F462163

General Info

Members Datasets Scaffolds Average Seq Length
547 226 547 324

Family's Representative Sequence

Representative Sequence 3300053078|Ga0495612_0031181|Ga0495612_0031181_136_1170
Length 331
Sequence MRLKHAAPALIAPQDVRPRGSLWRHAGVRILLACLALAPVAALAADDYPTRSIKVVVPFSPGGAVDGPMRLIAQELTKRLGQSVFVENKPGAGATIGAEAVAKAPPDGYTLLLASQTNAISASLYPRLSFDPIDDFAPISLIGREPGVVVVNPSLPVHTLQELIAYVKARPGQIDYASSGNGSGQHLFAAMLCSMTGMKLNHVPYRGSAQATTDLIGGQVALSIPGIAGMLGHIRGGKLRALAVTGAKRAVPGYTAYVWMGLLAPKNTPPGIVDKLYKAVVQVLAEDEVKRYMAQASIEAVGSTPAEFGAYFRAEKEQWARIIRETGARVD

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
191 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.66
Rhizosphere 96.16
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10206623 3300005293 Bacteria 1334
2 Ga0065707_10094921 3300005295 Bacteria 3436
3 Ga0070658_10087120 3300005327 Bacteria 2569
4 Ga0070658_10492551 3300005327 Bacteria 1058
5 Ga0070676_10021732 3300005328 Bacteria 3593
6 Ga0070676_10040173 3300005328 Bacteria 2708
7 Ga0070676_10070236 3300005328 Bacteria 2100
8 Ga0070683_100002563 3300005329 Bacteria 14523
9 Ga0070670_100000384 3300005331 Bacteria 36688
10 Ga0070670_100016030 3300005331 Bacteria 6431
11 Ga0070670_100049788 3300005331 Bacteria 3601
12 Ga0070670_100108304 3300005331 Bacteria 2394
13 Ga0070670_100212618 3300005331 Bacteria 1681
14 Ga0070677_10026075 3300005333 Bacteria 2188
15 Ga0068869_100019722 3300005334 Bacteria 4613
16 Ga0068869_100020355 3300005334 Bacteria 4549
17 Ga0068869_100333164 3300005334 Bacteria 1233
18 Ga0070666_10025957 3300005335 Bacteria 3823
19 Ga0070666_10037000 3300005335 Bacteria 3243
20 Ga0070666_10168215 3300005335 Bacteria 1534
21 Ga0070680_100029253 3300005336 Bacteria 4425
22 Ga0070680_100085561 3300005336 Bacteria 2605
23 Ga0070680_100112325 3300005336 Bacteria 2269
24 Ga0070682_100047856 3300005337 Bacteria 2660
25 Ga0068868_100102677 3300005338 Bacteria 2315
26 Ga0068868_100137499 3300005338 Bacteria 2004
27 Ga0068868_100188603 3300005338 Bacteria 1714
28 Ga0070660_100000694 3300005339 Bacteria 22304
29 Ga0070660_100031339 3300005339 Bacteria 3992
30 Ga0070660_100125807 3300005339 Bacteria 2048
31 Ga0070689_100001272 3300005340 Bacteria 16034
32 Ga0070689_100098915 3300005340 Bacteria 2308
33 Ga0070687_100011963 3300005343 Bacteria 3814
34 Ga0070661_100000392 3300005344 Bacteria 33974
35 Ga0070661_100000400 3300005344 Bacteria 33614
36 Ga0070661_100009969 3300005344 Bacteria 6591
37 Ga0070661_100019148 3300005344 Bacteria 4874
38 Ga0070661_100084907 3300005344 Bacteria 2339
39 Ga0070668_100003233 3300005347 Bacteria 12007
40 Ga0070668_100011291 3300005347 Bacteria 6653
41 Ga0070668_100020847 3300005347 Bacteria 4951
42 Ga0070668_100058057 3300005347 Bacteria 2993
43 Ga0070668_100185981 3300005347 Bacteria 1699
44 Ga0070669_100012571 3300005353 Bacteria 6004
45 Ga0070675_100008345 3300005354 Bacteria 8037
46 Ga0070675_100089427 3300005354 Bacteria 2578
47 Ga0070675_100135518 3300005354 Bacteria 2101
48 Ga0070675_100189340 3300005354 Bacteria 1782
49 Ga0070671_100014722 3300005355 Bacteria 6323
50 Ga0070671_100015481 3300005355 Bacteria 6163
51 Ga0070671_100066182 3300005355 Bacteria 3011
52 Ga0070671_100337960 3300005355 Bacteria 1284
53 Ga0070674_100020718 3300005356 Bacteria 4208
54 Ga0070674_100021516 3300005356 Bacteria 4143
55 Ga0070674_100021707 3300005356 Bacteria 4128
56 Ga0070674_100169895 3300005356 Bacteria 1661
57 Ga0070674_100267688 3300005356 Bacteria 1349
58 Ga0070673_100000879 3300005364 Bacteria 16944
59 Ga0070673_100077314 3300005364 Bacteria 2689
60 Ga0070688_100015322 3300005365 Bacteria 4360
61 Ga0070659_100026600 3300005366 Bacteria 4453
62 Ga0070659_100044644 3300005366 Bacteria 3470
63 Ga0070659_100417982 3300005366 Bacteria 1134
64 Ga0070667_100001054 3300005367 Bacteria 25192
65 Ga0070667_100133003 3300005367 Bacteria 2172
66 Ga0070667_100218196 3300005367 Bacteria 1697
67 Ga0070667_100287408 3300005367 Bacteria 1478
68 Ga0070709_10004626 3300005434 Bacteria 7432
69 Ga0070709_10051886 3300005434 Bacteria 2575
70 Ga0070714_100028382 3300005435 Bacteria 4642
71 Ga0070714_100040738 3300005435 Bacteria 3916
72 Ga0070713_100097999 3300005436 Bacteria 2534
73 Ga0070713_100172805 3300005436 Bacteria 1937
74 Ga0070713_100224156 3300005436 Bacteria 1706
75 Ga0070711_100010142 3300005439 Bacteria 5819
76 Ga0070705_100071601 3300005440 Bacteria 2097
77 Ga0070700_100005655 3300005441 Bacteria 6633
78 Ga0070663_100002270 3300005455 Bacteria 10760
79 Ga0070663_100036967 3300005455 Bacteria 3396
80 Ga0070663_100061947 3300005455 Bacteria 2695
81 Ga0070663_100083033 3300005455 Bacteria 2358
82 Ga0070678_100004896 3300005456 Bacteria 7658
83 Ga0070678_100018636 3300005456 Bacteria 4503
84 Ga0070678_100086053 3300005456 Bacteria 2397
85 Ga0070678_100141949 3300005456 Bacteria 1923
86 Ga0070678_100236512 3300005456 Bacteria 1525
87 Ga0070662_100000108 3300005457 Bacteria 45797
88 Ga0070662_100162144 3300005457 Bacteria 1749
89 Ga0070681_10121111 3300005458 Bacteria 2551
90 Ga0070681_10177575 3300005458 Bacteria 2051
91 Ga0070681_10269495 3300005458 Bacteria 1614
92 Ga0068867_100008070 3300005459 Bacteria 7439
93 Ga0068867_100031311 3300005459 Bacteria 3840
94 Ga0068867_100093768 3300005459 Bacteria 2282
95 Ga0068867_100202126 3300005459 Bacteria 1591
96 Ga0068867_100255846 3300005459 Bacteria 1426
97 Ga0070685_10002619 3300005466 Bacteria 9215
98 Ga0070706_100032853 3300005467 Bacteria 4787
99 Ga0070706_100135859 3300005467 Bacteria 2295
100 Ga0070707_100080946 3300005468 Bacteria 3135
101 Ga0070707_100187130 3300005468 Bacteria 2019
102 Ga0070698_100063588 3300005471 Bacteria 3721
103 Ga0070699_100006642 3300005518 Bacteria 10056
104 Ga0070699_100017563 3300005518 Bacteria 6142
105 Ga0070679_100025119 3300005530 Bacteria 5843
106 Ga0070679_100031053 3300005530 Bacteria 5277
107 Ga0070679_100066820 3300005530 Bacteria 3585
108 Ga0070679_100359779 3300005530 Bacteria 1403
109 Ga0070684_100002032 3300005535 Bacteria 14890
110 Ga0070684_100002097 3300005535 Bacteria 14680
111 Ga0070684_100008260 3300005535 Bacteria 8138
112 Ga0070684_100039058 3300005535 Bacteria 4081
113 Ga0070684_100087560 3300005535 Bacteria 2765
114 Ga0070697_100061762 3300005536 Bacteria 3056
115 Ga0068853_100001634 3300005539 Bacteria 16388
116 Ga0068853_100017860 3300005539 Bacteria 5860
117 Ga0068853_100068251 3300005539 Bacteria 3090
118 Ga0068853_100144952 3300005539 Bacteria 2134
119 Ga0068853_100306768 3300005539 Bacteria 1468
120 Ga0068853_100413335 3300005539 Bacteria 1264
121 Ga0068853_100537544 3300005539 Bacteria 1106
122 Ga0070672_100000285 3300005543 Bacteria 28794
123 Ga0070672_100248332 3300005543 Bacteria 1498
124 Ga0070686_100047159 3300005544 Bacteria 2723
125 Ga0070695_100110517 3300005545 Bacteria 1864
126 Ga0070696_100075939 3300005546 Bacteria 2371
127 Ga0070696_100158952 3300005546 Bacteria 1664
128 Ga0070665_100081544 3300005548 Bacteria 3241
129 Ga0070665_100441651 3300005548 Bacteria 1310
130 Ga0070704_100252382 3300005549 Bacteria 1449
131 Ga0068855_100002112 3300005563 Bacteria 24586
132 Ga0068855_100046681 3300005563 Bacteria 5119
133 Ga0068855_100098715 3300005563 Bacteria 3364
134 Ga0068855_100105872 3300005563 Bacteria 3234
135 Ga0070664_100001288 3300005564 Bacteria 20064
136 Ga0070664_100008263 3300005564 Bacteria 8419
137 Ga0070664_100032418 3300005564 Bacteria 4370
138 Ga0070664_100060714 3300005564 Bacteria 3220
139 Ga0070664_100085308 3300005564 Bacteria 2727
140 Ga0070664_100177395 3300005564 Bacteria 1892
141 Ga0070664_100223906 3300005564 Bacteria 1684
142 Ga0068857_100000227 3300005577 Bacteria 37461
143 Ga0068857_100003129 3300005577 Bacteria 13692
