F462234

General Info

Members Datasets Scaffolds Average Seq Length
548 295 548 144

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10718046|Ga0207646_107180462
Length 177
Sequence VGALVRLLASSAGDAAIDLDGPAQLDGTMKVKGRGTSAGQSGPAASALIDKRIDELGDWRGKMLARLRALIHKADPDIVEEWKWMGTPIFSHAGIVCTGETYKAVVKLTFAKGAALKDPAGLFNSSLEGNVRRAIDVHEGEKVNEAALKDLIRAAVALNVEGKTKTGTKTKSARKAK

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
162 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
163 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
164 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
165 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
293 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 3.65
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10194032 3300001989 Bacteria 597
2 JGI24743J22301_10008365 3300001991 Bacteria 1814
3 Ga0065712_10076784 3300005290 Bacteria 3603
4 Ga0065712_10132493 3300005290 Bacteria 1533
5 Ga0065715_10107365 3300005293 Bacteria 2761
6 Ga0065715_10268803 3300005293 Bacteria 1091
7 Ga0065715_10291854 3300005293 Bacteria 1061
8 Ga0065715_10869015 3300005293 Bacteria 585
9 Ga0065707_10027610 3300005295 Bacteria 1566
10 Ga0065707_10115429 3300005295 Bacteria 2267
11 Ga0070676_10011237 3300005328 Bacteria 4868
12 Ga0070683_100128551 3300005329 Bacteria 2396
13 Ga0070683_100237802 3300005329 Bacteria 1732
14 Ga0070690_100279245 3300005330 Bacteria 1191
15 Ga0070670_100243971 3300005331 Bacteria 1564
16 Ga0070670_100272122 3300005331 Bacteria 1478
17 Ga0070680_100024536 3300005336 Bacteria 4818
18 Ga0068868_100048308 3300005338 Bacteria 3338
19 Ga0068868_100053829 3300005338 Bacteria 3171
20 Ga0068868_100131338 3300005338 Bacteria 2049
21 Ga0068868_100552163 3300005338 Unclassified 1015
22 Ga0070660_100037692 3300005339 Bacteria 3665
23 Ga0070689_100000001 3300005340 Bacteria 1334580
24 Ga0070689_100000101 3300005340 Bacteria 50092
25 Ga0070661_100161254 3300005344 Bacteria 1698
26 Ga0070675_100042568 3300005354 Bacteria 3710
27 Ga0070671_100314082 3300005355 Bacteria 1335
28 Ga0070674_100678123 3300005356 Bacteria 879
29 Ga0070673_100483734 3300005364 Bacteria 1118
30 Ga0070673_101523971 3300005364 Bacteria 631
31 Ga0070688_100000001 3300005365 Bacteria 106331
32 Ga0070688_100067590 3300005365 Bacteria 2277
33 Ga0070659_100327778 3300005366 Bacteria 1281
34 Ga0070667_100638324 3300005367 Bacteria 983
35 Ga0070709_10134980 3300005434 Bacteria 1689
36 Ga0070710_10126867 3300005437 Bacteria 1551
37 Ga0070710_10385507 3300005437 Unclassified 936
38 Ga0070711_101462076 3300005439 Bacteria 596
39 Ga0070705_100000257 3300005440 Bacteria 31587
40 Ga0070663_100173922 3300005455 Bacteria 1666
41 Ga0070663_100705151 3300005455 Bacteria 858
42 Ga0070678_100065502 3300005456 Bacteria 2698
43 Ga0070678_100317871 3300005456 Bacteria 1329
44 Ga0070678_100834834 3300005456 Bacteria 839
45 Ga0070662_100030034 3300005457 Bacteria 3799
46 Ga0070681_10247445 3300005458 Bacteria 1696
47 Ga0070681_10360312 3300005458 Bacteria 1364
48 Ga0070681_10682973 3300005458 Bacteria 942
49 Ga0070685_10092012 3300005466 Bacteria 1837
50 Ga0070685_10129576 3300005466 Bacteria 1576
51 Ga0070706_100182330 3300005467 Bacteria 1960
52 Ga0070707_100164279 3300005468 Bacteria 2163
53 Ga0070707_100557892 3300005468 Bacteria 1108
54 Ga0070698_100003314 3300005471 Bacteria 17717
55 Ga0070698_100696887 3300005471 Bacteria 958
56 Ga0070698_101052491 3300005471 Bacteria 762
57 Ga0070699_100086457 3300005518 Bacteria 2736
58 Ga0070699_100329802 3300005518 Bacteria 1372
59 Ga0070679_100054622 3300005530 Bacteria 3977
60 Ga0070679_100137445 3300005530 Bacteria 2425
61 Ga0070684_100133335 3300005535 Bacteria 2242
62 Ga0070684_100141544 3300005535 Bacteria 2175
63 Ga0070684_100587576 3300005535 Bacteria 1035
64 Ga0070684_100645644 3300005535 Bacteria 985
65 Ga0068853_100057925 3300005539 Bacteria 3344
66 Ga0068853_100662200 3300005539 Bacteria 994
67 Ga0070686_100743803 3300005544 Bacteria 786
68 Ga0070695_100185335 3300005545 Bacteria 1477
69 Ga0070696_100092279 3300005546 Bacteria 2158
70 Ga0070696_100560238 3300005546 Bacteria 917
71 Ga0070665_100226350 3300005548 Bacteria 1870
72 Ga0070665_100557095 3300005548 Bacteria 1159
73 Ga0068855_100097809 3300005563 Bacteria 3381
74 Ga0068855_100310169 3300005563 Bacteria 1746
75 Ga0068855_100393353 3300005563 Bacteria 1520
76 Ga0070664_100035559 3300005564 Bacteria 4182
77 Ga0070664_100614192 3300005564 Bacteria 1009
78 Ga0068857_100093482 3300005577 Bacteria 2693
79 Ga0068854_100075900 3300005578 Bacteria 2469
80 Ga0068854_100228764 3300005578 Bacteria 1475
81 Ga0068854_100944915 3300005578 Bacteria 760
82 Ga0068856_100017387 3300005614 Bacteria 6969
83 Ga0068856_100251061 3300005614 Bacteria 1784
84 Ga0070702_100522686 3300005615 Bacteria 876
85 Ga0068852_100209420 3300005616 Bacteria 1849
86 Ga0068852_101061197 3300005616 Bacteria 830
87 Ga0068852_102188430 3300005616 Bacteria 575
88 Ga0068859_100034183 3300005617 Bacteria 5103
89 Ga0068859_100977571 3300005617 Bacteria 929
90 Ga0068859_101757604 3300005617 Bacteria 685
91 Ga0068866_10026547 3300005718 Bacteria 2736
92 Ga0068866_10073036 3300005718 Bacteria 1819
93 Ga0068866_10387482 3300005718 Bacteria 898
94 Ga0068861_100189500 3300005719 Bacteria 1718
95 Ga0068861_100555659 3300005719 Bacteria 1047
96 Ga0068861_101965896 3300005719 Bacteria 583
