3300035114 Bacteria 36084
378 Ga0373945_0087807 3300035116 Bacteria 1200
379 Ga0373960_0000294 3300035121 Bacteria 9505
380 Ga0373960_0005051 3300035121 Bacteria 3040
381 Ga0373946_0034374 3300035171 Bacteria 2047
382 Ga0373931_0000870 3300035691 Bacteria 12748
383 Ga0373931_0003270 3300035691 Bacteria 7251
384 Ga0373931_0094987 3300035691 Bacteria 1668
385 Ga0373927_0043918 3300035695 Bacteria 2893
386 Ga0373947_0113054 3300035725 Bacteria 1718
387 Ga0373937_0123177 3300036401 Bacteria 2417
388 Ga0373937_0190646 3300036401 Bacteria 1926
389 Ga0395905_0001528 3300037471 Bacteria 27686
390 Ga0395905_0004284 3300037471 Bacteria 14874
391 Ga0395905_0012063 3300037471 Bacteria 8328
392 Ga0395905_0053882 3300037471 Bacteria 3764
393 Ga0395905_0265972 3300037471 Bacteria 1600
394 Ga0436361_0050220 3300039447 Bacteria 22165
395 Ga0436363_1083478 3300039450 Bacteria 2645
396 Ga0451793_1867563 3300041452 Bacteria 3436
397 Ga0451853_2247177 3300041512 Bacteria 1147
398 Ga0439437_000891 3300042000 Bacteria 3111
399 Ga0439455_0008313 3300042012 Bacteria 2220
400 Ga0450888_000764 3300042126 Bacteria 3080
401 Ga0450891_000139 3300042129 Bacteria 6631
402 Ga0450892_000941 3300042130 Bacteria 3136
403 Ga0450899_005450 3300042135 Bacteria 1368
404 Ga0439464_0001824 3300042439 Bacteria 5139
405 Ga0451577_0216782 3300042876 Bacteria 1730
406 Ga0466969_0000157 3300044656 Bacteria 36880
407 Ga0466969_0037501 3300044656 Bacteria 2444
408 Ga0466972_0010902 3300044658 Bacteria 4561
409 Ga0466965_0003866 3300044683 Bacteria 6618
410 Ga0466965_0083787 3300044683 Bacteria 1614
411 Ga0466966_0010737 3300044684 Bacteria 6089
412 Ga0466966_0015258 3300044684 Bacteria 5080
413 Ga0466961_0061275 3300044693 Bacteria 2391
414 Ga0453684_0008823 3300044712 Bacteria 17877
415 Ga0466971_0011291 3300044719 Bacteria 3913
416 Ga0466971_0040395 3300044719 Bacteria 2095
417 Ga0466968_0082237 3300044735 Bacteria 1417
418 Ga0466970_0007109 3300044765 Bacteria 5602
419 Ga0466960_0070087 3300044901 Bacteria 1743
420 Ga0466959_0011523 3300045049 Bacteria 6356
421 Ga0466959_0075544 3300045049 Bacteria 2434
422 Ga0466959_0085138 3300045049 Bacteria 2275
423 Ga0451576_0001435 3300045051 Bacteria 40749
424 Ga0451576_0032586 3300045051 Bacteria 5546
425 Ga0451576_0081201 3300045051 Bacteria 3372
426 Ga0451576_0167851 3300045051 Bacteria 2290
427 Ga0466958_0028498 3300045836 Bacteria 3311
428 Ga0495590_0003984 3300046457 Bacteria 5998
429 Ga0495629_0060333 3300046459 Bacteria 2651
430 Ga0495638_0049107 3300046460 Bacteria 2639
431 Ga0495650_0000329 3300046471 Bacteria 84971
432 Ga0495639_0017217 3300046475 Bacteria 3139
433 Ga0495585_0008761 3300046492 Bacteria 6116
434 Ga0495607_0128902 3300046501 Bacteria 1319
435 Ga0495583_0000628 3300046506 Bacteria 47247
436 Ga0495606_0000001 3300046507 Bacteria 592123
437 Ga0495606_0001339 3300046507 Bacteria 33542
438 Ga0495610_0001848 3300046512 Bacteria 18355
439 Ga0495610_0016504 3300046512 Bacteria 4246
440 Ga0495620_0035573 3300046515 Bacteria 2237
441 Ga0495632_0003423 3300046519 Bacteria 11276
442 Ga0495632_0019378 3300046519 Bacteria 3708
443 Ga0495643_0042463 3300046522 Bacteria 2477