144 Ga0068857_100050904 3300005577 Bacteria 3674
145 Ga0068857_100230810 3300005577 Bacteria 1693
146 Ga0068857_100311403 3300005577 Bacteria 1452
147 Ga0068857_100407176 3300005577 Bacteria 1266
148 Ga0068854_100022124 3300005578 Bacteria 4325
149 Ga0068854_100048787 3300005578 Bacteria 3022
150 Ga0068854_100109081 3300005578 Bacteria 2085
151 Ga0068854_100265308 3300005578 Bacteria 1376
152 Ga0068856_100000818 3300005614 Bacteria 33516
153 Ga0068856_100008383 3300005614 Bacteria 10072
154 Ga0068856_100010196 3300005614 Bacteria 9135
155 Ga0068856_100018772 3300005614 Bacteria 6706
156 Ga0068856_100234007 3300005614 Bacteria 1852
157 Ga0070702_100037446 3300005615 Bacteria 2694
158 Ga0068852_100022286 3300005616 Bacteria 5078
159 Ga0068852_100035483 3300005616 Bacteria 4161
160 Ga0068852_100054207 3300005616 Bacteria 3455
161 Ga0068852_100370152 3300005616 Bacteria 1404
162 Ga0068859_100046449 3300005617 Bacteria 4361
163 Ga0068859_100054180 3300005617 Bacteria 4033
164 Ga0068859_100286393 3300005617 Bacteria 1740
165 Ga0068859_100458688 3300005617 Bacteria 1370
166 Ga0068864_100000811 3300005618 Bacteria 26286
167 Ga0068864_100002245 3300005618 Bacteria 15975
168 Ga0068866_10108975 3300005718 Bacteria 1541
169 Ga0068861_100014463 3300005719 Bacteria 5540
170 Ga0068861_100081667 3300005719 Bacteria 2531
171 Ga0068861_100220844 3300005719 Bacteria 1602
172 Ga0068851_10003492 3300005834 Bacteria 7001
173 Ga0068851_10006219 3300005834 Bacteria 5448
174 Ga0068870_10009717 3300005840 Bacteria 4385
175 Ga0068870_10019757 3300005840 Bacteria 3272
176 Ga0068863_100008166 3300005841 Bacteria 10224
177 Ga0068863_100030992 3300005841 Bacteria 5106
178 Ga0068863_100040190 3300005841 Bacteria 4448
179 Ga0068863_100047823 3300005841 Bacteria 4057
180 Ga0068863_100049726 3300005841 Bacteria 3975
181 Ga0068863_100082149 3300005841 Bacteria 3053
182 Ga0068863_100268308 3300005841 Bacteria 1651
183 Ga0068858_100014291 3300005842 Bacteria 7486
184 Ga0068860_100022229 3300005843 Bacteria 6139
185 Ga0068860_100034549 3300005843 Bacteria 4851
186 Ga0068860_100175288 3300005843 Bacteria 2072
187 Ga0068860_100205565 3300005843 Bacteria 1909
188 Ga0068860_100220359 3300005843 Bacteria 1842
189 Ga0068862_100002238 3300005844 Bacteria 17341
190 Ga0068862_100007647 3300005844 Bacteria 8945
191 Ga0068862_100017622 3300005844 Bacteria 5946
192 Ga0068862_100041591 3300005844 Bacteria 3911
193 Ga0068862_100072094 3300005844 Bacteria 2983
194 Ga0068862_100131754 3300005844 Bacteria 2212
195 Ga0081539_10015143 3300005985 Bacteria 5635
196 Ga0070712_100139945 3300006175 Bacteria 1845
197 Ga0097621_100030022 3300006237 Bacteria 4300
198 Ga0068871_100117420 3300006358 Bacteria 2244
199 Ga0068871_100292744 3300006358 Bacteria 1427
200 Ga0068871_100293853 3300006358 Bacteria 1424
201 Ga0075433_10067907 3300006852 Bacteria 3129
202 Ga0075434_100064619 3300006871 Bacteria 3644
203 Ga0068865_100040601 3300006881 Bacteria 3163
204 Ga0068865_100119942 3300006881 Bacteria 1954
205 Ga0097620_100046449 3300006931 Bacteria 4361
206 Ga0097620_100054180 3300006931 Bacteria 4033
207 Ga0097620_100286394 3300006931 Bacteria 1740
208 Ga0097620_100458713 3300006931 Bacteria 1370
209 Ga0075435_100004323 3300007076 Bacteria 9765
210 Ga0105240_10033512 3300009093 Bacteria 6635
211 Ga0105240_10047967 3300009093 Bacteria 5401
212 Ga0105240_10102492 3300009093 Bacteria 3478
213 Ga0105240_10291278 3300009093 Bacteria 1871
214 Ga0111539_10035560 3300009094 Bacteria 6030
215 Ga0105245_10117666 3300009098 Bacteria 2479
216 Ga0114129_10048102 3300009147 Bacteria 5992
217 Ga0105243_10061452 3300009148 Bacteria 3004
218 Ga0105241_10001315 3300009174 Bacteria 18872
219 Ga0105241_10049560 3300009174 Bacteria 3199
220 Ga0105241_10065449 3300009174 Bacteria 2809
221 Ga0105242_10008308 3300009176 Bacteria 7975
222 Ga0105242_10059498 3300009176 Bacteria 3135
223 Ga0105242_10232793 3300009176 Bacteria 1652
224 Ga0105248_10001895 3300009177 Bacteria 23186
225 Ga0105248_10104542 3300009177 Bacteria 3193
226 Ga0105237_10014672 3300009545 Bacteria 8182
227 Ga0105237_10606181 3300009545 Bacteria 1102
228 Ga0105238_10007960 3300009551 Bacteria 10605
229 Ga0105238_10263418 3300009551 Bacteria 1704
230 Ga0105249_10030152 3300009553 Bacteria 4901
231 Ga0105239_10308434 3300010375 Bacteria 1783
232 Ga0105239_10358356 3300010375 Bacteria 1647
233 Ga0157373_10004666 3300013100 Bacteria 10310
234 Ga0157373_10008273 3300013100 Bacteria 7731
235 Ga0157373_10122555 3300013100 Bacteria 1827
236 Ga0157371_10001582 3300013102 Bacteria 23372
237 Ga0157371_10029358 3300013102 Bacteria 3978
238 Ga0157370_10037320 3300013104 Bacteria 4711
239 Ga0157370_10045674 3300013104 Bacteria 4201
240 Ga0157370_10070028 3300013104 Bacteria 3312
241 Ga0157370_10097429 3300013104 Bacteria 2759
242 Ga0157369_10040229 3300013105 Bacteria 5104
243 Ga0157369_10079287 3300013105 Bacteria 3517
244 Ga0157369_10091901 3300013105 Bacteria 3239
245 Ga0157369_10230387 3300013105 Bacteria 1937
246 Ga0157374_10016561 3300013296 Bacteria 6482
247 Ga0157374_10511644 3300013296 Bacteria 1206
248 Ga0157378_10005774 3300013297 Bacteria 10842
249 Ga0157378_10048997 3300013297 Bacteria 3758
250 Ga0157378_10099146 3300013297 Bacteria 2658
251 Ga0157372_10000713 3300013307 Bacteria 36525
252 Ga0157372_10009175 3300013307 Bacteria 10513
253 Ga0157372_10067361 3300013307 Bacteria 4023
254 Ga0157372_10078185 3300013307 Bacteria 3738
255 Ga0157372_10078262 3300013307 Bacteria 3736
256 Ga0157372_10098417 3300013307 Bacteria 3337
257 Ga0157372_10104013 3300013307 Bacteria 3245
258 Ga0157372_10132273 3300013307 Bacteria 2871
259 Ga0157372_10229684 3300013307 Bacteria 2151
260 Ga0157375_10004850 3300013308 Bacteria 11687
261 Ga0157375_10042494 3300013308 Bacteria 4399
262 Ga0157375_10105841 3300013308 Bacteria 2904
263 Ga0157375_10140378 3300013308 Bacteria 2543
264 Ga0157375_10247068 3300013308 Bacteria 1945
265 Ga0163163_10003586 3300014325 Bacteria 13189
266 Ga0163163_10265601 3300014325 Bacteria 1767
267 Ga0163163_10449486 3300014325 Bacteria 1349
268 Ga0157380_10187321 3300014326 Bacteria 1824
269 Ga0182008_10070035 3300014497 Bacteria 1725
270 Ga0157377_10027307 3300014745 Bacteria 3064
271 Ga0157379_10000212 3300014968 Bacteria 45147
272 Ga0157379_10125506 3300014968 Bacteria 2309
273 Ga0163161_10189701 3300017792 Bacteria 1579
274 Ga0206356_11894257 3300020070 Bacteria 2249
275 Ga0207697_10000294 3300025315 Bacteria 27868
276 Ga0207697_10086639 3300025315 Bacteria 1324
277 Ga0207682_10001359 3300025893 Bacteria 11300
278 Ga0207682_10094606 3300025893 Bacteria 1300
279 Ga0207642_10096282 3300025899 Bacteria 1475
280 Ga0207688_10000560 3300025901 Bacteria 18162
281 Ga0207688_10097619 3300025901 Bacteria 1693
282 Ga0207680_10025546 3300025903 Bacteria 3259
283 Ga0207680_10116877 3300025903 Bacteria 1739
284 Ga0207680_10154873 3300025903 Bacteria 1531
285 Ga0207645_10001322 3300025907 Bacteria 20361
286 Ga0207645_10003614 3300025907 Bacteria 11699
287 Ga0207645_10054143 3300025907 Bacteria 2563
288 Ga0207645_10082952 3300025907 Bacteria 2055
289 Ga0207643_10001280 3300025908 Bacteria 14686
290 Ga0207643_10011549 3300025908 Bacteria 4770
291 Ga0207643_10013975 3300025908 Bacteria 4355
292 Ga0207705_10035614 3300025909 Bacteria 3561
293 Ga0207705_10089575 3300025909 Bacteria 2252
294 Ga0207705_10137666 3300025909 Bacteria 1821
295 Ga0207684_10074451 3300025910 Bacteria 2885
296 Ga0207684_10435274 3300025910 Bacteria 1126
297 Ga0207654_10086673 3300025911 Bacteria 1899
298 Ga0207707_10008980 3300025912 Bacteria 8682
299 Ga0207707_10017735 3300025912 Bacteria 6211