97 Ga0068863_100327412 3300005841 Bacteria 1489
98 Ga0068858_100002668 3300005842 Bacteria 17950
99 Ga0068858_100010011 3300005842 Bacteria 9005
100 Ga0068860_101341727 3300005843 Bacteria 736
101 Ga0068860_101369707 3300005843 Bacteria 729
102 Ga0068862_100329106 3300005844 Bacteria 1412
103 Ga0068862_100951623 3300005844 Bacteria 847
104 Ga0081455_10001198 3300005937 Bacteria 32472
105 Ga0081539_10002066 3300005985 Bacteria 30089
106 Ga0070717_10207889 3300006028 Bacteria 1717
107 Ga0075365_10070994 3300006038 Bacteria 2343
108 Ga0075362_10000363 3300006177 Bacteria 13081
109 Ga0075366_10022348 3300006195 Bacteria 3678
110 Ga0097621_100004225 3300006237 Bacteria 9974
111 Ga0097621_100201189 3300006237 Bacteria 1729
112 Ga0097621_101999760 3300006237 Bacteria 554
113 Ga0068871_100046325 3300006358 Bacteria 3502
114 Ga0068871_100079058 3300006358 Bacteria 2720
115 Ga0068871_100304635 3300006358 Bacteria 1399
116 Ga0068871_100775412 3300006358 Bacteria 882
117 Ga0068871_100808094 3300006358 Bacteria 865
118 Ga0075428_100179306 3300006844 Bacteria 2293
119 Ga0075431_101652549 3300006847 Bacteria 598
120 Ga0075433_10005620 3300006852 Bacteria 9856
121 Ga0075433_10653137 3300006852 Bacteria 922
122 Ga0075434_100034229 3300006871 Bacteria 5016
123 Ga0075434_101321057 3300006871 Bacteria 732
124 Ga0068865_100014987 3300006881 Bacteria 4936
125 Ga0068865_100172987 3300006881 Bacteria 1657
126 Ga0075436_100008890 3300006914 Bacteria 6872
127 Ga0097620_100034180 3300006931 Bacteria 5103
128 Ga0097620_100911930 3300006931 Bacteria 963
129 Ga0097620_100977415 3300006931 Bacteria 929
130 Ga0097620_101757593 3300006931 Bacteria 685
131 Ga0075435_100027708 3300007076 Bacteria 4435
132 Ga0105240_10003190 3300009093 Bacteria 25760
133 Ga0105240_10013677 3300009093 Bacteria 11129
134 Ga0105240_10021753 3300009093 Bacteria 8523
135 Ga0105240_10050819 3300009093 Bacteria 5223
136 Ga0105240_10059121 3300009093 Bacteria 4785
137 Ga0111539_10244451 3300009094 Bacteria 2089
138 Ga0105245_10251248 3300009098 Bacteria 1718
139 Ga0105245_10681560 3300009098 Bacteria 1060
140 Ga0105245_11402222 3300009098 Bacteria 749
141 Ga0105247_10037076 3300009101 Bacteria 2974
142 Ga0105247_10093456 3300009101 Bacteria 1912
143 Ga0105247_10252371 3300009101 Bacteria 1206
144 Ga0114129_10014611 3300009147 Bacteria 11188
145 Ga0114129_10018464 3300009147 Bacteria 9934
146 Ga0114129_10053679 3300009147 Bacteria 5653
147 Ga0114129_10747813 3300009147 Bacteria 1252
148 Ga0114129_10751851 3300009147 Bacteria 1248
149 Ga0114129_11314397 3300009147 Bacteria 896
150 Ga0114129_12754912 3300009147 Bacteria 585
151 Ga0105243_10072216 3300009148 Bacteria 2793
152 Ga0105243_10863941 3300009148 Bacteria 897
153 Ga0105241_10004901 3300009174 Bacteria 9872
154 Ga0105241_10082389 3300009174 Bacteria 2521
155 Ga0105242_10050465 3300009176 Bacteria 3387
156 Ga0105242_10088116 3300009176 Bacteria 2607
157 Ga0105242_10095366 3300009176 Bacteria 2511
158 Ga0105242_12595662 3300009176 Bacteria 556
159 Ga0105248_10016703 3300009177 Bacteria 8080
160 Ga0105248_10105109 3300009177 Bacteria 3183
161 Ga0105248_10131281 3300009177 Bacteria 2826
162 Ga0105248_10219748 3300009177 Bacteria 2139
163 Ga0105248_10994150 3300009177 Bacteria 948
164 Ga0105237_10007563 3300009545 Bacteria 11875
165 Ga0105237_10265903 3300009545 Bacteria 1718
166 Ga0105238_10023968 3300009551 Bacteria 6222
167 Ga0105238_10596671 3300009551 Bacteria 1112
168 Ga0105238_10621610 3300009551 Bacteria 1089
169 Ga0105238_11468180 3300009551 Bacteria 710
170 Ga0105249_10111933 3300009553 Bacteria 2581
171 Ga0105239_10084586 3300010375 Bacteria 3494
172 Ga0105239_10095116 3300010375 Bacteria 3291
173 Ga0105239_10290497 3300010375 Bacteria 1841
174 Ga0105239_10830208 3300010375 Bacteria 1059
175 Ga0105239_10900287 3300010375 Bacteria 1016
176 Ga0105246_10157177 3300011119 Unclassified 1728
177 Ga0105246_10164490 3300011119 Bacteria 1693
178 Ga0105246_10429306 3300011119 Bacteria 1105
179 Ga0157373_10526973 3300013100 Bacteria 855
180 Ga0157371_10255416 3300013102 Bacteria 1263
181 Ga0157370_10169793 3300013104 Bacteria 2028
182 Ga0157370_10172784 3300013104 Bacteria 2008
183 Ga0157370_10984598 3300013104 Bacteria 764
184 Ga0157369_10294707 3300013105 Bacteria 1688
185 Ga0157369_10431371 3300013105 Bacteria 1366
186 Ga0157369_10678418 3300013105 Bacteria 1062
187 Ga0157374_10037668 3300013296 Bacteria 4440
188 Ga0157374_10070419 3300013296 Bacteria 3295
189 Ga0157374_10116705 3300013296 Unclassified 2572
190 Ga0157374_10785018 3300013296 Bacteria 968
191 Ga0157374_11546171 3300013296 Bacteria 687
192 Ga0157378_10005847 3300013297 Bacteria 10781
193 Ga0157378_10017861 3300013297 Bacteria 6226
194 Ga0157378_10284868 3300013297 Bacteria 1594
195 Ga0157378_10923679 3300013297 Bacteria 904
196 Ga0157378_11967509 3300013297 Bacteria 634
197 Ga0163162_10112464 3300013306 Bacteria 2821
198 Ga0163162_10346429 3300013306 Bacteria 1618
199 Ga0163162_11765998 3300013306 Unclassified 707
200 Ga0157372_10130575 3300013307 Bacteria 2890
201 Ga0157372_10200042 3300013307 Bacteria 2314
202 Ga0157372_10293508 3300013307 Bacteria 1891
203 Ga0157372_10350903 3300013307 Bacteria 1719
204 Ga0157375_10006070 3300013308 Bacteria 10538
205 Ga0157375_10049954 3300013308 Bacteria 4101
206 Ga0157375_10271346 3300013308 Bacteria 1859
207 Ga0163163_10309771 3300014325 Bacteria 1632