444 Ga0495648_0057782 3300046524 Bacteria 2324
445 Ga0495621_0000904 3300046539 Bacteria 7543
446 Ga0495645_0061193 3300046543 Bacteria 2728
447 Ga0495668_0000474 3300046616 Bacteria 50676
448 Ga0495668_0033330 3300046616 Bacteria 2894
449 Ga0495625_0003318 3300046660 Bacteria 16212
450 Ga0495647_0006716 3300046681 Bacteria 3828
451 Ga0495647_0018493 3300046681 Bacteria 2482
452 Ga0495658_0006191 3300046683 Bacteria 5875
453 Ga0495670_0078754 3300046691 Bacteria 1677
454 Ga0495649_0000386 3300046694 Bacteria 38357
455 Ga0495589_0019325 3300046794 Bacteria 3495
456 Ga0495600_0060720 3300046809 Bacteria 2469
457 Ga0495684_0092413 3300047471 Bacteria 2292
458 Ga0495686_0005405 3300047472 Bacteria 10088
459 Ga0496100_0051032 3300048903 Bacteria 2683
460 Ga0496101_0052358 3300048904 Bacteria 2943
461 Ga0496101_0291367 3300048904 Bacteria 1277
462 Ga0496102_0007022 3300048905 Bacteria 9615
463 Ga0496102_0008369 3300048905 Bacteria 8859
464 Ga0496102_0518629 3300048905 Bacteria 1114
465 Ga0496104_0002996 3300048907 Bacteria 14561
466 Ga0496104_0031621 3300048907 Bacteria 4923
467 Ga0496105_0019359 3300048908 Bacteria 5490
468 Ga0496105_0079723 3300048908 Bacteria 2704
469 Ga0496105_0087831 3300048908 Bacteria 2569
470 Ga0496108_0056190 3300048911 Bacteria 3306
471 Ga0496108_0147745 3300048911 Bacteria 2027
472 Ga0496108_0195435 3300048911 Bacteria 1754
473 Ga0496110_0078442 3300048913 Bacteria 2940
474 Ga0496110_0359809 3300048913 Bacteria 1326
475 Ga0496112_0109434 3300048915 Bacteria 2733
476 Ga0496113_0038115 3300048916 Bacteria 3532
477 Ga0496113_0080078 3300048916 Bacteria 2501
478 Ga0496114_0015736 3300048917 Bacteria 6087
479 Ga0496114_0103021 3300048917 Bacteria 2439
480 Ga0496114_0137482 3300048917 Bacteria 2113
481 Ga0496114_0408678 3300048917 Bacteria 1202
482 Ga0496115_0003633 3300048918 Bacteria 11100
483 Ga0496124_0073642 3300048927 Bacteria 2826
484 Ga0501309_004053 3300049129 Bacteria 1691
485 Ga0501310_002776 3300049130 Bacteria 1678
486 Ga0501310_010318 3300049130 Bacteria 1040
487 Ga0501305_005422 3300049161 Bacteria 1545
488 Ga0501311_002816 3300049527 Bacteria 1707
489 Ga0501043_0000024 3300049579 Bacteria 154045
490 Ga0501046_0000173 3300049580 Bacteria 65571
491 Ga0501047_0000051 3300049581 Bacteria 154281
492 Ga0501048_0005127 3300049582 Bacteria 9981
493 Ga0501198_000003 3300049649 Bacteria 175301
494 Ga0501222_000001 3300049662 Bacteria 307689
495 Ga0501222_000413 3300049662 Bacteria 6442
496 Ga0501233_006681 3300049668 Bacteria 2174
497 Ga0501235_014643 3300049669 Bacteria 1728
498 Ga0501249_002043 3300049679 Bacteria 4107
499 Ga0501221_001265 3300049704 Bacteria 4182
500 Ga0501262_001963 3300049759 Bacteria 2318
501 Ga0501268_023687 3300049765 Bacteria 1068
502 Ga0501045_0083239 3300049824 Bacteria 2360
503 nmdc:mga0k408_31648_c1 3300050493 Bacteria 2493
504 nmdc:mga0k408_36237_c1 3300050493 Bacteria 2831
505 nmdc:mga0k408_4394_c2 3300050493 Bacteria 5891
506 nmdc:mga0k408_54126_c1 3300050493 Bacteria 2326
507 nmdc:mga0k408_54981_c1 3300050493 Bacteria 2307
508 nmdc:mga0k408_93357_c1 3300050493 Bacteria 1769