300 Ga0207707_10041031 3300025912 Bacteria 4041
301 Ga0207707_10257351 3300025912 Bacteria 1515
302 Ga0207695_10036276 3300025913 Bacteria 5332
303 Ga0207695_10116075 3300025913 Bacteria 2651
304 Ga0207671_10018151 3300025914 Bacteria 5405
305 Ga0207671_10208030 3300025914 Bacteria 1530
306 Ga0207693_10054932 3300025915 Bacteria 3124
307 Ga0207663_10049546 3300025916 Bacteria 2606
308 Ga0207660_10009828 3300025917 Bacteria 6193
309 Ga0207660_10078762 3300025917 Bacteria 2416
310 Ga0207660_10131710 3300025917 Bacteria 1904
311 Ga0207662_10001098 3300025918 Bacteria 12716
312 Ga0207657_10000142 3300025919 Bacteria 72309
313 Ga0207657_10000788 3300025919 Bacteria 33688
314 Ga0207657_10031718 3300025919 Bacteria 4781
315 Ga0207657_10039230 3300025919 Bacteria 4211
316 Ga0207657_10039325 3300025919 Bacteria 4205
317 Ga0207657_10112787 3300025919 Bacteria 2243
318 Ga0207649_10003419 3300025920 Bacteria 8681
319 Ga0207649_10009412 3300025920 Bacteria 5346
320 Ga0207649_10064368 3300025920 Bacteria 2318
321 Ga0207649_10161880 3300025920 Bacteria 1551
322 Ga0207649_10164939 3300025920 Bacteria 1538
323 Ga0207652_10019964 3300025921 Bacteria 5517
324 Ga0207652_10032722 3300025921 Bacteria 4374
325 Ga0207652_10054916 3300025921 Bacteria 3425
326 Ga0207652_10253117 3300025921 Bacteria 1588
327 Ga0207646_10006512 3300025922 Bacteria 12054
328 Ga0207646_10061803 3300025922 Bacteria 3343
329 Ga0207681_10048753 3300025923 Bacteria 2860
330 Ga0207694_10006593 3300025924 Bacteria 8821
331 Ga0207694_10174528 3300025924 Bacteria 1741
332 Ga0207650_10002177 3300025925 Bacteria 13684
333 Ga0207650_10013158 3300025925 Bacteria 5727
334 Ga0207650_10029342 3300025925 Bacteria 3954
335 Ga0207650_10157412 3300025925 Bacteria 1797
336 Ga0207650_10407185 3300025925 Bacteria 1127
337 Ga0207659_10028290 3300025926 Bacteria 3808
338 Ga0207659_10037456 3300025926 Bacteria 3368
339 Ga0207659_10048659 3300025926 Bacteria 3004
340 Ga0207659_10110870 3300025926 Bacteria 2086
341 Ga0207659_10147793 3300025926 Bacteria 1832
342 Ga0207687_10346322 3300025927 Bacteria 1209
343 Ga0207700_10000031 3300025928 Bacteria 130086
344 Ga0207700_10216321 3300025928 Bacteria 1622
345 Ga0207664_10005520 3300025929 Bacteria 8652
346 Ga0207664_10013214 3300025929 Bacteria 5916
347 Ga0207664_10020785 3300025929 Bacteria 4871
348 Ga0207664_10023637 3300025929 Bacteria 4608
349 Ga0207664_10152053 3300025929 Bacteria 1967
350 Ga0207644_10019000 3300025931 Bacteria 4659
351 Ga0207644_10025308 3300025931 Bacteria 4081
352 Ga0207644_10032991 3300025931 Bacteria 3616
353 Ga0207644_10111367 3300025931 Bacteria 2070
354 Ga0207690_10005110 3300025932 Bacteria 7749
355 Ga0207690_10043258 3300025932 Bacteria 2963
356 Ga0207690_10080238 3300025932 Bacteria 2277
357 Ga0207690_10128640 3300025932 Bacteria 1850
358 Ga0207690_10252010 3300025932 Bacteria 1364
359 Ga0207706_10000186 3300025933 Bacteria 69567
360 Ga0207706_10002261 3300025933 Bacteria 18804
361 Ga0207706_10036459 3300025933 Bacteria 4368
362 Ga0207706_10224348 3300025933 Bacteria 1645
363 Ga0207686_10020663 3300025934 Bacteria 3765
364 Ga0207709_10105424 3300025935 Bacteria 1873
365 Ga0207709_10232617 3300025935 Bacteria 1336
366 Ga0207670_10033661 3300025936 Bacteria 3304
367 Ga0207670_10218619 3300025936 Bacteria 1457
368 Ga0207669_10062314 3300025937 Bacteria 2296
369 Ga0207669_10147397 3300025937 Bacteria 1643
370 Ga0207669_10282043 3300025937 Bacteria 1253
371 Ga0207665_10009677 3300025939 Bacteria 6330
372 Ga0207691_10000024 3300025940 Bacteria 132111
373 Ga0207691_10001968 3300025940 Bacteria 20078
374 Ga0207691_10024939 3300025940 Bacteria 5619
375 Ga0207691_10063951 3300025940 Bacteria 3335
376 Ga0207691_10197457 3300025940 Bacteria 1752
377 Ga0207691_10240179 3300025940 Bacteria 1566
378 Ga0207711_10014198 3300025941 Bacteria 6616
379 Ga0207711_10227582 3300025941 Bacteria 1707
380 Ga0207689_10000066 3300025942 Bacteria 84063
381 Ga0207689_10009656 3300025942 Bacteria 8316
382 Ga0207689_10013126 3300025942 Bacteria 7070
383 Ga0207661_10034942 3300025944 Bacteria 3913
384 Ga0207661_10259095 3300025944 Bacteria 1549
385 Ga0207679_10004040 3300025945 Bacteria 9115
386 Ga0207679_10074299 3300025945 Bacteria 2575
387 Ga0207679_10178134 3300025945 Bacteria 1756
388 Ga0207667_10001802 3300025949 Bacteria 26992
389 Ga0207667_10011601 3300025949 Bacteria 10231
390 Ga0207667_10022825 3300025949 Bacteria 6901
391 Ga0207667_10087315 3300025949 Bacteria 3226
392 Ga0207667_10205588 3300025949 Bacteria 2019
393 Ga0207667_10207700 3300025949 Bacteria 2007
394 Ga0207667_10233145 3300025949 Bacteria 1884
395 Ga0207651_10070184 3300025960 Bacteria 2477
396 Ga0207651_10182213 3300025960 Bacteria 1667
397 Ga0207668_10019959 3300025972 Bacteria 4249
398 Ga0207668_10043196 3300025972 Bacteria 3057
399 Ga0207668_10060272 3300025972 Bacteria 2663
400 Ga0207668_10071731 3300025972 Bacteria 2475
401 Ga0207668_10139096 3300025972 Bacteria 1864
402 Ga0207668_10174669 3300025972 Bacteria 1688
403 Ga0207668_10321548 3300025972 Bacteria 1284
404 Ga0207640_10098148 3300025981 Bacteria 2047
405 Ga0207640_10099258 3300025981 Bacteria 2037
406 Ga0207658_10015608 3300025986 Bacteria 5212
407 Ga0207658_10035724 3300025986 Bacteria 3560
408 Ga0207658_10080830 3300025986 Bacteria 2490
409 Ga0207658_10091126 3300025986 Bacteria 2364
410 Ga0207658_10106923 3300025986 Bacteria 2204
411 Ga0207658_10149311 3300025986 Bacteria 1902
412 Ga0207677_10029684 3300026023 Bacteria 3479
413 Ga0207677_10052914 3300026023 Bacteria 2761
414 Ga0207677_10174013 3300026023 Bacteria 1687
415 Ga0207703_10000539 3300026035 Bacteria 38982
416 Ga0207703_10184520 3300026035 Bacteria 1843
417 Ga0207639_10006877 3300026041 Bacteria 7747
418 Ga0207639_10027652 3300026041 Bacteria 4134
419 Ga0207639_10152781 3300026041 Bacteria 1935
420 Ga0207639_10277136 3300026041 Bacteria 1474
421 Ga0207639_10346905 3300026041 Bacteria 1325
422 Ga0207678_10003125 3300026067 Bacteria 14987
423 Ga0207678_10005127 3300026067 Bacteria 11750
424 Ga0207678_10019164 3300026067 Bacteria 6007
425 Ga0207678_10081264 3300026067 Bacteria 2774
426 Ga0207678_10107082 3300026067 Bacteria 2384
427 Ga0207678_10114205 3300026067 Bacteria 2304
428 Ga0207678_10135909 3300026067 Bacteria 2098
429 Ga0207708_10003194 3300026075 Bacteria 12077
430 Ga0207702_10003786 3300026078 Bacteria 13650
431 Ga0207702_10061218 3300026078 Bacteria 3210
432 Ga0207702_10173709 3300026078 Bacteria 1978
433 Ga0207641_10105184 3300026088 Bacteria 2493
434 Ga0207648_10000390 3300026089 Bacteria 48543
435 Ga0207648_10028509 3300026089 Bacteria 4949
436 Ga0207648_10041289 3300026089 Bacteria 4051
437 Ga0207648_10046673 3300026089 Bacteria 3798
438 Ga0207648_10085349 3300026089 Bacteria 2754
439 Ga0207648_10112141 3300026089 Bacteria 2395
440 Ga0207648_10123945 3300026089 Bacteria 2273
441 Ga0207676_10047859 3300026095 Bacteria 3316
442 Ga0207676_10052364 3300026095 Bacteria 3190
443 Ga0207676_10073391 3300026095 Bacteria 2754
444 Ga0207674_10000593 3300026116 Bacteria 47678
445 Ga0207674_10000883 3300026116 Bacteria 39210
446 Ga0207674_10026116 3300026116 Bacteria 6213
447 Ga0207674_10077157 3300026116 Bacteria 3338
448 Ga0207675_100002297 3300026118 Bacteria 18984
449 Ga0207675_100015338 3300026118 Bacteria 7151
450 Ga0207675_100064462 3300026118 Bacteria 3424
451 Ga0207675_100321255 3300026118 Bacteria 1511
452 Ga0207683_10000789 3300026121 Bacteria 28884
453 Ga0207683_10008987 3300026121 Bacteria 8512
454 Ga0207683_10366046 3300026121 Bacteria 1324
455 Ga0207698_10009534 3300026142 Bacteria 6196
456 Ga0207698_10015850 3300026142 Bacteria 5063
457 Ga0207698_10125251 3300026142 Bacteria 2184