208 Ga0163163_10361854 3300014325 Bacteria 1507
209 Ga0157380_11170801 3300014326 Bacteria 811
210 Ga0157377_10262497 3300014745 Bacteria 1124
211 Ga0157379_10023299 3300014968 Bacteria 5493
212 Ga0157379_10118300 3300014968 Bacteria 2383
213 Ga0157379_10244968 3300014968 Bacteria 1626
214 Ga0157376_10063664 3300014969 Bacteria 3108
215 Ga0157376_10360946 3300014969 Bacteria 1393
216 Ga0157376_10761883 3300014969 Bacteria 978
217 Ga0157376_11189507 3300014969 Bacteria 790
218 Ga0182005_1042836 3300015265 Bacteria 1230
219 Ga0207666_1010380 3300025271 Bacteria 1273
220 Ga0207697_10000173 3300025315 Bacteria 32981
221 Ga0207697_10195467 3300025315 Bacteria 889
222 Ga0207642_10102160 3300025899 Bacteria 1442
223 Ga0207688_10007915 3300025901 Bacteria 5785
224 Ga0207645_10016805 3300025907 Bacteria 4838
225 Ga0207705_10341692 3300025909 Bacteria 1152
226 Ga0207654_10014094 3300025911 Bacteria 4125
227 Ga0207707_10111879 3300025912 Bacteria 2387
228 Ga0207695_10003747 3300025913 Bacteria 21137
229 Ga0207695_10025050 3300025913 Bacteria 6692
230 Ga0207695_10045629 3300025913 Bacteria 4650
231 Ga0207695_10045878 3300025913 Bacteria 4635
232 Ga0207695_10104126 3300025913 Bacteria 2828
233 Ga0207671_10021522 3300025914 Bacteria 4889
234 Ga0207671_10044095 3300025914 Bacteria 3298
235 Ga0207671_10162139 3300025914 Bacteria 1732
236 Ga0207671_10738935 3300025914 Bacteria 782
237 Ga0207671_10949359 3300025914 Bacteria 679
238 Ga0207662_10369721 3300025918 Bacteria 967
239 Ga0207657_10046799 3300025919 Bacteria 3788
240 Ga0207652_10264124 3300025921 Bacteria 1553
241 Ga0207652_10587638 3300025921 Bacteria 999
242 Ga0207646_10019358 3300025922 Bacteria 6328
243 Ga0207646_10153518 3300025922 Bacteria 2076
244 Ga0207646_10207476 3300025922 Bacteria 1770
245 Ga0207646_10521504 3300025922 Bacteria 1070
246 Ga0207646_10718046 3300025922 Bacteria 893
247 Ga0207694_10014336 3300025924 Bacteria 5976
248 Ga0207694_10419275 3300025924 Bacteria 1115
249 Ga0207650_10098636 3300025925 Bacteria 2245
250 Ga0207650_10228810 3300025925 Bacteria 1499
251 Ga0207659_10026197 3300025926 Bacteria 3932
252 Ga0207687_10725959 3300025927 Bacteria 844
253 Ga0207644_10134521 3300025931 Bacteria 1897
254 Ga0207644_10227184 3300025931 Bacteria 1482
255 Ga0207644_10518538 3300025931 Bacteria 984
256 Ga0207690_10103710 3300025932 Bacteria 2036
257 Ga0207670_10000002 3300025936 Bacteria 783058
258 Ga0207670_10000012 3300025936 Bacteria 246808
259 Ga0207670_10263964 3300025936 Bacteria 1336
260 Ga0207669_10042111 3300025937 Bacteria 2663
261 Ga0207704_10174511 3300025938 Bacteria 1546
262 Ga0207691_10754003 3300025940 Bacteria 819
263 Ga0207711_10064760 3300025941 Bacteria 3158
264 Ga0207711_10106196 3300025941 Bacteria 2491
265 Ga0207711_10631861 3300025941 Bacteria 999
266 Ga0207689_10626485 3300025942 Bacteria 906
267 Ga0207661_10078568 3300025944 Bacteria 2717
268 Ga0207661_10287051 3300025944 Bacteria 1472
269 Ga0207661_10288691 3300025944 Bacteria 1468
270 Ga0207661_11015252 3300025944 Bacteria 764
271 Ga0207661_11282421 3300025944 Bacteria 673
272 Ga0207679_10030460 3300025945 Bacteria 3768
273 Ga0207679_10034339 3300025945 Bacteria 3577
274 Ga0207679_10363743 3300025945 Bacteria 1264
275 Ga0207679_10457720 3300025945 Bacteria 1132
276 Ga0207679_11993590 3300025945 Bacteria 528
277 Ga0207679_12176906 3300025945 Bacteria 503
278 Ga0207667_10039807 3300025949 Bacteria 5006
279 Ga0207667_10049769 3300025949 Bacteria 4424
280 Ga0207667_10212252 3300025949 Bacteria 1984
281 Ga0207651_10654016 3300025960 Bacteria 923
282 Ga0207651_12005726 3300025960 Bacteria 520
283 Ga0207640_11739770 3300025981 Bacteria 563
284 Ga0207677_10008313 3300026023 Bacteria 5787
285 Ga0207677_10145591 3300026023 Bacteria 1820
286 Ga0207703_10001937 3300026035 Bacteria 18323
287 Ga0207703_10037266 3300026035 Bacteria 3873
288 Ga0207703_10998975 3300026035 Bacteria 803
289 Ga0207639_10036972 3300026041 Bacteria 3623
290 Ga0207639_10483036 3300026041 Bacteria 1129
291 Ga0207678_10189061 3300026067 Bacteria 1759
292 Ga0207702_10020443 3300026078 Bacteria 5484
293 Ga0207702_10041493 3300026078 Bacteria 3859
294 Ga0207702_10087494 3300026078 Bacteria 2720
295 Ga0207648_10374689 3300026089 Bacteria 1286
296 Ga0207674_10016506 3300026116 Bacteria 8081
297 Ga0207675_100217558 3300026118 Bacteria 1840
298 Ga0207683_10086652 3300026121 Bacteria 2784
299 Ga0207428_10602153 3300027907 Bacteria 792
300 Ga0268266_10004587 3300028379 Bacteria 13190
301 Ga0268266_10211401 3300028379 Bacteria 1779
302 Ga0268266_10458147 3300028379 Bacteria 1213
303 Ga0268264_10841290 3300028381 Bacteria 919
304 Ga0268264_10918900 3300028381 Bacteria 879
305 Ga0265336_10025059 3300028666 Bacteria 1880
306 Ga0265338_10047899 3300028800 Bacteria 3896
307 Ga0265338_10169526 3300028800 Bacteria 1676
308 Ga0265332_10071452 3300031238 Bacteria 1478
309 Ga0265332_10140063 3300031238 Bacteria 1014
310 Ga0265320_10025873 3300031240 Bacteria 3079
311 Ga0265325_10069848 3300031241 Bacteria 1765
312 Ga0265340_10001919 3300031247 Bacteria 11878
313 Ga0265339_10005596 3300031249 Bacteria 8345
314 Ga0265327_10334412 3300031251 Bacteria 663
315 Ga0265316_10187562 3300031344 Bacteria 1538
316 Ga0265314_10203779 3300031711 Bacteria 1167
317 Ga0265342_10002056 3300031712 Bacteria 17870
318 Ga0307405_10264235 3300031731 Bacteria 1287
319 Ga0307413_10292404 3300031824 Bacteria 1231