509 nmdc:mga07m45_23934_c1 3300050496 Bacteria 3341
510 nmdc:mga09592_1348_c1 3300050508 Bacteria 19609
511 nmdc:mga0qj67_16850_c1 3300050509 Bacteria 5549
512 nmdc:mga0qj67_337087_c1 3300050509 Bacteria 1220
513 nmdc:mga08y16_274380_c1 3300050511 Bacteria 1740
514 nmdc:mga08y16_439885_c1 3300050511 Bacteria 1331
515 Ga0500635_0000330 3300053080 Bacteria 16279
516 Ga0495619_0055920 3300053085 Bacteria 2615
517 Ga0500578_0000182 3300053086 Bacteria 75873
518 Ga0500646_0007684 3300053090 Bacteria 2753
519 Ga0500583_0057760 3300053092 Bacteria 1823
520 Ga0500651_0004839 3300053093 Bacteria 7604
521 Ga0500650_0013775 3300053098 Bacteria 3401
522 Ga0500593_016373 3300053117 Bacteria 3211
523 Ga0500642_0066834 3300053130 Bacteria 1628
524 Ga0500652_000309 3300053131 Bacteria 17694
525 Ga0500655_005748 3300053133 Bacteria 2231
526 Ga0500577_0007374 3300053142 Bacteria 3080
527 Ga0500590_004896 3300053148 Bacteria 6393
528 Ga0500619_000134 3300053154 Bacteria 19056
529 Ga0500622_0001582 3300053156 Bacteria 17915
530 Ga0500636_0059034 3300053177 Bacteria 2242
531 Ga0466962_0022161 3300061719 Bacteria 3050
532 2548848492 2547132512 Bacteria 3416496
533 2587729101 2585428057 Bacteria 6737412
534 2587733676 2585428058 Bacteria 6853932
535 2587759083 2585428062 Bacteria 6842168
536 2588294061 2588253510 Bacteria 6901809
537 2643746038 2643221544 Bacteria 5886209
538 2643937003 2643221585 Bacteria 5812563
539 2643967162 2643221592 Bacteria 6608788
540 2644139993 2643221625 Bacteria 6512927
541 2644218031 2643221639 Bacteria 6649903
542 2644258228 2643221646 Bacteria 6433402
543 2644271233 2643221648 Bacteria 6521465
544 2644318168 2643221656 Bacteria 5809961
545 2644339643 2643221660 Bacteria 4208257
546 2739057166 2738541337 Bacteria 6183410
547 2891633833 2891633521 Bacteria 4602265
548 nmdc:mga0k408_16581_c1
549 JGI24744J21845_10009649
550 JGI25156J39149_1010588
551 JGI25153J46596_10001786
552 rootH2_10029312
553 rootL2_10019891
554 rootL2_10131798
555 rootH1_10012734
556 rootH1_10185320
557 Ga0055533_1000011
558 Ga0055525_1000468
559 Ga0055535_1000107
560 Ga0055529_1000111
561 Ga0055526_1000070
562 Ga0055526_1003988
563 Ga0055524_1000227
564 Ga0055530_10008633
565 Ga0055540_1000112
566 Ga0055540_1011087
567 Ga0055531_10000021
568 Ga0055531_10021676
569 Ga0065165_1000707
570 Ga0065715_10009227
571 Ga0070658_10087406
572 Ga0070658_10253365
573 Ga0070658_10370031
574 Ga0070676_10008107
575 Ga0070676_10040392
576 Ga0070676_10041692
577 Ga0070683_100064962
578 Ga0070683_100088191
579 Ga0070683_100198468
580 Ga0070690_100057470
581 Ga0070670_100006130
582 Ga0070670_100015540
583 Ga0070670_100077509
584 Ga0070670_100081313
585 Ga0070677_10017591
586 Ga0068869_100003187
587 Ga0068869_100042093
588 Ga0068869_100045356
589 Ga0070666_10001924
590 Ga0070666_10221256
591 Ga0070666_10233765
592 Ga0070680_100005902
593 Ga0068868_100001433
594 Ga0068868_100003192
595 Ga0070660_100243605
596 Ga0070689_100346599
597 Ga0070687_100054457
598 Ga0070661_100012722
599 Ga0070661_100128726
600 Ga0070661_100141862
601 Ga0070661_100322578
602 Ga0070668_100019089
603 Ga0070669_100030933
604 Ga0070669_100193271