458 Ga0207698_10253198 3300026142 Bacteria 1613
459 Ga0207698_10316452 3300026142 Bacteria 1460
460 Ga0207698_10520967 3300026142 Bacteria 1160
461 Ga0209971_1003349 3300027682 Bacteria 3808
462 Ga0209974_10000914 3300027876 Bacteria 10295
463 Ga0207428_10065958 3300027907 Bacteria 2853
464 Ga0268266_10136667 3300028379 Bacteria 2196
465 Ga0268265_10007921 3300028380 Bacteria 7169
466 Ga0268265_10011203 3300028380 Bacteria 6061
467 Ga0268265_10012626 3300028380 Bacteria 5729
468 Ga0268265_10017902 3300028380 Bacteria 4900
469 Ga0268265_10026966 3300028380 Bacteria 4094
470 Ga0268264_10003765 3300028381 Bacteria 13013
471 Ga0268264_10115075 3300028381 Bacteria 2362
472 Ga0307515_10000093 3300028794 Bacteria 212053
473 Ga0307408_100049773 3300031548 Bacteria 3011
474 Ga0307413_10089523 3300031824 Bacteria 2000
475 Ga0307410_10274646 3300031852 Bacteria 1320
476 Ga0307407_10173669 3300031903 Bacteria 1422
477 Ga0307407_10276898 3300031903 Bacteria 1160
478 Ga0307412_10118227 3300031911 Bacteria 1904
479 Ga0307409_100044980 3300031995 Bacteria 3329
480 Ga0307409_100430480 3300031995 Bacteria 1268
481 Ga0307416_100007029 3300032002 Bacteria 7103
482 Ga0307416_100117558 3300032002 Bacteria 2361
483 Ga0307416_100183690 3300032002 Bacteria 1963
484 Ga0307414_10046915 3300032004 Bacteria 2970
485 Ga0307411_10467263 3300032005 Bacteria 1059
486 Ga0373954_0040711 3300035118 Bacteria 2165
487 Ga0373956_0060606 3300035119 Bacteria 1714
488 Ga0373943_0093591 3300035170 Bacteria 1560
489 Ga0373955_0204960 3300035172 Bacteria 1175
490 Ga0373931_0094133 3300035691 Bacteria 1674
491 Ga0373931_0190525 3300035691 Bacteria 1220
492 Ga0373927_0004115 3300035695 Bacteria 10239
493 Ga0373927_0038465 3300035695 Bacteria 3106
494 Ga0373927_0040758 3300035695 Bacteria 3013
495 Ga0373937_0067371 3300036401 Bacteria 3298
496 Ga0373937_0140368 3300036401 Bacteria 2260
497 Ga0373925_0024573 3300037068 Bacteria 4399
498 Ga0373925_0440555 3300037068 Bacteria 1066
499 Ga0395905_0304032 3300037471 Bacteria 1483
500 Ga0395901_0275869 3300038443 Bacteria 1748
501 Ga0242420_010569 3300038996 Bacteria 1536
502 Ga0439460_0011700 3300042461 Bacteria 2267
503 Ga0451577_0159977 3300042876 Bacteria 2028
504 Ga0451577_0281921 3300042876 Bacteria 1505
505 Ga0466963_0062383 3300044694 Bacteria 2493
506 Ga0453684_0019411 3300044712 Bacteria 10353
507 Ga0453684_0414995 3300044712 Bacteria 1505
508 Ga0451576_0003170 3300045051 Bacteria 22980
509 Ga0495580_0081441 3300046472 Bacteria 2256
510 Ga0495645_0050652 3300046543 Bacteria 3023
511 Ga0495647_0027975 3300046681 Bacteria 2076
512 Ga0496100_0114147 3300048903 Bacteria 1881
513 Ga0496101_0067887 3300048904 Bacteria 2605
514 Ga0496101_0242641 3300048904 Bacteria 1402
515 Ga0496102_0002372 3300048905 Bacteria 16070
516 Ga0496102_0012667 3300048905 Bacteria 7304
517 Ga0496102_0576315 3300048905 Bacteria 1048
518 Ga0496103_0016674 3300048906 Bacteria 4387
519 Ga0496103_0031465 3300048906 Bacteria 3233
520 Ga0496104_0068971 3300048907 Bacteria 3360
521 Ga0496105_0028951 3300048908 Bacteria 4532
522 Ga0496106_0005084 3300048909 Bacteria 9737
523 Ga0496106_0048705 3300048909 Bacteria 3192
524 Ga0496106_0150816 3300048909 Bacteria 1834
525 Ga0496107_0021697 3300048910 Bacteria 4538
526 Ga0496108_0005780 3300048911 Bacteria 10021
527 Ga0496108_0387629 3300048911 Bacteria 1220
528 Ga0496109_0009534 3300048912 Bacteria 8275
529 Ga0496112_0122023 3300048915 Bacteria 2576
530 Ga0496112_0151785 3300048915 Bacteria 2284
531 Ga0496113_0122974 3300048916 Bacteria 2031
532 Ga0501034_0176802 3300049571 Bacteria 2100
533 Ga0501047_0068910 3300049581 Bacteria 3407
534 Ga0501067_0038006 3300049583 Bacteria 2674
535 Ga0501072_0026595 3300049588 Bacteria 4511
536 Ga0501073_0003984 3300049589 Bacteria 11084
537 Ga0501074_0011305 3300049590 Bacteria 6491
538 Ga0501079_0229191 3300049741 Bacteria 1451
539 Ga0501080_0046717 3300049742 Bacteria 4030
540 Ga0501083_0008659 3300049744 Bacteria 7178
541 nmdc:mga05p37_32061_c1 3300050507 Bacteria 6425
542 nmdc:mga08y16_95141_c1 3300050511 Bacteria 3103
543 nmdc:mga0n895_40699_c1 3300050512 Bacteria 4515
544 nmdc:mga0rr50_34877_c1 3300050513 Bacteria 3607
545 nmdc:mga08x19_87190_c1 3300050514 Bacteria 2056
546 Ga0495612_0031181 3300053078 Bacteria 2149
547 Ga0501082_0038254 3300060353 Bacteria 4139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005295 Ga0065707_10094921 Ga0065707_100949212 293
2 3300046681 Ga0495647_0027975 Ga0495647_0027975_1140_2045 301
3 3300049741 Ga0501079_0229191 Ga0501079_0229191_512_1423 302
4 3300035119 Ga0373956_0060606 Ga0373956_0060606_229_1212 303
5 3300005617 Ga0068859_100046449 Ga0068859_1000464493 304
6 3300006931 Ga0097620_100046449 Ga0097620_1000464493 304
7 3300026089 Ga0207648_10123945 Ga0207648_101239452 304
8 3300037068 Ga0373925_0440555 Ga0373925_0440555_45_998 304
9 3300005328 Ga0070676_10070236 Ga0070676_100702362 305
10 3300005335 Ga0070666_10037000 Ga0070666_100370001 305
11 3300005355 Ga0070671_100337960 Ga0070671_1003379602 305
12 3300005356 Ga0070674_100021516 Ga0070674_1000215162 305
13 3300005456 Ga0070678_100004896 Ga0070678_1000048962 305
14 3300005459 Ga0068867_100031311 Ga0068867_1000313116 305
15 3300006358 Ga0068871_100117420 Ga0068871_1001174202 305
16 3300025903 Ga0207680_10025546 Ga0207680_100255461 305
17 3300025907 Ga0207645_10082952 Ga0207645_100829522 305
18 3300025937 Ga0207669_10062314 Ga0207669_100623142 305
19 3300025940 Ga0207691_10063951 Ga0207691_100639514 305
20 3300026023 Ga0207677_10174013 Ga0207677_101740132 305
21 3300026089 Ga0207648_10041289 Ga0207648_100412897 305
22 3300026121 Ga0207683_10008987 Ga0207683_100089875 305
23 3300025913 Ga0207695_10116075 Ga0207695_101160752 306
24 3300005841 Ga0068863_100030992 Ga0068863_1000309927 308
25 3300005843 Ga0068860_100220359 Ga0068860_1002203592 308
26 3300005844 Ga0068862_100131754 Ga0068862_1001317542 308
27 3300014325 Ga0163163_10449486 Ga0163163_104494862 308
28 3300028380 Ga0268265_10012626 Ga0268265_100126265 308
29 3300035170 Ga0373943_0093591 Ga0373943_0093591_436_1470 308
30 3300053078 Ga0495612_0031181 Ga0495612_0031181_136_1170 308
31 3300013297 Ga0157378_10005774 Ga0157378_100057742 309
32 3300005327 Ga0070658_10087120 Ga0070658_100871202 311
33 3300005455 Ga0070663_100083033 Ga0070663_1000830332 311
34 3300005458 Ga0070681_10121111 Ga0070681_101211113 311
35 3300005535 Ga0070684_100002097 Ga0070684_1000020976 311
36 3300005564 Ga0070664_100008263 Ga0070664_1000082632 311
37 3300005578 Ga0068854_100022124 Ga0068854_1000221242 311
38 3300005614 Ga0068856_100010196 Ga0068856_1000101967 311
39 3300005834 Ga0068851_10006219 Ga0068851_100062195 311
40 3300005843 Ga0068860_100034549 Ga0068860_1000345496 311
41 3300009093 Ga0105240_10033512 Ga0105240_100335123 311
42 3300009174 Ga0105241_10001315 Ga0105241_1000131515 311
43 3300009545 Ga0105237_10014672 Ga0105237_100146726 311
44 3300013102 Ga0157371_10029358 Ga0157371_100293584 311
45 3300025909 Ga0207705_10035614 Ga0207705_100356143 311
46 3300025912 Ga0207707_10017735 Ga0207707_100177352 311
47 3300025914 Ga0207671_10018151 Ga0207671_100181515 311
48 3300025917 Ga0207660_10009828 Ga0207660_100098282 311
49 3300025919 Ga0207657_10000142 Ga0207657_1000014223 311
50 3300025920 Ga0207649_10064368 Ga0207649_100643682 311
51 3300025924 Ga0207694_10006593 Ga0207694_100065937 311
52 3300025929 Ga0207664_10013214 Ga0207664_100132145 311
53 3300025932 Ga0207690_10043258 Ga0207690_100432583 311
54 3300025949 Ga0207667_10011601 Ga0207667_100116019 311
55 3300025981 Ga0207640_10099258 Ga0207640_100992582 311
56 3300026067 Ga0207678_10135909 Ga0207678_101359091 311
57 3300026078 Ga0207702_10173709 Ga0207702_101737092 311