320 Ga0307406_10335624 3300031901 Bacteria 1175
321 Ga0307407_10117357 3300031903 Bacteria 1681
322 Ga0307409_100350603 3300031995 Bacteria 1393
323 Ga0307409_100436971 3300031995 Bacteria 1260
324 Ga0307416_100138336 3300032002 Bacteria 2208
325 Ga0373930_0000190 3300034816 Bacteria 7423
326 Ga0373958_0001725 3300034819 Bacteria 2969
327 Ga0373959_0002213 3300034820 Bacteria 3100
328 Ga0373928_0016570 3300035084 Bacteria 1509
329 Ga0373929_0002028 3300035085 Bacteria 3770
330 Ga0373940_0002904 3300035088 Bacteria 3415
331 Ga0373949_0003873 3300035090 Bacteria 3477
332 Ga0373951_0000928 3300035091 Bacteria 7886
333 Ga0373952_0000354 3300035092 Bacteria 7749
334 Ga0373923_0515455 3300035111 Bacteria 584
335 Ga0373932_0000157 3300035112 Bacteria 19830
336 Ga0373939_0000138 3300035114 Bacteria 20969
337 Ga0373941_0006216 3300035115 Bacteria 2865
338 Ga0373953_0115664 3300035117 Bacteria 1137
339 Ga0373954_0030358 3300035118 Bacteria 2492
340 Ga0373960_0001327 3300035121 Bacteria 5444
341 Ga0373943_0008200 3300035170 Bacteria 4689
342 Ga0373942_0001220 3300035207 Bacteria 6767
343 Ga0373961_0031744 3300035241 Bacteria 1477
344 Ga0373962_0000383 3300035242 Bacteria 9648
345 Ga0373931_0003364 3300035691 Bacteria 7168
346 Ga0373935_0374018 3300035692 Unclassified 1019
347 Ga0373933_0005592 3300035724 Bacteria 6848
348 Ga0373933_0106380 3300035724 Bacteria 1746
349 Ga0373937_0020221 3300036401 Bacteria 5967
350 Ga0373937_0488243 3300036401 Bacteria 1170
351 Ga0373937_0584231 3300036401 Bacteria 1061
352 Ga0373937_0666696 3300036401 Unclassified 986
353 Ga0373937_0903175 3300036401 Bacteria 832
354 Ga0373937_0950083 3300036401 Bacteria 808
355 Ga0373937_0983606 3300036401 Bacteria 792
356 Ga0373925_0240363 3300037068 Bacteria 1450
357 Ga0373925_1768906 3300037068 Bacteria 504
358 Ga0395899_0000019 3300037312 Bacteria 411777
359 Ga0436364_1460136 3300037853 Bacteria 559
360 Ga0395901_0783806 3300038443 Bacteria 944
361 Ga0450893_0123964 3300042532 Bacteria 541
362 Ga0466966_0031693 3300044684 Bacteria 3428
363 Ga0466970_0332934 3300044765 Bacteria 860
364 Ga0466959_0005273 3300045049 Bacteria 8831
365 Ga0451576_0009094 3300045051 Bacteria 11560
366 Ga0451576_0062809 3300045051 Bacteria 3871
367 Ga0495592_0010328 3300046454 Bacteria 7038
368 Ga0495592_0012697 3300046454 Bacteria 6402
369 Ga0495592_0222510 3300046454 Bacteria 1261
370 Ga0495629_0625001 3300046459 Bacteria 719
371 Ga0495651_0019400 3300046462 Bacteria 5270
372 Ga0495651_0305973 3300046462 Bacteria 1065
373 Ga0495653_0023865 3300046463 Bacteria 4937
374 Ga0495653_0232733 3300046463 Bacteria 1232
375 Ga0495580_0116131 3300046472 Bacteria 1859
376 Ga0495582_0100246 3300046473 Bacteria 1621
377 Ga0495662_0089186 3300046476 Bacteria 1502
378 Ga0495662_0234314 3300046476 Unclassified 905
379 Ga0495664_0009481 3300046477 Bacteria 5448
380 Ga0495594_0043164 3300046499 Bacteria 2471
381 Ga0495608_0100893 3300046511 Bacteria 1861
382 Ga0495608_0336005 3300046511 Bacteria 931
383 Ga0495618_0320603 3300046514 Bacteria 960
384 Ga0495628_0031632 3300046516 Bacteria 4279
385 Ga0495628_0031961 3300046516 Bacteria 4253
386 Ga0495628_0383723 3300046516 Bacteria 1028
387 Ga0495630_0001715 3300046517 Bacteria 15275
388 Ga0495630_0098503 3300046517 Bacteria 2211
389 Ga0495630_0118473 3300046517 Bacteria 2008
390 Ga0495630_0433423 3300046517 Bacteria 1007
391 Ga0495642_0037283 3300046528 Bacteria 1967
392 Ga0495642_0496577 3300046528 Bacteria 540
393 Ga0495652_0005289 3300046529 Bacteria 12170
394 Ga0495652_0013888 3300046529 Bacteria 7244
395 Ga0495665_0131718 3300046531 Bacteria 1309
396 Ga0495665_0273764 3300046531 Bacteria 867
397 Ga0495640_0058582 3300046533 Bacteria 2626
398 Ga0495640_0259525 3300046533 Bacteria 1086
399 Ga0495586_0050873 3300046535 Bacteria 2242
400 Ga0495586_0062284 3300046535 Bacteria 2030
401 Ga0495586_0228772 3300046535 Bacteria 1058
402 Ga0495587_0318792 3300046536 Bacteria 868
403 Ga0495645_0004376 3300046543 Bacteria 9646
404 Ga0495645_0012448 3300046543 Bacteria 5995
405 Ga0495645_0045675 3300046543 Bacteria 3196
406 Ga0495645_0093075 3300046543 Bacteria 2152
407 Ga0495645_0559087 3300046543 Bacteria 708
408 Ga0495622_0131859 3300046557 Bacteria 1138
409 Ga0495667_0072161 3300046559 Bacteria 2251
410 Ga0495667_0288240 3300046559 Bacteria 1041
411 Ga0495634_0079517 3300046642 Bacteria 2147
412 Ga0495634_0373011 3300046642 Bacteria 851
413 Ga0495634_0623057 3300046642 Bacteria 625
414 Ga0495635_0125875 3300046663 Bacteria 1747
415 Ga0495635_0134835 3300046663 Bacteria 1683
416 Ga0495659_0005932 3300046664 Bacteria 3863
417 Ga0495657_0298040 3300046675 Bacteria 962
418 Ga0495599_0009115 3300046678 Bacteria 6050
419 Ga0495623_0008411 3300046679 Bacteria 6706
420 Ga0495623_0023472 3300046679 Bacteria 3981
421 Ga0495646_0031461 3300046680 Bacteria 3306
422 Ga0495647_0047070 3300046681 Bacteria 1663
423 Ga0495647_0048000 3300046681 Bacteria 1649
424 Ga0495647_0117742 3300046681 Bacteria 1115
425 Ga0495658_0007509 3300046683 Bacteria 5400
426 Ga0495658_0034712 3300046683 Bacteria 2769
427 Ga0495669_0040346 3300046684 Bacteria 2070
428 Ga0495613_0000501 3300046689 Bacteria 33165
429 Ga0495613_0315689 3300046689 Bacteria 1079
430 Ga0495613_0392185 3300046689 Bacteria 948
431 Ga0495600_0024267 3300046809 Bacteria 3903
432 Ga0495600_0286281 3300046809 Bacteria 1042
433 Ga0495600_0519598 3300046809 Unclassified 730