605 Ga0070675_100004634
606 Ga0070675_100012627
607 Ga0070675_100018720
608 Ga0070675_100196771
609 Ga0070675_100236953
610 Ga0070671_100028423
611 Ga0070671_100325800
612 Ga0070674_100010654
613 Ga0070674_100147199
614 Ga0070673_100015595
615 Ga0070673_100034120
616 Ga0070688_100010026
617 Ga0070659_100002488
618 Ga0070659_100015279
619 Ga0070659_100263807
620 Ga0070659_100339730
621 Ga0070667_100003252
622 Ga0070667_100011203
623 Ga0070700_100021791
624 Ga0070663_100267990
625 Ga0070678_100013316
626 Ga0070678_100064748
627 Ga0070662_100001070
628 Ga0070662_100002870
629 Ga0070662_100045787
630 Ga0070662_100165515
631 Ga0068867_100000036
632 Ga0068867_100015847
633 Ga0068867_100046698
634 Ga0070706_100355960
635 Ga0070679_100017484
636 Ga0070684_100129983
637 Ga0068853_100003281
638 Ga0068853_100090822
639 Ga0068853_100307180
640 Ga0070672_100001996
641 Ga0070672_100036630
642 Ga0070672_100105390
643 Ga0070672_100108461
644 Ga0070672_100230853
645 Ga0070686_100061741
646 Ga0070693_100018518
647 Ga0068855_100007253
648 Ga0068855_100079641
649 Ga0070664_100190400
650 Ga0070664_100208800
651 Ga0068857_100039125
652 Ga0068857_100144011
653 Ga0068854_100022165
654 Ga0068854_100220463
655 Ga0068856_100470658
656 Ga0070702_100069884
657 Ga0070702_100123254
658 Ga0068852_100045093
659 Ga0068852_100082887
660 Ga0068852_100116127
661 Ga0068852_100199145
662 Ga0068859_100003467
663 Ga0068859_100021684
664 Ga0068864_100001208
665 Ga0068864_100011910
666 Ga0068864_100032262
667 Ga0068864_100036794
668 Ga0068864_100058060
669 Ga0068861_100008773
670 Ga0068861_100011385
671 Ga0068863_100002785
672 Ga0068863_100022314
673 Ga0068858_100000436
674 Ga0068858_100016124
675 Ga0068858_100027483
676 Ga0068858_100063430
677 Ga0068860_100001260
678 Ga0068860_100022605
679 Ga0068860_100280612
680 Ga0068862_100030222
681 Ga0075363_100033553
682 Ga0075366_10000823
683 Ga0075366_10030750
684 Ga0075366_10055154
685 Ga0075366_10140097
686 Ga0075366_10146802
687 Ga0097621_100010262
688 Ga0097621_100041421
689 Ga0097621_100167092
690 Ga0097621_100287171
691 Ga0075370_10031514
692 Ga0068871_100078765
693 Ga0075430_100100883
694 Ga0075430_100208152
695 Ga0075429_100000756
696 Ga0097620_100003467
697 Ga0097620_100021684
698 Ga0079104_1000024
699 Ga0105240_10068912
700 Ga0105240_10209141
701 Ga0111539_10423514
702 Ga0105245_10363798
703 Ga0105247_10047738
704 Ga0105243_10001240
705 Ga0105243_10022977
706 Ga0105243_10118756
707 Ga0105241_10067363
708 Ga0105242_10194341
709 Ga0105242_10207958
710 Ga0105248_10006273
711 Ga0105248_10024158
712 Ga0105248_10047429
713 Ga0105248_10102510
714 Ga0105248_10247246
715 Ga0105237_10586999
716 Ga0105238_10216528
717 Ga0105238_10260369
718 Ga0105249_10008506
719 Ga0105249_10257469
720 Ga0105239_10146529
721 Ga0157373_10030122
722 Ga0157369_10188410
723 Ga0157374_10345981
724 Ga0163162_10007061
725 Ga0163162_10039424
726 Ga0163162_10069032
727 Ga0163162_10487707
728 Ga0157372_10267700
729 Ga0157375_10079578
730 Ga0157375_10108585
731 Ga0157375_10184820
732 Ga0157375_10869704
733 Ga0163163_10104206
734 Ga0163163_10335187
735 Ga0157380_10033970
736 Ga0157380_10071692