58 3300026116 Ga0207674_10000593 Ga0207674_1000059337 311
59 3300026142 Ga0207698_10009534 Ga0207698_100095342 311
60 3300038443 Ga0395901_0275869 Ga0395901_0275869_332_1339 311
61 3300005339 Ga0070660_100125807 Ga0070660_1001258072 312
62 3300005344 Ga0070661_100009969 Ga0070661_1000099692 312
63 3300005530 Ga0070679_100031053 Ga0070679_1000310533 312
64 3300005539 Ga0068853_100017860 Ga0068853_1000178604 312
65 3300005577 Ga0068857_100050904 Ga0068857_1000509043 312
66 3300009551 Ga0105238_10263418 Ga0105238_102634182 312
67 3300013100 Ga0157373_10122555 Ga0157373_101225552 312
68 3300013307 Ga0157372_10104013 Ga0157372_101040133 312
69 3300025912 Ga0207707_10041031 Ga0207707_100410314 312
70 3300025920 Ga0207649_10161880 Ga0207649_101618802 312
71 3300026041 Ga0207639_10152781 Ga0207639_101527812 312
72 3300026116 Ga0207674_10026116 Ga0207674_100261163 312
73 3300032002 Ga0307416_100117558 Ga0307416_1001175581 313
74 3300005614 Ga0068856_100018772 Ga0068856_1000187722 314
75 3300038996 Ga0242420_010569 Ga0242420_010569_553_1497 314
76 3300048909 Ga0496106_0150816 Ga0496106_0150816_560_1504 314
77 3300005355 Ga0070671_100014722 Ga0070671_1000147225 315
78 3300025903 Ga0207680_10154873 Ga0207680_101548732 315
79 3300025931 Ga0207644_10032991 Ga0207644_100329914 315
80 3300027682 Ga0209971_1003349 Ga0209971_10033494 315
81 3300027876 Ga0209974_10000914 Ga0209974_100009147 315
82 3300042461 Ga0439460_0011700 Ga0439460_0011700_833_1780 315
83 3300005337 Ga0070682_100047856 Ga0070682_1000478561 316
84 3300005338 Ga0068868_100102677 Ga0068868_1001026773 316
85 3300005434 Ga0070709_10051886 Ga0070709_100518862 316
86 3300005436 Ga0070713_100224156 Ga0070713_1002241562 316
87 3300005440 Ga0070705_100071601 Ga0070705_1000716012 316
88 3300005458 Ga0070681_10177575 Ga0070681_101775752 316
89 3300005467 Ga0070706_100135859 Ga0070706_1001358592 316
90 3300005518 Ga0070699_100006642 Ga0070699_1000066428 316
91 3300005530 Ga0070679_100025119 Ga0070679_1000251196 316
92 3300005535 Ga0070684_100087560 Ga0070684_1000875602 316
93 3300005536 Ga0070697_100061762 Ga0070697_1000617623 316
94 3300005539 Ga0068853_100068251 Ga0068853_1000682512 316
95 3300005539 Ga0068853_100144952 Ga0068853_1001449522 316
96 3300005545 Ga0070695_100110517 Ga0070695_1001105172 316
97 3300005546 Ga0070696_100075939 Ga0070696_1000759392 316
98 3300005548 Ga0070665_100081544 Ga0070665_1000815441 316
99 3300005549 Ga0070704_100252382 Ga0070704_1002523822 316
100 3300005564 Ga0070664_100085308 Ga0070664_1000853082 316
101 3300005577 Ga0068857_100407176 Ga0068857_1004071762 316
102 3300005578 Ga0068854_100048787 Ga0068854_1000487873 316
103 3300006175 Ga0070712_100139945 Ga0070712_1001399452 316
104 3300009098 Ga0105245_10117666 Ga0105245_101176661 316
105 3300009174 Ga0105241_10049560 Ga0105241_100495602 316
106 3300009545 Ga0105237_10606181 Ga0105237_106061811 316
107 3300013105 Ga0157369_10079287 Ga0157369_100792873 316
108 3300025893 Ga0207682_10001359 Ga0207682_100013593 316
109 3300025911 Ga0207654_10086673 Ga0207654_100866731 316
110 3300025912 Ga0207707_10008980 Ga0207707_100089808 316
111 3300025915 Ga0207693_10054932 Ga0207693_100549322 316
112 3300025919 Ga0207657_10031718 Ga0207657_100317182 316
113 3300025920 Ga0207649_10164939 Ga0207649_101649392 316
114 3300025921 Ga0207652_10054916 Ga0207652_100549164 316
115 3300025928 Ga0207700_10216321 Ga0207700_102163212 316
116 3300025929 Ga0207664_10005520 Ga0207664_100055207 316
117 3300025937 Ga0207669_10282043 Ga0207669_102820431 316
118 3300025939 Ga0207665_10009677 Ga0207665_100096775 316
119 3300025940 Ga0207691_10000024 Ga0207691_10000024120 316
120 3300025944 Ga0207661_10259095 Ga0207661_102590951 316
121 3300025945 Ga0207679_10178134 Ga0207679_101781342 316
122 3300025949 Ga0207667_10207700 Ga0207667_102077002 316
123 3300025981 Ga0207640_10098148 Ga0207640_100981482 316
124 3300026067 Ga0207678_10019164 Ga0207678_100191645 316
125 3300026078 Ga0207702_10061218 Ga0207702_100612181 316
126 3300026116 Ga0207674_10077157 Ga0207674_100771572 316
127 3300026142 Ga0207698_10015850 Ga0207698_100158502 316
128 3300035695 Ga0373927_0040758 Ga0373927_0040758_1413_2369 316
129 3300037068 Ga0373925_0024573 Ga0373925_0024573_73_1029 316
130 3300005328 Ga0070676_10021732 Ga0070676_100217324 317
131 3300005334 Ga0068869_100333164 Ga0068869_1003331641 317
132 3300005338 Ga0068868_100137499 Ga0068868_1001374992 317
133 3300005353 Ga0070669_100012571 Ga0070669_1000125711 317
134 3300005364 Ga0070673_100077314 Ga0070673_1000773141 317
135 3300005366 Ga0070659_100417982 Ga0070659_1004179821 317
136 3300005367 Ga0070667_100001054 Ga0070667_1000010544 317
137 3300005459 Ga0068867_100008070 Ga0068867_1000080706 317
138 3300005468 Ga0070707_100187130 Ga0070707_1001871302 317
139 3300005539 Ga0068853_100413335 Ga0068853_1004133351 317
140 3300005543 Ga0070672_100248332 Ga0070672_1002483321 317
141 3300005564 Ga0070664_100060714 Ga0070664_1000607142 317
142 3300005577 Ga0068857_100003129 Ga0068857_1000031299 317
143 3300005617 Ga0068859_100286393 Ga0068859_1002863932 317
144 3300005618 Ga0068864_100000811 Ga0068864_10000081118 317
145 3300005719 Ga0068861_100014463 Ga0068861_1000144636 317
146 3300005840 Ga0068870_10009717 Ga0068870_100097173 317
147 3300005841 Ga0068863_100008166 Ga0068863_10000816611 317
148 3300005842 Ga0068858_100014291 Ga0068858_1000142913 317
149 3300005843 Ga0068860_100022229 Ga0068860_1000222291 317
150 3300005844 Ga0068862_100002238 Ga0068862_1000022388 317
151 3300006881 Ga0068865_100119942 Ga0068865_1001199421 317
152 3300006931 Ga0097620_100286394 Ga0097620_1002863941 317
153 3300009148 Ga0105243_10061452 Ga0105243_100614524 317
154 3300009177 Ga0105248_10001895 Ga0105248_1000189513 317
155 3300013296 Ga0157374_10511644 Ga0157374_105116441 317
156 3300013308 Ga0157375_10042494 Ga0157375_100424944 317
157 3300014325 Ga0163163_10265601 Ga0163163_102656012 317
158 3300014968 Ga0157379_10000212 Ga0157379_1000021220 317
159 3300025893 Ga0207682_10094606 Ga0207682_100946062 317
160 3300025907 Ga0207645_10054143 Ga0207645_100541432 317
161 3300025908 Ga0207643_10013975 Ga0207643_100139754 317
162 3300025910 Ga0207684_10074451 Ga0207684_100744513 317
163 3300025922 Ga0207646_10061803 Ga0207646_100618032 317
164 3300025923 Ga0207681_10048753 Ga0207681_100487531 317
165 3300025925 Ga0207650_10013158 Ga0207650_100131582 317
166 3300025927 Ga0207687_10346322 Ga0207687_103463222 317
167 3300025935 Ga0207709_10232617 Ga0207709_102326171 317
168 3300025936 Ga0207670_10218619 Ga0207670_102186192 317
169 3300025940 Ga0207691_10240179 Ga0207691_102401792 317
170 3300025941 Ga0207711_10014198 Ga0207711_100141988 317
171 3300025942 Ga0207689_10000066 Ga0207689_1000006659 317
172 3300025949 Ga0207667_10087315 Ga0207667_100873153 317
173 3300025972 Ga0207668_10174669 Ga0207668_101746692 317
174 3300025986 Ga0207658_10015608 Ga0207658_100156084 317
175 3300026023 Ga0207677_10052914 Ga0207677_100529142 317
176 3300026035 Ga0207703_10000539 Ga0207703_1000053912 317
177 3300026041 Ga0207639_10346905 Ga0207639_103469052 317
178 3300026089 Ga0207648_10028509 Ga0207648_100285094 317
179 3300026095 Ga0207676_10052364 Ga0207676_100523644 317
180 3300026118 Ga0207675_100002297 Ga0207675_10000229712 317
181 3300028380 Ga0268265_10007921 Ga0268265_100079219 317
182 3300028381 Ga0268264_10003765 Ga0268264_100037659 317
183 3300035695 Ga0373927_0038465 Ga0373927_0038465_1214_2170 317
184 3300046472 Ga0495580_0081441 Ga0495580_0081441_1161_2129 317
185 3300048905 Ga0496102_0002372 Ga0496102_0002372_11004_11990 317
186 3300048911 Ga0496108_0387629 Ga0496108_0387629_135_1121 317