434 Ga0495604_0043490 3300047317 Bacteria 3516
435 Ga0495604_0054215 3300047317 Bacteria 3095
436 Ga0495604_0163604 3300047317 Bacteria 1570
437 Ga0495674_0026206 3300047319 Bacteria 5336
438 Ga0495674_0060670 3300047319 Bacteria 3299
439 Ga0495674_0776331 3300047319 Bacteria 747
440 Ga0495674_1006766 3300047319 Bacteria 638
441 Ga0495676_0408297 3300047321 Bacteria 900
442 Ga0495680_0029148 3300047322 Bacteria 4522
443 Ga0495680_0042118 3300047322 Bacteria 3626
444 Ga0495680_0216762 3300047322 Bacteria 1368
445 Ga0495680_0221233 3300047322 Bacteria 1351
446 Ga0495680_0368071 3300047322 Unclassified 998
447 Ga0495675_0030348 3300047444 Bacteria 3449
448 Ga0495675_0092974 3300047444 Bacteria 1892
449 Ga0495685_144491 3300047447 Bacteria 774
450 Ga0495684_0000965 3300047471 Bacteria 23436
451 Ga0495684_0000985 3300047471 Bacteria 23151
452 Ga0495686_0477423 3300047472 Bacteria 659
453 Ga0495593_0443683 3300047673 Bacteria 649
454 Ga0495602_0052199 3300048088 Bacteria 3634
455 Ga0495602_0060547 3300048088 Bacteria 3298
456 Ga0495614_0397125 3300048089 Bacteria 647
457 Ga0496100_0056589 3300048903 Bacteria 2566
458 Ga0496100_0361963 3300048903 Bacteria 1098
459 Ga0496101_0017382 3300048904 Bacteria 4879
460 Ga0496102_0041163 3300048905 Bacteria 4183
461 Ga0496102_1783886 3300048905 Bacteria 533
462 Ga0496104_0004247 3300048907 Bacteria 12444
463 Ga0496104_0036250 3300048907 Bacteria 4611
464 Ga0496105_0317164 3300048908 Bacteria 1250
465 Ga0496107_0021957 3300048910 Bacteria 4509
466 Ga0496107_0523554 3300048910 Bacteria 879
467 Ga0496108_0607706 3300048911 Bacteria 953
468 Ga0496108_1581274 3300048911 Bacteria 543
469 Ga0496109_0105997 3300048912 Bacteria 2611
470 Ga0496109_0290550 3300048912 Bacteria 1541
471 Ga0496110_0142980 3300048913 Bacteria 2163
472 Ga0496113_0835433 3300048916 Bacteria 731
473 Ga0496114_0002088 3300048917 Bacteria 15192
474 Ga0496114_0022030 3300048917 Bacteria 5188
475 Ga0496115_0047999 3300048918 Bacteria 3415
476 Ga0496115_0218513 3300048918 Bacteria 1573
477 Ga0496122_0044838 3300048925 Bacteria 3446
478 Ga0496123_0025405 3300048926 Bacteria 4467
479 Ga0496125_0061258 3300048928 Bacteria 3019
480 Ga0496126_0556773 3300048929 Bacteria 909
481 Ga0495678_187849 3300049459 Bacteria 644
482 Ga0501031_0023510 3300049568 Bacteria 4017
483 Ga0501032_0006619 3300049569 Bacteria 8506
484 Ga0501033_0033473 3300049570 Bacteria 3857
485 Ga0501034_0631203 3300049571 Bacteria 974
486 Ga0501036_0009240 3300049572 Bacteria 8105
487 Ga0501037_0001053 3300049573 Bacteria 20410
488 Ga0501038_0001986 3300049574 Bacteria 18917
489 Ga0501039_0009525 3300049575 Bacteria 7403
490 Ga0501043_0001018 3300049579 Bacteria 24636
491 Ga0501046_0000258 3300049580 Bacteria 53994
492 Ga0501046_0396966 3300049580 Bacteria 997
493 Ga0501047_0000977 3300049581 Bacteria 28782
494 Ga0501068_0105988 3300049584 Bacteria 1745
495 Ga0501069_0109389 3300049585 Bacteria 1573
496 Ga0501073_0016701 3300049589 Bacteria 5318
497 Ga0501073_1081196 3300049589 Bacteria 551
498 Ga0501074_0164907 3300049590 Bacteria 1582
499 Ga0501074_0874693 3300049590 Bacteria 633
500 Ga0501075_0293412 3300049591 Bacteria 1239
501 Ga0501076_0912039 3300049592 Bacteria 724
502 Ga0501080_0014125 3300049742 Bacteria 7350
503 Ga0501035_0080665 3300049822 Bacteria 2872
504 Ga0501044_0020441 3300049823 Bacteria 7069
505 Ga0501044_0428637 3300049823 Bacteria 1232
506 Ga0501045_0538802 3300049824 Bacteria 866
507 nmdc:mga03683_207867_c1 3300050489 Bacteria 900
508 nmdc:mga03683_419311_c1 3300050489 Bacteria 641
509 nmdc:mga00v17_721694_c1 3300050491 Bacteria 638
510 nmdc:mga0k408_659704_c1 3300050493 Bacteria 615
511 nmdc:mga05p37_110882_c2 3300050507 Bacteria 2898
512 nmdc:mga05p37_1163168_c1 3300050507 Bacteria 801
513 nmdc:mga05p37_118491_c1 3300050507 Bacteria 3253
514 nmdc:mga05p37_19171_c1 3300050507 Bacteria 8274
515 nmdc:mga05p37_3539_c1 3300050507 Bacteria 18225
516 nmdc:mga05p37_366953_c1 3300050507 Bacteria 1691
517 nmdc:mga09592_622283_c1 3300050508 Bacteria 924
518 nmdc:mga0qj67_172671_c1 3300050509 Bacteria 1755
519 nmdc:mga06r32_240521_c1 3300050510 Bacteria 1798
520 nmdc:mga06r32_48184_c1 3300050510 Bacteria 4073
521 nmdc:mga08y16_102464_c1 3300050511 Bacteria 2980
522 nmdc:mga08y16_433823_c1 3300050511 Bacteria 1342
523 nmdc:mga0n895_10417_c1 3300050512 Bacteria 8210
524 nmdc:mga0n895_104199_c1 3300050512 Bacteria 2849
525 nmdc:mga0rr50_15448_c1 3300050513 Bacteria 5042
526 nmdc:mga0rr50_46356_c1 3300050513 Bacteria 3200
527 nmdc:mga0rr50_67727_c1 3300050513 Bacteria 2713
528 nmdc:mga08x19_1124062_c1 3300050514 Bacteria 557
529 nmdc:mga08x19_490821_c1 3300050514 Bacteria 866
530 nmdc:mga08x19_6557_c1 3300050514 Bacteria 6896
531 nmdc:mga0a205_1046866_c1 3300050515 Bacteria 663
532 nmdc:mga0a205_41606_c1 3300050515 Bacteria 4426
533 nmdc:mga0a205_595710_c1 3300050515 Bacteria 959
534 Ga0495601_0051819 3300053077 Bacteria 2591
535 Ga0495601_0074277 3300053077 Bacteria 2175
536 Ga0495601_0265388 3300053077 Bacteria 1120
537 Ga0495601_0382164 3300053077 Bacteria 914
538 Ga0495595_0064272 3300053084 Bacteria 1724
539 Ga0495595_0215182 3300053084 Bacteria 958
540 Ga0495595_0521376 3300053084 Bacteria 606
541 Ga0495619_0004782 3300053085 Bacteria 8613
542 Ga0495619_0006716 3300053085 Bacteria 7279
543 Ga0495619_0006938 3300053085 Bacteria 7163
544 Ga0495619_0138076 3300053085 Bacteria 1677