737 Ga0157380_10103460
738 Ga0157377_10000010
739 Ga0157377_10002392
740 Ga0157379_10008733
741 Ga0157379_10008941
742 Ga0157379_10016132
743 Ga0157379_10021355
744 Ga0157376_10077274
745 Ga0157376_10189434
746 Ga0163161_10084417
747 Ga0163161_10094822
748 Ga0209674_100003
749 Ga0209563_100010
750 Ga0207427_100869
751 Ga0209258_100267
752 Ga0207425_1000328
753 Ga0209677_100068
754 Ga0209677_103116
755 Ga0209759_1000847
756 Ga0209759_1001246
757 Ga0209759_1002289
758 Ga0209759_1011814
759 Ga0209129_1000035
760 Ga0209565_1014805
761 Ga0209455_1000158
762 Ga0209673_1003283
763 Ga0209675_1011720
764 Ga0209564_1000024
765 Ga0209758_1000066
766 Ga0209758_1000213
767 Ga0209050_1000178
768 Ga0209050_1004228
769 Ga0209050_1004728
770 Ga0209256_1000011
771 Ga0209051_1000016
772 Ga0209051_1009600
773 Ga0209257_1000032
774 Ga0209257_1000510
775 Ga0209257_1017020
776 Ga0207697_10082366
777 Ga0207682_10048335
778 Ga0207642_10038849
779 Ga0207688_10081050
780 Ga0207680_10014016
781 Ga0207647_10137730
782 Ga0207685_10033492
783 Ga0207645_10016926
784 Ga0207645_10108134
785 Ga0207705_10237955
786 Ga0207695_10055277
787 Ga0207695_10117379
788 Ga0207695_10437014
789 Ga0207671_10001444
790 Ga0207660_10008400
791 Ga0207657_10022586
792 Ga0207649_10005583
793 Ga0207649_10160956
794 Ga0207652_10033780
795 Ga0207681_10004364
796 Ga0207681_10022723
797 Ga0207681_10063833
798 Ga0207694_10091166
799 Ga0207694_10096331
800 Ga0207650_10001175
801 Ga0207650_10092072
802 Ga0207659_10001653
803 Ga0207659_10004285
804 Ga0207659_10007056
805 Ga0207644_10006285
806 Ga0207644_10143772
807 Ga0207690_10007581
808 Ga0207690_10041443
809 Ga0207690_10045373
810 Ga0207690_10082677
811 Ga0207706_10007806
812 Ga0207706_10021986
813 Ga0207706_10030321
814 Ga0207706_10191472
815 Ga0207686_10152492
816 Ga0207686_10288811
817 Ga0207709_10001721
818 Ga0207709_10031240
819 Ga0207709_10059906
820 Ga0207670_10008723
821 Ga0207669_10025495
822 Ga0207669_10111422
823 Ga0207669_10123838
824 Ga0207669_10227133
825 Ga0207691_10070596
826 Ga0207691_10082895
827 Ga0207711_10044076
828 Ga0207711_10065978
829 Ga0207711_10113253
830 Ga0207711_10176853
831 Ga0207689_10007748
832 Ga0207689_10018156
833 Ga0207689_10043151
834 Ga0207689_10140581
835 Ga0207661_10059056
836 Ga0207679_10007653
837 Ga0207679_10011113
838 Ga0207679_10168631
839 Ga0207679_10238516
840 Ga0207667_10005517
841 Ga0207667_10343829
842 Ga0207651_10015996
843 Ga0207651_10270416
844 Ga0207712_10019737
845 Ga0207668_10017174
846 Ga0207668_10030692
847 Ga0207640_10039484
848 Ga0207658_10000458
849 Ga0207658_10114517
850 Ga0207677_10006505
851 Ga0207677_10067696
852 Ga0207677_10127528
853 Ga0207677_10137769
854 Ga0207703_10004646
855 Ga0207703_10016146
856 Ga0207703_10021127
857 Ga0207703_10081579
858 Ga0207639_10010143
859 Ga0207639_10107749
860 Ga0207678_10000924
861 Ga0207678_10078251
862 Ga0207708_10023923
863 Ga0207702_10013557
864 Ga0207702_10253805
865 Ga0207641_10012454
866 Ga0207641_10104424
867 Ga0207641_10169855
868 Ga0207648_10000037
869 Ga0207676_10000221
870 Ga0207676_10009712
871 Ga0207676_10036213
872 Ga0207676_10076456
873 Ga0207676_10459123