187 3300048912 Ga0496109_0009534 Ga0496109_0009534_493_1479 317
188 3300048916 Ga0496113_0122974 Ga0496113_0122974_847_1833 317
189 3300050514 nmdc:mga08x19_87190_c1 nmdc:mga08x19_87190_c1_129_1088 317
190 3300005347 Ga0070668_100185981 Ga0070668_1001859811 318
191 3300005578 Ga0068854_100265308 Ga0068854_1002653082 318
192 3300005841 Ga0068863_100047823 Ga0068863_1000478235 318
193 3300013105 Ga0157369_10230387 Ga0157369_102303872 318
194 3300013307 Ga0157372_10229684 Ga0157372_102296843 318
195 3300025972 Ga0207668_10043196 Ga0207668_100431962 318
196 3300025986 Ga0207658_10091126 Ga0207658_100911262 318
197 3300026089 Ga0207648_10085349 Ga0207648_100853492 318
198 3300028380 Ga0268265_10026966 Ga0268265_100269662 318
199 3300028794 Ga0307515_10000093 Ga0307515_10000093141 318
200 3300005327 Ga0070658_10492551 Ga0070658_104925511 319
201 3300005336 Ga0070680_100029253 Ga0070680_1000292535 319
202 3300005336 Ga0070680_100085561 Ga0070680_1000855612 319
203 3300005339 Ga0070660_100031339 Ga0070660_1000313393 319
204 3300005344 Ga0070661_100000392 Ga0070661_10000039221 319
205 3300005344 Ga0070661_100084907 Ga0070661_1000849072 319
206 3300005347 Ga0070668_100020847 Ga0070668_1000208472 319
207 3300005435 Ga0070714_100028382 Ga0070714_1000283826 319
208 3300005436 Ga0070713_100172805 Ga0070713_1001728051 319
209 3300005458 Ga0070681_10269495 Ga0070681_102694952 319
210 3300005530 Ga0070679_100066820 Ga0070679_1000668202 319
211 3300005535 Ga0070684_100002032 Ga0070684_1000020326 319
212 3300005539 Ga0068853_100537544 Ga0068853_1005375441 319
213 3300005563 Ga0068855_100046681 Ga0068855_1000466811 319
214 3300005563 Ga0068855_100105872 Ga0068855_1001058722 319
215 3300005564 Ga0070664_100001288 Ga0070664_10000128812 319
216 3300005577 Ga0068857_100000227 Ga0068857_10000022711 319
217 3300005614 Ga0068856_100008383 Ga0068856_1000083834 319
218 3300005614 Ga0068856_100234007 Ga0068856_1002340072 319
219 3300005616 Ga0068852_100054207 Ga0068852_1000542073 319
220 3300005841 Ga0068863_100049726 Ga0068863_1000497264 319
221 3300005841 Ga0068863_100268308 Ga0068863_1002683082 319
222 3300005844 Ga0068862_100041591 Ga0068862_1000415912 319
223 3300009093 Ga0105240_10102492 Ga0105240_101024924 319
224 3300009176 Ga0105242_10008308 Ga0105242_100083085 319
225 3300013104 Ga0157370_10045674 Ga0157370_100456742 319
226 3300013104 Ga0157370_10070028 Ga0157370_100700282 319
227 3300013105 Ga0157369_10091901 Ga0157369_100919014 319
228 3300013307 Ga0157372_10067361 Ga0157372_100673612 319
229 3300013307 Ga0157372_10098417 Ga0157372_100984173 319
230 3300013307 Ga0157372_10132273 Ga0157372_101322733 319
231 3300013308 Ga0157375_10247068 Ga0157375_102470682 319
232 3300025909 Ga0207705_10089575 Ga0207705_100895751 319
233 3300025912 Ga0207707_10257351 Ga0207707_102573512 319
234 3300025913 Ga0207695_10036276 Ga0207695_100362766 319
235 3300025917 Ga0207660_10131710 Ga0207660_101317102 319
236 3300025919 Ga0207657_10039230 Ga0207657_100392302 319
237 3300025919 Ga0207657_10112787 Ga0207657_101127872 319
238 3300025920 Ga0207649_10009412 Ga0207649_100094122 319
239 3300025921 Ga0207652_10019964 Ga0207652_100199642 319
240 3300025921 Ga0207652_10032722 Ga0207652_100327224 319
241 3300025924 Ga0207694_10174528 Ga0207694_101745282 319
242 3300025925 Ga0207650_10407185 Ga0207650_104071851 319
243 3300025926 Ga0207659_10147793 Ga0207659_101477932 319
244 3300025928 Ga0207700_10000031 Ga0207700_10000031132 319
245 3300025929 Ga0207664_10023637 Ga0207664_100236376 319
246 3300025929 Ga0207664_10152053 Ga0207664_101520532 319
247 3300025932 Ga0207690_10128640 Ga0207690_101286401 319
248 3300025933 Ga0207706_10224348 Ga0207706_102243481 319
249 3300025934 Ga0207686_10020663 Ga0207686_100206633 319
250 3300025940 Ga0207691_10197457 Ga0207691_101974572 319
251 3300025949 Ga0207667_10022825 Ga0207667_100228257 319
252 3300025949 Ga0207667_10205588 Ga0207667_102055881 319
253 3300025972 Ga0207668_10071731 Ga0207668_100717312 319
254 3300026041 Ga0207639_10027652 Ga0207639_100276522 319
255 3300026041 Ga0207639_10277136 Ga0207639_102771362 319
256 3300026088 Ga0207641_10105184 Ga0207641_101051842 319
257 3300026116 Ga0207674_10000883 Ga0207674_1000088319 319
258 3300026118 Ga0207675_100064462 Ga0207675_1000644622 319
259 3300026142 Ga0207698_10316452 Ga0207698_103164521 319
260 3300028381 Ga0268264_10115075 Ga0268264_101150752 319
261 3300032002 Ga0307416_100183690 Ga0307416_1001836902 319
262 3300037471 Ga0395905_0304032 Ga0395905_0304032_485_1456 319
263 3300042876 Ga0451577_0281921 Ga0451577_0281921_433_1416 319
264 3300044694 Ga0466963_0062383 Ga0466963_0062383_641_1609 319
265 3300044712 Ga0453684_0414995 Ga0453684_0414995_263_1225 319
266 3300046543 Ga0495645_0050652 Ga0495645_0050652_1944_2909 319
267 3300048915 Ga0496112_0122023 Ga0496112_0122023_16_990 319
268 3300049571 Ga0501034_0176802 Ga0501034_0176802_678_1643 319
269 3300049581 Ga0501047_0068910 Ga0501047_0068910_1806_2798 319
270 3300049583 Ga0501067_0038006 Ga0501067_0038006_18_983 319
271 3300049588 Ga0501072_0026595 Ga0501072_0026595_125_1117 319
272 3300049589 Ga0501073_0003984 Ga0501073_0003984_5946_6938 319
273 3300049590 Ga0501074_0011305 Ga0501074_0011305_2798_3898 319
274 3300049742 Ga0501080_0046717 Ga0501080_0046717_2024_3016 319
275 3300049744 Ga0501083_0008659 Ga0501083_0008659_4571_5563 319
276 3300060353 Ga0501082_0038254 Ga0501082_0038254_558_1550 319
277 3300005367 Ga0070667_100218196 Ga0070667_1002181962 320
278 3300005434 Ga0070709_10004626 Ga0070709_100046263 320
279 3300005435 Ga0070714_100040738 Ga0070714_1000407383 320
280 3300005436 Ga0070713_100097999 Ga0070713_1000979993 320
281 3300005439 Ga0070711_100010142 Ga0070711_1000101423 320
282 3300005518 Ga0070699_100017563 Ga0070699_1000175634 320
283 3300005530 Ga0070679_100359779 Ga0070679_1003597791 320
284 3300005546 Ga0070696_100158952 Ga0070696_1001589522 320
285 3300009093 Ga0105240_10047967 Ga0105240_100479673 320
286 3300013104 Ga0157370_10097429 Ga0157370_100974292 320
287 3300013307 Ga0157372_10078185 Ga0157372_100781852 320
288 3300013307 Ga0157372_10078262 Ga0157372_100782624 320
289 3300020070 Ga0206356_11894257 Ga0206356_118942572 320
290 3300025909 Ga0207705_10137666 Ga0207705_101376662 320
291 3300025914 Ga0207671_10208030 Ga0207671_102080302 320
292 3300025916 Ga0207663_10049546 Ga0207663_100495463 320
293 3300025921 Ga0207652_10253117 Ga0207652_102531172 320
294 3300025929 Ga0207664_10020785 Ga0207664_100207851 320
295 3300025932 Ga0207690_10080238 Ga0207690_100802382 320
296 3300025932 Ga0207690_10252010 Ga0207690_102520102 320
297 3300031824 Ga0307413_10089523 Ga0307413_100895232 320
298 3300031852 Ga0307410_10274646 Ga0307410_102746462 320
299 3300031903 Ga0307407_10276898 Ga0307407_102768981 320
300 3300042876 Ga0451577_0159977 Ga0451577_0159977_511_1476 320
301 3300044712 Ga0453684_0019411 Ga0453684_0019411_9166_10131 320
302 3300045051 Ga0451576_0003170 Ga0451576_0003170_508_1473 320
303 3300005331 Ga0070670_100000384 Ga0070670_10000038411 321
304 3300005331 Ga0070670_100049788 Ga0070670_1000497883 321
305 3300005331 Ga0070670_100212618 Ga0070670_1002126182 321
306 3300005334 Ga0068869_100020355 Ga0068869_1000203553 321
307 3300005340 Ga0070689_100098915 Ga0070689_1000989152 321
308 3300005347 Ga0070668_100058057 Ga0070668_1000580573 321
309 3300005354 Ga0070675_100008345 Ga0070675_1000083456 321
310 3300005354 Ga0070675_100135518 Ga0070675_1001355182 321
311 3300005355 Ga0070671_100066182 Ga0070671_1000661823 321
312 3300005356 Ga0070674_100020718 Ga0070674_1000207183 321
313 3300005459 Ga0068867_100255846 Ga0068867_1002558462 321