545 Ga0500583_0433699 3300053092 Bacteria 626
546 Ga0587076_018069 3300059645 Bacteria 1132
547 Ga0587079_159391 3300059647 Bacteria 589
548 Ga0530510_0395037 3300061734 Bacteria 1042

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046543 Ga0495645_0093075 Ga0495645_0093075_1173_1733 117
2 3300005617 Ga0068859_100977571 Ga0068859_1009775712 124
3 3300006931 Ga0097620_100977415 Ga0097620_1009774152 124
4 3300046681 Ga0495647_0047070 Ga0495647_0047070_1089_1586 128
5 3300049569 Ga0501032_0006619 Ga0501032_0006619_1518_1958 129
6 3300049572 Ga0501036_0009240 Ga0501036_0009240_809_1249 129
7 3300049573 Ga0501037_0001053 Ga0501037_0001053_19731_20171 129
8 3300049574 Ga0501038_0001986 Ga0501038_0001986_3282_3722 129
9 3300049579 Ga0501043_0001018 Ga0501043_0001018_3405_3845 129
10 3300049584 Ga0501068_0105988 Ga0501068_0105988_104_544 129
11 3300049590 Ga0501074_0164907 Ga0501074_0164907_950_1390 129
12 3300006237 Ga0097621_101999760 Ga0097621_1019997601 130
13 3300006358 Ga0068871_100808094 Ga0068871_1008080941 130
14 3300009093 Ga0105240_10003190 Ga0105240_1000319026 130
15 3300009098 Ga0105245_10681560 Ga0105245_106815602 130
16 3300010375 Ga0105239_10900287 Ga0105239_109002871 130
17 3300011119 Ga0105246_10429306 Ga0105246_104293062 130
18 3300014968 Ga0157379_10023299 Ga0157379_100232991 130
19 3300025927 Ga0207687_10725959 Ga0207687_107259592 130
20 3300025931 Ga0207644_10518538 Ga0207644_105185382 130
21 3300036401 Ga0373937_0950083 Ga0373937_0950083_279_713 130
22 3300048929 Ga0496126_0556773 Ga0496126_0556773_182_613 130
23 3300049823 Ga0501044_0428637 Ga0501044_0428637_271_699 130
24 3300005466 Ga0070685_10129576 Ga0070685_101295762 131
25 3300005563 Ga0068855_100310169 Ga0068855_1003101694 131
26 3300005614 Ga0068856_100251061 Ga0068856_1002510613 131
27 3300005617 Ga0068859_100034183 Ga0068859_1000341834 131
28 3300005842 Ga0068858_100002668 Ga0068858_10000266816 131
29 3300006931 Ga0097620_100034180 Ga0097620_1000341804 131
30 3300009093 Ga0105240_10021753 Ga0105240_100217537 131
31 3300009101 Ga0105247_10252371 Ga0105247_102523711 131
32 3300009147 Ga0114129_12754912 Ga0114129_127549122 131
33 3300009177 Ga0105248_10016703 Ga0105248_100167038 131
34 3300009551 Ga0105238_11468180 Ga0105238_114681802 131
35 3300010375 Ga0105239_10095116 Ga0105239_100951165 131
36 3300014968 Ga0157379_10244968 Ga0157379_102449682 131
37 3300025913 Ga0207695_10025050 Ga0207695_100250508 131
38 3300025914 Ga0207671_10162139 Ga0207671_101621392 131
39 3300025924 Ga0207694_10419275 Ga0207694_104192752 131
40 3300025941 Ga0207711_10106196 Ga0207711_101061962 131
41 3300025949 Ga0207667_10212252 Ga0207667_102122521 131
42 3300026035 Ga0207703_10001937 Ga0207703_1000193711 131
43 3300026078 Ga0207702_10087494 Ga0207702_100874945 131
44 3300005336 Ga0070680_100024536 Ga0070680_1000245363 132
45 3300005458 Ga0070681_10360312 Ga0070681_103603122 132
46 3300005530 Ga0070679_100054622 Ga0070679_1000546226 132
47 3300005535 Ga0070684_100133335 Ga0070684_1001333351 132
48 3300005719 Ga0068861_100189500 Ga0068861_1001895002 132
49 3300006038 Ga0075365_10070994 Ga0075365_100709943 132
50 3300006847 Ga0075431_101652549 Ga0075431_1016525491 132
51 3300006852 Ga0075433_10005620 Ga0075433_1000562014 132
52 3300006871 Ga0075434_100034229 Ga0075434_1000342296 132
53 3300006914 Ga0075436_100008890 Ga0075436_1000088905 132
54 3300007076 Ga0075435_100027708 Ga0075435_1000277085 132
55 3300009147 Ga0114129_10018464 Ga0114129_100184649 132
56 3300009147 Ga0114129_10053679 Ga0114129_100536797 132
57 3300013104 Ga0157370_10169793 Ga0157370_101697931 132
58 3300013296 Ga0157374_10116705 Ga0157374_101167054 132
59 3300013306 Ga0163162_11765998 Ga0163162_117659981 132
60 3300014969 Ga0157376_10360946 Ga0157376_103609462 132
61 3300025922 Ga0207646_10019358 Ga0207646_100193582 132
62 3300047317 Ga0495604_0043490 Ga0495604_0043490_1564_1998 132
63 3300047444 Ga0495675_0030348 Ga0495675_0030348_1148_1582 132
64 3300050489 nmdc:mga03683_207867_c1 nmdc:mga03683_207867_c1_73_513 132
65 3300050489 nmdc:mga03683_419311_c1 nmdc:mga03683_419311_c1_119_559 132
66 3300050491 nmdc:mga00v17_721694_c1 nmdc:mga00v17_721694_c1_22_462 132
67 3300050493 nmdc:mga0k408_659704_c1 nmdc:mga0k408_659704_c1_49_489 132
68 3300050507 nmdc:mga05p37_3539_c1 nmdc:mga05p37_3539_c1_5904_6332 132
69 3300050508 nmdc:mga09592_622283_c1 nmdc:mga09592_622283_c1_125_592 132
70 3300050509 nmdc:mga0qj67_172671_c1 nmdc:mga0qj67_172671_c1_161_628 132
71 3300050510 nmdc:mga06r32_48184_c1 nmdc:mga06r32_48184_c1_1729_2196 132
72 3300050512 nmdc:mga0n895_10417_c1 nmdc:mga0n895_10417_c1_5003_5452 132
73 3300050512 nmdc:mga0n895_104199_c1 nmdc:mga0n895_104199_c1_1212_1679 132
74 3300050513 nmdc:mga0rr50_15448_c1 nmdc:mga0rr50_15448_c1_2334_2783 132
75 3300050513 nmdc:mga0rr50_67727_c1 nmdc:mga0rr50_67727_c1_543_1010 132
76 3300050514 nmdc:mga08x19_6557_c1 nmdc:mga08x19_6557_c1_5794_6243 132
77 3300050515 nmdc:mga0a205_41606_c1 nmdc:mga0a205_41606_c1_2542_2991 132
78 3300005290 Ga0065712_10132493 Ga0065712_101324933 133
79 3300005293 Ga0065715_10869015 Ga0065715_108690151 133
80 3300005295 Ga0065707_10115429 Ga0065707_101154295 133
81 3300005329 Ga0070683_100237802 Ga0070683_1002378022 133
82 3300005330 Ga0070690_100279245 Ga0070690_1002792451 133
83 3300005338 Ga0068868_100053829 Ga0068868_1000538295 133