874 Ga0207674_10033930
875 Ga0207674_10227592
876 Ga0207674_10255040
877 Ga0207675_100001459
878 Ga0207675_100008112
879 Ga0207683_10025002
880 Ga0207683_10128341
881 Ga0207683_10191247
882 Ga0207698_10006139
883 Ga0207698_10045436
884 Ga0209281_1000104
885 Ga0209974_10002408
886 Ga0268266_10220107
887 Ga0268265_10200089
888 Ga0268265_10284748
889 Ga0268264_10000963
890 Ga0268264_10037911
891 Ga0307515_10005576
892 Ga0307515_10013844
893 Ga0307515_10054018
894 Ga0307515_10066151
895 Ga0307515_10174440
896 Ga0265324_10000232
897 Ga0307512_10060993
898 Ga0265332_10000030
899 Ga0265328_10008511
900 Ga0265331_10007217
901 Ga0265327_10026013
902 Ga0265316_10000180
903 Ga0307513_10026447
904 Ga0307513_10164049
905 Ga0307408_100000056
906 Ga0307408_100098777
907 Ga0307508_10000142
908 Ga0307514_10025162
909 Ga0307516_10000517
910 Ga0307516_10007360
911 Ga0307516_10217260
912 Ga0307413_10219676
913 Ga0307410_10271308
914 Ga0307412_10236148
915 Ga0307409_100006655
916 Ga0307416_100019732
917 Ga0307416_100073360
918 Ga0307414_10006110
919 Ga0307411_10000184
920 Ga0307411_10004105
921 Ga0307415_100042363
922 Ga0307507_10141672
923 Ga0373959_0021180
924 Ga0373939_0000063
925 Ga0373945_0087807
926 Ga0373960_0000294
927 Ga0373960_0005051
928 Ga0373946_0034374
929 Ga0373931_0000870
930 Ga0373931_0003270
931 Ga0373931_0094987
932 Ga0373927_0043918
933 Ga0373947_0113054
934 Ga0373937_0123177
935 Ga0373937_0190646
936 Ga0395905_0001528
937 Ga0395905_0004284
938 Ga0395905_0012063
939 Ga0395905_0053882
940 Ga0395905_0265972
941 Ga0436361_0050220
942 Ga0436363_1083478
943 Ga0451793_1867563
944 Ga0451853_2247177
945 Ga0439437_000891
946 Ga0439455_0008313
947 Ga0450888_000764
948 Ga0450891_000139
949 Ga0450892_000941
950 Ga0450899_005450
951 Ga0439464_0001824
952 Ga0451577_0216782
953 Ga0466969_0000157
954 Ga0466969_0037501
955 Ga0466972_0010902
956 Ga0466965_0003866
957 Ga0466965_0083787
958 Ga0466966_0010737
959 Ga0466966_0015258
960 Ga0466961_0061275
961 Ga0453684_0008823
962 Ga0466971_0011291
963 Ga0466971_0040395
964 Ga0466968_0082237
965 Ga0466970_0007109
966 Ga0466960_0070087
967 Ga0466959_0011523
968 Ga0466959_0075544
969 Ga0466959_0085138
970 Ga0451576_0001435
971 Ga0451576_0032586
972 Ga0451576_0081201
973 Ga0451576_0167851
974 Ga0466958_0028498
975 Ga0495590_0003984
976 Ga0495629_0060333
977 Ga0495638_0049107
978 Ga0495650_0000329
979 Ga0495639_0017217
980 Ga0495585_0008761
981 Ga0495607_0128902
982 Ga0495583_0000628
983 Ga0495606_0000001
984 Ga0495606_0001339
985 Ga0495610_0001848
986 Ga0495610_0016504
987 Ga0495620_0035573
988 Ga0495632_0003423
989 Ga0495632_0019378
990 Ga0495643_0042463
991 Ga0495648_0057782
992 Ga0495621_0000904
993 Ga0495645_0061193
994 Ga0495668_0000474
995 Ga0495668_0033330
996 Ga0495625_0003318
997 Ga0495647_0006716
998 Ga0495647_0018493
999 Ga0495658_0006191
1000 Ga0495670_0078754
1001 Ga0495649_0000386
1002 Ga0495589_0019325
1003 Ga0495600_0060720
1004 Ga0495684_0092413
1005 Ga0495686_0005405
1006 Ga0496100_0051032
1007 Ga0496101_0052358
1008 Ga0496101_0291367
1009 Ga0496102_0007022
1010 Ga0496102_0008369
1011 Ga0496102_0518629
1012 Ga0496104_0002996