314 3300005543 Ga0070672_100000285 Ga0070672_10000028523 321
315 3300005564 Ga0070664_100223906 Ga0070664_1002239062 321
316 3300005617 Ga0068859_100054180 Ga0068859_1000541803 321
317 3300005618 Ga0068864_100002245 Ga0068864_1000022453 321
318 3300005719 Ga0068861_100220844 Ga0068861_1002208442 321
319 3300005841 Ga0068863_100040190 Ga0068863_1000401902 321
320 3300005843 Ga0068860_100175288 Ga0068860_1001752882 321
321 3300005844 Ga0068862_100007647 Ga0068862_1000076477 321
322 3300005844 Ga0068862_100017622 Ga0068862_1000176227 321
323 3300005844 Ga0068862_100072094 Ga0068862_1000720942 321
324 3300006237 Ga0097621_100030022 Ga0097621_1000300223 321
325 3300006931 Ga0097620_100054180 Ga0097620_1000541803 321
326 3300009147 Ga0114129_10048102 Ga0114129_100481025 321
327 3300009176 Ga0105242_10059498 Ga0105242_100594982 321
328 3300009177 Ga0105248_10104542 Ga0105248_101045421 321
329 3300013297 Ga0157378_10099146 Ga0157378_100991462 321
330 3300013308 Ga0157375_10004850 Ga0157375_100048502 321
331 3300013308 Ga0157375_10105841 Ga0157375_101058413 321
332 3300013308 Ga0157375_10140378 Ga0157375_101403783 321
333 3300014325 Ga0163163_10003586 Ga0163163_100035864 321
334 3300017792 Ga0163161_10189701 Ga0163161_101897012 321
335 3300025908 Ga0207643_10011549 Ga0207643_100115492 321
336 3300025925 Ga0207650_10002177 Ga0207650_100021771 321
337 3300025926 Ga0207659_10028290 Ga0207659_100282902 321
338 3300025926 Ga0207659_10110870 Ga0207659_101108702 321
339 3300025933 Ga0207706_10036459 Ga0207706_100364595 321
340 3300025942 Ga0207689_10009656 Ga0207689_100096564 321
341 3300025972 Ga0207668_10060272 Ga0207668_100602723 321
342 3300026089 Ga0207648_10046673 Ga0207648_100466732 321
343 3300026095 Ga0207676_10047859 Ga0207676_100478592 321
344 3300026118 Ga0207675_100321255 Ga0207675_1003212552 321
345 3300026121 Ga0207683_10366046 Ga0207683_103660461 321
346 3300026142 Ga0207698_10125251 Ga0207698_101252512 321
347 3300028380 Ga0268265_10011203 Ga0268265_100112033 321
348 3300028380 Ga0268265_10017902 Ga0268265_100179025 321
349 3300031548 Ga0307408_100049773 Ga0307408_1000497732 321
350 3300031903 Ga0307407_10173669 Ga0307407_101736692 321
351 3300031911 Ga0307412_10118227 Ga0307412_101182272 321
352 3300031995 Ga0307409_100044980 Ga0307409_1000449802 321
353 3300031995 Ga0307409_100430480 Ga0307409_1004304801 321
354 3300032002 Ga0307416_100007029 Ga0307416_1000070294 321
355 3300032004 Ga0307414_10046915 Ga0307414_100469153 321
356 3300032005 Ga0307411_10467263 Ga0307411_104672631 321
357 3300035118 Ga0373954_0040711 Ga0373954_0040711_279_1244 321
358 3300036401 Ga0373937_0067371 Ga0373937_0067371_2150_3115 321
359 3300050507 nmdc:mga05p37_32061_c1 nmdc:mga05p37_32061_c1_446_1429 321
360 3300005293 Ga0065715_10206623 Ga0065715_102066231 322
361 3300005328 Ga0070676_10040173 Ga0070676_100401731 322
362 3300005329 Ga0070683_100002563 Ga0070683_1000025637 322
363 3300005331 Ga0070670_100016030 Ga0070670_1000160303 322
364 3300005331 Ga0070670_100108304 Ga0070670_1001083042 322
365 3300005333 Ga0070677_10026075 Ga0070677_100260751 322
366 3300005334 Ga0068869_100019722 Ga0068869_1000197222 322
367 3300005335 Ga0070666_10025957 Ga0070666_100259572 322
368 3300005335 Ga0070666_10168215 Ga0070666_101682151 322
369 3300005336 Ga0070680_100112325 Ga0070680_1001123252 322
370 3300005338 Ga0068868_100188603 Ga0068868_1001886032 322
371 3300005339 Ga0070660_100000694 Ga0070660_1000006949 322
372 3300005340 Ga0070689_100001272 Ga0070689_10000127210 322
373 3300005343 Ga0070687_100011963 Ga0070687_1000119632 322
374 3300005344 Ga0070661_100000400 Ga0070661_10000040012 322
375 3300005344 Ga0070661_100019148 Ga0070661_1000191484 322
376 3300005347 Ga0070668_100003233 Ga0070668_1000032333 322
377 3300005347 Ga0070668_100011291 Ga0070668_1000112919 322
378 3300005354 Ga0070675_100089427 Ga0070675_1000894273 322
379 3300005354 Ga0070675_100189340 Ga0070675_1001893402 322
380 3300005355 Ga0070671_100015481 Ga0070671_1000154813 322
381 3300005356 Ga0070674_100021707 Ga0070674_1000217076 322
382 3300005356 Ga0070674_100169895 Ga0070674_1001698952 322
383 3300005356 Ga0070674_100267688 Ga0070674_1002676882 322
384 3300005364 Ga0070673_100000879 Ga0070673_10000087910 322
385 3300005365 Ga0070688_100015322 Ga0070688_1000153223 322
386 3300005366 Ga0070659_100026600 Ga0070659_1000266003 322
387 3300005366 Ga0070659_100044644 Ga0070659_1000446444 322
388 3300005367 Ga0070667_100133003 Ga0070667_1001330032 322
389 3300005367 Ga0070667_100287408 Ga0070667_1002874081 322
390 3300005441 Ga0070700_100005655 Ga0070700_1000056552 322
391 3300005455 Ga0070663_100002270 Ga0070663_1000022707 322
392 3300005455 Ga0070663_100036967 Ga0070663_1000369672 322
393 3300005455 Ga0070663_100061947 Ga0070663_1000619473 322
394 3300005456 Ga0070678_100018636 Ga0070678_1000186367 322
395 3300005456 Ga0070678_100086053 Ga0070678_1000860532 322
396 3300005456 Ga0070678_100141949 Ga0070678_1001419492 322
397 3300005456 Ga0070678_100236512 Ga0070678_1002365122 322
398 3300005457 Ga0070662_100000108 Ga0070662_1000001082 322
399 3300005457 Ga0070662_100162144 Ga0070662_1001621442 322
400 3300005459 Ga0068867_100093768 Ga0068867_1000937682 322
401 3300005459 Ga0068867_100202126 Ga0068867_1002021262 322
402 3300005466 Ga0070685_10002619 Ga0070685_100026192 322
403 3300005467 Ga0070706_100032853 Ga0070706_1000328532 322
404 3300005468 Ga0070707_100080946 Ga0070707_1000809462 322
405 3300005471 Ga0070698_100063588 Ga0070698_1000635882 322
406 3300005535 Ga0070684_100008260 Ga0070684_1000082602 322
407 3300005535 Ga0070684_100039058 Ga0070684_1000390582 322
408 3300005539 Ga0068853_100001634 Ga0068853_1000016343 322
409 3300005539 Ga0068853_100306768 Ga0068853_1003067682 322
410 3300005544 Ga0070686_100047159 Ga0070686_1000471593 322
411 3300005548 Ga0070665_100441651 Ga0070665_1004416512 322
412 3300005563 Ga0068855_100002112 Ga0068855_10000211211 322
413 3300005563 Ga0068855_100098715 Ga0068855_1000987154 322
414 3300005564 Ga0070664_100032418 Ga0070664_1000324183 322
415 3300005564 Ga0070664_100177395 Ga0070664_1001773951 322
416 3300005577 Ga0068857_100230810 Ga0068857_1002308102 322
417 3300005577 Ga0068857_100311403 Ga0068857_1003114031 322
418 3300005578 Ga0068854_100109081 Ga0068854_1001090811 322
419 3300005614 Ga0068856_100000818 Ga0068856_10000081825 322
420 3300005615 Ga0070702_100037446 Ga0070702_1000374464 322
421 3300005616 Ga0068852_100022286 Ga0068852_1000222862 322
422 3300005616 Ga0068852_100035483 Ga0068852_1000354832 322
423 3300005616 Ga0068852_100370152 Ga0068852_1003701522 322
424 3300005617 Ga0068859_100458688 Ga0068859_1004586882 322
425 3300005718 Ga0068866_10108975 Ga0068866_101089752 322
426 3300005719 Ga0068861_100081667 Ga0068861_1000816671 322
427 3300005834 Ga0068851_10003492 Ga0068851_100034924 322
428 3300005840 Ga0068870_10019757 Ga0068870_100197572 322
429 3300005841 Ga0068863_100082149 Ga0068863_1000821492 322
430 3300005843 Ga0068860_100205565 Ga0068860_1002055652 322
431 3300005985 Ga0081539_10015143 Ga0081539_100151432 322
432 3300006358 Ga0068871_100292744 Ga0068871_1002927442 322
433 3300006358 Ga0068871_100293853 Ga0068871_1002938531 322
434 3300006852 Ga0075433_10067907 Ga0075433_100679073 322
435 3300006871 Ga0075434_100064619 Ga0075434_1000646193 322
436 3300006881 Ga0068865_100040601 Ga0068865_1000406011 322
437 3300006931 Ga0097620_100458713 Ga0097620_1004587131 322
438 3300007076 Ga0075435_100004323 Ga0075435_10000432310 322
439 3300009093 Ga0105240_10291278 Ga0105240_102912782 322
440 3300009094 Ga0111539_10035560 Ga0111539_100355604 322