84 3300005340 Ga0070689_100000101 Ga0070689_10000010117 133
85 3300005356 Ga0070674_100678123 Ga0070674_1006781232 133
86 3300005364 Ga0070673_100483734 Ga0070673_1004837341 133
87 3300005365 Ga0070688_100000001 Ga0070688_10000000119 133
88 3300005367 Ga0070667_100638324 Ga0070667_1006383243 133
89 3300005434 Ga0070709_10134980 Ga0070709_101349802 133
90 3300005437 Ga0070710_10126867 Ga0070710_101268672 133
91 3300005439 Ga0070711_101462076 Ga0070711_1014620761 133
92 3300005456 Ga0070678_100317871 Ga0070678_1003178712 133
93 3300005457 Ga0070662_100030034 Ga0070662_1000300342 133
94 3300005458 Ga0070681_10247445 Ga0070681_102474452 133
95 3300005466 Ga0070685_10092012 Ga0070685_100920125 133
96 3300005471 Ga0070698_101052491 Ga0070698_1010524911 133
97 3300005530 Ga0070679_100137445 Ga0070679_1001374451 133
98 3300005535 Ga0070684_100141544 Ga0070684_1001415442 133
99 3300005539 Ga0068853_100662200 Ga0068853_1006622002 133
100 3300005563 Ga0068855_100097809 Ga0068855_1000978093 133
101 3300005564 Ga0070664_100614192 Ga0070664_1006141922 133
102 3300005578 Ga0068854_100944915 Ga0068854_1009449151 133
103 3300005614 Ga0068856_100017387 Ga0068856_1000173875 133
104 3300005616 Ga0068852_100209420 Ga0068852_1002094203 133
105 3300005617 Ga0068859_101757604 Ga0068859_1017576042 133
106 3300005718 Ga0068866_10026547 Ga0068866_100265472 133
107 3300005718 Ga0068866_10073036 Ga0068866_100730361 133
108 3300005718 Ga0068866_10387482 Ga0068866_103874821 133
109 3300005719 Ga0068861_100555659 Ga0068861_1005556593 133
110 3300005719 Ga0068861_101965896 Ga0068861_1019658961 133
111 3300005841 Ga0068863_100327412 Ga0068863_1003274123 133
112 3300005844 Ga0068862_100329106 Ga0068862_1003291063 133
113 3300005844 Ga0068862_100951623 Ga0068862_1009516233 133
114 3300006028 Ga0070717_10207889 Ga0070717_102078893 133
115 3300006177 Ga0075362_10000363 Ga0075362_100003635 133
116 3300006195 Ga0075366_10022348 Ga0075366_100223484 133
117 3300006237 Ga0097621_100201189 Ga0097621_1002011891 133
118 3300006358 Ga0068871_100046325 Ga0068871_1000463255 133
119 3300006358 Ga0068871_100775412 Ga0068871_1007754122 133
120 3300006852 Ga0075433_10653137 Ga0075433_106531372 133
121 3300006881 Ga0068865_100014987 Ga0068865_1000149876 133
122 3300006931 Ga0097620_100911930 Ga0097620_1009119302 133
123 3300006931 Ga0097620_101757593 Ga0097620_1017575932 133
124 3300009093 Ga0105240_10013677 Ga0105240_100136772 133
125 3300009093 Ga0105240_10050819 Ga0105240_100508192 133
126 3300009098 Ga0105245_10251248 Ga0105245_102512482 133
127 3300009101 Ga0105247_10037076 Ga0105247_100370762 133
128 3300009148 Ga0105243_10072216 Ga0105243_100722166 133
129 3300009174 Ga0105241_10082389 Ga0105241_100823891 133
130 3300009176 Ga0105242_10050465 Ga0105242_100504653 133
131 3300009176 Ga0105242_10088116 Ga0105242_100881164 133
132 3300009177 Ga0105248_10105109 Ga0105248_101051093 133
133 3300009177 Ga0105248_10131281 Ga0105248_101312813 133
134 3300009545 Ga0105237_10007563 Ga0105237_1000756310 133
135 3300009551 Ga0105238_10596671 Ga0105238_105966712 133
136 3300009551 Ga0105238_10621610 Ga0105238_106216101 133
137 3300009553 Ga0105249_10111933 Ga0105249_101119333 133
138 3300010375 Ga0105239_10084586 Ga0105239_100845862 133
139 3300010375 Ga0105239_10290497 Ga0105239_102904974 133
140 3300013104 Ga0157370_10984598 Ga0157370_109845982 133
141 3300013105 Ga0157369_10431371 Ga0157369_104313712 133
142 3300013105 Ga0157369_10678418 Ga0157369_106784182 133
143 3300013296 Ga0157374_10037668 Ga0157374_100376683 133
144 3300013296 Ga0157374_10785018 Ga0157374_107850182 133
145 3300013296 Ga0157374_11546171 Ga0157374_115461712 133
146 3300013297 Ga0157378_10005847 Ga0157378_100058476 133
147 3300013297 Ga0157378_10284868 Ga0157378_102848682 133
148 3300013297 Ga0157378_10923679 Ga0157378_109236792 133
149 3300013297 Ga0157378_11967509 Ga0157378_119675091 133
150 3300013306 Ga0163162_10112464 Ga0163162_101124646 133
151 3300013306 Ga0163162_10346429 Ga0163162_103464294 133
152 3300013307 Ga0157372_10130575 Ga0157372_101305752 133
153 3300013307 Ga0157372_10293508 Ga0157372_102935082 133
154 3300013308 Ga0157375_10006070 Ga0157375_100060709 133
155 3300013308 Ga0157375_10049954 Ga0157375_100499542 133
156 3300014325 Ga0163163_10309771 Ga0163163_103097713 133
157 3300014326 Ga0157380_11170801 Ga0157380_111708012 133
158 3300014745 Ga0157377_10262497 Ga0157377_102624973 133
159 3300014969 Ga0157376_10761883 Ga0157376_107618832 133
160 3300014969 Ga0157376_11189507 Ga0157376_111895072 133
161 3300025899 Ga0207642_10102160 Ga0207642_101021602 133
162 3300025912 Ga0207707_10111879 Ga0207707_101118792 133
163 3300025913 Ga0207695_10003747 Ga0207695_100037474 133
164 3300025913 Ga0207695_10045629 Ga0207695_100456295 133
165 3300025913 Ga0207695_10045878 Ga0207695_100458782 133
166 3300025913 Ga0207695_10104126 Ga0207695_101041263 133
167 3300025914 Ga0207671_10021522 Ga0207671_100215223 133
168 3300025914 Ga0207671_10044095 Ga0207671_100440952 133
169 3300025914 Ga0207671_10738935 Ga0207671_107389351 133
170 3300025918 Ga0207662_10369721 Ga0207662_103697211 133
171 3300025921 Ga0207652_10264124 Ga0207652_102641241 133
172 3300025922 Ga0207646_10718046 Ga0207646_107180462 133
173 3300025936 Ga0207670_10000012 Ga0207670_1000001263 133
174 3300025936 Ga0207670_10263964 Ga0207670_102639642 133
175 3300025941 Ga0207711_10064760 Ga0207711_100647604 133