1013 Ga0496104_0031621
1014 Ga0496105_0019359
1015 Ga0496105_0079723
1016 Ga0496105_0087831
1017 Ga0496108_0056190
1018 Ga0496108_0147745
1019 Ga0496108_0195435
1020 Ga0496110_0078442
1021 Ga0496110_0359809
1022 Ga0496112_0109434
1023 Ga0496113_0038115
1024 Ga0496113_0080078
1025 Ga0496114_0015736
1026 Ga0496114_0103021
1027 Ga0496114_0137482
1028 Ga0496114_0408678
1029 Ga0496115_0003633
1030 Ga0496124_0073642
1031 Ga0501309_004053
1032 Ga0501310_002776
1033 Ga0501310_010318
1034 Ga0501305_005422
1035 Ga0501311_002816
1036 Ga0501043_0000024
1037 Ga0501046_0000173
1038 Ga0501047_0000051
1039 Ga0501048_0005127
1040 Ga0501198_000003
1041 Ga0501222_000001
1042 Ga0501222_000413
1043 Ga0501233_006681
1044 Ga0501235_014643
1045 Ga0501249_002043
1046 Ga0501221_001265
1047 Ga0501262_001963
1048 Ga0501268_023687
1049 Ga0501045_0083239
1050 nmdc:mga0k408_31648_c1
1051 nmdc:mga0k408_36237_c1
1052 nmdc:mga0k408_4394_c2
1053 nmdc:mga0k408_54126_c1
1054 nmdc:mga0k408_54981_c1
1055 nmdc:mga0k408_93357_c1
1056 nmdc:mga07m45_23934_c1
1057 nmdc:mga09592_1348_c1
1058 nmdc:mga0qj67_16850_c1
1059 nmdc:mga0qj67_337087_c1
1060 nmdc:mga08y16_274380_c1
1061 nmdc:mga08y16_439885_c1
1062 Ga0500635_0000330
1063 Ga0495619_0055920
1064 Ga0500578_0000182
1065 Ga0500646_0007684
1066 Ga0500583_0057760
1067 Ga0500651_0004839
1068 Ga0500650_0013775
1069 Ga0500593_016373
1070 Ga0500642_0066834
1071 Ga0500652_000309
1072 Ga0500655_005748
1073 Ga0500577_0007374
1074 Ga0500590_004896
1075 Ga0500619_000134
1076 Ga0500622_0001582
1077 Ga0500636_0059034
1078 Ga0466962_0022161
1079 2548848492
1080 2587729101
1081 2587733676
1082 2587759083
1083 2588294061
1084 2643746038
1085 2643937003
1086 2643967162
1087 2644139993
1088 2644218031
1089 2644258228
1090 2644271233
1091 2644318168
1092 2644339643
1093 2739057166
1094 2891633833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

86

341

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9057 39 343
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.8983 39 346
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.8921 39 343
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.8745 39 346
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.86 40 334
ID Description Score Start End Superfamily
1sbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9878 39 311 3.40.190.10
1sbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9749 39 311 3.40.190.10
1sbpA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9532 132 343 3.40.190.10
1sbpA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9415 132 343 3.40.190.10
af_P16700_28_100_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9375 42 113 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4Q3N7M7-F1-model_v4 deleted 0.9875 109 342
AF-A0A833GVX5-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9873 53 342 GO:0042597
GO:1902358
AF-A0A5E7VYV4-F1-model_v4 Sulfate-binding protein 0.9805 36 342 GO:0042597
GO:1902358
AF-A0A7U7FUM0-F1-model_v4 deleted 0.9767 42 342
AF-W0V128-F1-model_v4 Sulfate ABC transporter, sulfate-binding family protein 0.9736 42 344 GO:0042597
GO:1902358

Map