441 3300009174 Ga0105241_10065449 Ga0105241_100654492 322
442 3300009176 Ga0105242_10232793 Ga0105242_102327932 322
443 3300009551 Ga0105238_10007960 Ga0105238_100079605 322
444 3300009553 Ga0105249_10030152 Ga0105249_100301525 322
445 3300010375 Ga0105239_10308434 Ga0105239_103084342 322
446 3300010375 Ga0105239_10358356 Ga0105239_103583562 322
447 3300013100 Ga0157373_10004666 Ga0157373_100046663 322
448 3300013100 Ga0157373_10008273 Ga0157373_100082734 322
449 3300013102 Ga0157371_10001582 Ga0157371_1000158218 322
450 3300013104 Ga0157370_10037320 Ga0157370_100373206 322
451 3300013105 Ga0157369_10040229 Ga0157369_100402291 322
452 3300013296 Ga0157374_10016561 Ga0157374_100165613 322
453 3300013297 Ga0157378_10048997 Ga0157378_100489972 322
454 3300013307 Ga0157372_10000713 Ga0157372_1000071319 322
455 3300013307 Ga0157372_10009175 Ga0157372_100091753 322
456 3300014326 Ga0157380_10187321 Ga0157380_101873212 322
457 3300014497 Ga0182008_10070035 Ga0182008_100700352 322
458 3300014745 Ga0157377_10027307 Ga0157377_100273072 322
459 3300014968 Ga0157379_10125506 Ga0157379_101255062 322
460 3300025315 Ga0207697_10000294 Ga0207697_1000029426 322
461 3300025315 Ga0207697_10086639 Ga0207697_100866392 322
462 3300025899 Ga0207642_10096282 Ga0207642_100962822 322
463 3300025901 Ga0207688_10000560 Ga0207688_100005606 322
464 3300025901 Ga0207688_10097619 Ga0207688_100976192 322
465 3300025903 Ga0207680_10116877 Ga0207680_101168771 322
466 3300025907 Ga0207645_10001322 Ga0207645_1000132214 322
467 3300025907 Ga0207645_10003614 Ga0207645_100036145 322
468 3300025908 Ga0207643_10001280 Ga0207643_1000128011 322
469 3300025910 Ga0207684_10435274 Ga0207684_104352741 322
470 3300025917 Ga0207660_10078762 Ga0207660_100787622 322
471 3300025918 Ga0207662_10001098 Ga0207662_100010982 322
472 3300025919 Ga0207657_10000788 Ga0207657_1000078821 322
473 3300025919 Ga0207657_10039325 Ga0207657_100393252 322
474 3300025920 Ga0207649_10003419 Ga0207649_100034193 322
475 3300025922 Ga0207646_10006512 Ga0207646_100065128 322
476 3300025925 Ga0207650_10029342 Ga0207650_100293422 322
477 3300025925 Ga0207650_10157412 Ga0207650_101574122 322
478 3300025926 Ga0207659_10037456 Ga0207659_100374562 322
479 3300025926 Ga0207659_10048659 Ga0207659_100486592 322
480 3300025931 Ga0207644_10019000 Ga0207644_100190004 322
481 3300025931 Ga0207644_10025308 Ga0207644_100253084 322
482 3300025931 Ga0207644_10111367 Ga0207644_101113672 322
483 3300025932 Ga0207690_10005110 Ga0207690_100051105 322
484 3300025933 Ga0207706_10000186 Ga0207706_1000018655 322
485 3300025933 Ga0207706_10002261 Ga0207706_1000226111 322
486 3300025935 Ga0207709_10105424 Ga0207709_101054242 322
487 3300025936 Ga0207670_10033661 Ga0207670_100336612 322
488 3300025937 Ga0207669_10147397 Ga0207669_101473972 322
489 3300025940 Ga0207691_10001968 Ga0207691_100019684 322
490 3300025940 Ga0207691_10024939 Ga0207691_100249393 322
491 3300025941 Ga0207711_10227582 Ga0207711_102275822 322
492 3300025942 Ga0207689_10013126 Ga0207689_100131266 322
493 3300025944 Ga0207661_10034942 Ga0207661_100349423 322
494 3300025945 Ga0207679_10004040 Ga0207679_100040403 322
495 3300025945 Ga0207679_10074299 Ga0207679_100742991 322
496 3300025949 Ga0207667_10001802 Ga0207667_1000180222 322
497 3300025949 Ga0207667_10233145 Ga0207667_102331452 322
498 3300025960 Ga0207651_10070184 Ga0207651_100701842 322
499 3300025960 Ga0207651_10182213 Ga0207651_101822132 322
500 3300025972 Ga0207668_10019959 Ga0207668_100199594 322
501 3300025972 Ga0207668_10139096 Ga0207668_101390962 322
502 3300025972 Ga0207668_10321548 Ga0207668_103215482 322
503 3300025986 Ga0207658_10035724 Ga0207658_100357242 322
504 3300025986 Ga0207658_10080830 Ga0207658_100808302 322
505 3300025986 Ga0207658_10106923 Ga0207658_101069232 322
506 3300025986 Ga0207658_10149311 Ga0207658_101493112 322
507 3300026023 Ga0207677_10029684 Ga0207677_100296842 322
508 3300026035 Ga0207703_10184520 Ga0207703_101845202 322
509 3300026041 Ga0207639_10006877 Ga0207639_100068774 322
510 3300026067 Ga0207678_10003125 Ga0207678_100031257 322
511 3300026067 Ga0207678_10005127 Ga0207678_100051273 322
512 3300026067 Ga0207678_10081264 Ga0207678_100812642 322
513 3300026067 Ga0207678_10107082 Ga0207678_101070822 322
514 3300026067 Ga0207678_10114205 Ga0207678_101142052 322
515 3300026075 Ga0207708_10003194 Ga0207708_1000319410 322
516 3300026078 Ga0207702_10003786 Ga0207702_100037869 322
517 3300026089 Ga0207648_10000390 Ga0207648_1000039011 322
518 3300026089 Ga0207648_10112141 Ga0207648_101121412 322
519 3300026095 Ga0207676_10073391 Ga0207676_100733912 322
520 3300026118 Ga0207675_100015338 Ga0207675_1000153385 322
521 3300026121 Ga0207683_10000789 Ga0207683_1000078913 322
522 3300026142 Ga0207698_10253198 Ga0207698_102531982 322
523 3300026142 Ga0207698_10520967 Ga0207698_105209671 322
524 3300027907 Ga0207428_10065958 Ga0207428_100659582 322
525 3300028379 Ga0268266_10136667 Ga0268266_101366672 322
526 3300035172 Ga0373955_0204960 Ga0373955_0204960_161_1153 322
527 3300035691 Ga0373931_0094133 Ga0373931_0094133_95_1078 322
528 3300035691 Ga0373931_0190525 Ga0373931_0190525_202_1176 322
529 3300035695 Ga0373927_0004115 Ga0373927_0004115_5822_6805 322
530 3300036401 Ga0373937_0140368 Ga0373937_0140368_615_1598 322
531 3300048903 Ga0496100_0114147 Ga0496100_0114147_817_1791 322
532 3300048904 Ga0496101_0067887 Ga0496101_0067887_119_1102 322
533 3300048904 Ga0496101_0242641 Ga0496101_0242641_395_1369 322
534 3300048905 Ga0496102_0012667 Ga0496102_0012667_2094_3077 322
535 3300048905 Ga0496102_0576315 Ga0496102_0576315_16_1014 322
536 3300048906 Ga0496103_0016674 Ga0496103_0016674_2707_3681 322
537 3300048906 Ga0496103_0031465 Ga0496103_0031465_1339_2322 322
538 3300048907 Ga0496104_0068971 Ga0496104_0068971_1159_2133 322
539 3300048908 Ga0496105_0028951 Ga0496105_0028951_2938_3912 322
540 3300048909 Ga0496106_0005084 Ga0496106_0005084_4980_5963 322
541 3300048909 Ga0496106_0048705 Ga0496106_0048705_817_1791 322
542 3300048910 Ga0496107_0021697 Ga0496107_0021697_2437_3411 322
543 3300048911 Ga0496108_0005780 Ga0496108_0005780_8231_9205 322
544 3300048915 Ga0496112_0151785 Ga0496112_0151785_969_1958 322
545 3300050511 nmdc:mga08y16_95141_c1 nmdc:mga08y16_95141_c1_37_1011 322
546 3300050512 nmdc:mga0n895_40699_c1 nmdc:mga0n895_40699_c1_732_1718 322
547 3300050513 nmdc:mga0rr50_34877_c1 nmdc:mga0rr50_34877_c1_1137_2123 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

69

328

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9677 27 322
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9645 27 322
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9547 26 322
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9515 26 322
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9367 30 318
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9529 125 242 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9501 125 247 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9466 26 322 3.40.190.150
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9449 126 247 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9359 26 322 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A0Q4Y6X1-F1-model_v4 ABC transporter substrate-binding protein 0.9799 51 322
AF-A0A2N5C237-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9792 23 322
AF-A0A537U4L1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9778 55 322
AF-A0A4Q5WTE4-F1-model_v4 deleted 0.9769 127 320
AF-A0A4V2HUY2-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9763 89 322

Feature Viewer

pLDDT pTM Quality
92.17 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map