176 3300025941 Ga0207711_10631861 Ga0207711_106318612 133
177 3300025942 Ga0207689_10626485 Ga0207689_106264851 133
178 3300025944 Ga0207661_10287051 Ga0207661_102870512 133
179 3300025944 Ga0207661_10288691 Ga0207661_102886913 133
180 3300025944 Ga0207661_11282421 Ga0207661_112824212 133
181 3300025945 Ga0207679_10363743 Ga0207679_103637433 133
182 3300025945 Ga0207679_10457720 Ga0207679_104577202 133
183 3300025945 Ga0207679_12176906 Ga0207679_121769061 133
184 3300025949 Ga0207667_10039807 Ga0207667_100398075 133
185 3300026078 Ga0207702_10020443 Ga0207702_100204433 133
186 3300026118 Ga0207675_100217558 Ga0207675_1002175584 133
187 3300028379 Ga0268266_10211401 Ga0268266_102114012 133
188 3300028381 Ga0268264_10841290 Ga0268264_108412902 133
189 3300028666 Ga0265336_10025059 Ga0265336_100250593 133
190 3300028800 Ga0265338_10047899 Ga0265338_100478995 133
191 3300028800 Ga0265338_10169526 Ga0265338_101695263 133
192 3300031238 Ga0265332_10071452 Ga0265332_100714523 133
193 3300031238 Ga0265332_10140063 Ga0265332_101400633 133
194 3300031240 Ga0265320_10025873 Ga0265320_100258735 133
195 3300031241 Ga0265325_10069848 Ga0265325_100698484 133
196 3300031247 Ga0265340_10001919 Ga0265340_1000191912 133
197 3300031249 Ga0265339_10005596 Ga0265339_100055963 133
198 3300031251 Ga0265327_10334412 Ga0265327_103344122 133
199 3300031344 Ga0265316_10187562 Ga0265316_101875621 133
200 3300031711 Ga0265314_10203779 Ga0265314_102037793 133
201 3300031712 Ga0265342_10002056 Ga0265342_1000205612 133
202 3300031995 Ga0307409_100436971 Ga0307409_1004369712 133
203 3300035111 Ga0373923_0515455 Ga0373923_0515455_23_451 133
204 3300035117 Ga0373953_0115664 Ga0373953_0115664_363_791 133
205 3300035118 Ga0373954_0030358 Ga0373954_0030358_493_921 133
206 3300035170 Ga0373943_0008200 Ga0373943_0008200_102_530 133
207 3300035724 Ga0373933_0005592 Ga0373933_0005592_1622_2050 133
208 3300036401 Ga0373937_0020221 Ga0373937_0020221_3671_4099 133
209 3300036401 Ga0373937_0584231 Ga0373937_0584231_501_941 133
210 3300036401 Ga0373937_0903175 Ga0373937_0903175_309_755 133
211 3300037068 Ga0373925_0240363 Ga0373925_0240363_225_653 133
212 3300037853 Ga0436364_1460136 Ga0436364_1460136_66_518 133
213 3300038443 Ga0395901_0783806 Ga0395901_0783806_102_530 133
214 3300046454 Ga0495592_0012697 Ga0495592_0012697_606_1034 133
215 3300046454 Ga0495592_0222510 Ga0495592_0222510_300_731 133
216 3300046462 Ga0495651_0019400 Ga0495651_0019400_1218_1646 133
217 3300046463 Ga0495653_0232733 Ga0495653_0232733_161_589 133
218 3300046472 Ga0495580_0116131 Ga0495580_0116131_1356_1784 133
219 3300046476 Ga0495662_0089186 Ga0495662_0089186_1054_1482 133
220 3300046477 Ga0495664_0009481 Ga0495664_0009481_4614_5054 133
221 3300046514 Ga0495618_0320603 Ga0495618_0320603_302_733 133
222 3300046516 Ga0495628_0031632 Ga0495628_0031632_1217_1645 133
223 3300046517 Ga0495630_0098503 Ga0495630_0098503_715_1143 133
224 3300046528 Ga0495642_0496577 Ga0495642_0496577_43_471 133
225 3300046529 Ga0495652_0005289 Ga0495652_0005289_1787_2215 133
226 3300046531 Ga0495665_0273764 Ga0495665_0273764_361_789 133
227 3300046533 Ga0495640_0058582 Ga0495640_0058582_1491_1919 133
228 3300046533 Ga0495640_0259525 Ga0495640_0259525_320_763 133
229 3300046535 Ga0495586_0228772 Ga0495586_0228772_547_978 133
230 3300046536 Ga0495587_0318792 Ga0495587_0318792_92_520 133
231 3300046543 Ga0495645_0004376 Ga0495645_0004376_7471_7899 133
232 3300046543 Ga0495645_0559087 Ga0495645_0559087_98_538 133
233 3300046557 Ga0495622_0131859 Ga0495622_0131859_448_876 133
234 3300046559 Ga0495667_0288240 Ga0495667_0288240_22_462 133
235 3300046663 Ga0495635_0125875 Ga0495635_0125875_54_482 133
236 3300046663 Ga0495635_0134835 Ga0495635_0134835_436_885 133
237 3300046675 Ga0495657_0298040 Ga0495657_0298040_431_880 133
238 3300046679 Ga0495623_0008411 Ga0495623_0008411_5586_6035 133
239 3300046679 Ga0495623_0023472 Ga0495623_0023472_1677_2105 133
240 3300046680 Ga0495646_0031461 Ga0495646_0031461_978_1406 133
241 3300046681 Ga0495647_0117742 Ga0495647_0117742_63_491 133
242 3300046689 Ga0495613_0315689 Ga0495613_0315689_491_919 133
243 3300046809 Ga0495600_0024267 Ga0495600_0024267_1936_2364 133
244 3300047317 Ga0495604_0054215 Ga0495604_0054215_2278_2718 133
245 3300047317 Ga0495604_0163604 Ga0495604_0163604_14_442 133
246 3300047319 Ga0495674_0060670 Ga0495674_0060670_178_606 133
247 3300047319 Ga0495674_0776331 Ga0495674_0776331_195_635 133
248 3300047319 Ga0495674_1006766 Ga0495674_1006766_166_597 133
249 3300047322 Ga0495680_0029148 Ga0495680_0029148_2087_2515 133
250 3300047322 Ga0495680_0221233 Ga0495680_0221233_330_758 133
251 3300047322 Ga0495680_0368071 Ga0495680_0368071_89_517 133
252 3300047444 Ga0495675_0092974 Ga0495675_0092974_1052_1480 133
253 3300047471 Ga0495684_0000965 Ga0495684_0000965_8426_8875 133
254 3300047472 Ga0495686_0477423 Ga0495686_0477423_187_615 133
255 3300048088 Ga0495602_0052199 Ga0495602_0052199_733_1182 133
256 3300048088 Ga0495602_0060547 Ga0495602_0060547_1481_1909 133
257 3300048089 Ga0495614_0397125 Ga0495614_0397125_70_507 133
258 3300048903 Ga0496100_0361963 Ga0496100_0361963_43_474 133
259 3300048907 Ga0496104_0004247 Ga0496104_0004247_11048_11479 133
260 3300048908 Ga0496105_0317164 Ga0496105_0317164_59_490 133
261 3300048911 Ga0496108_0607706 Ga0496108_0607706_507_938 133
262 3300048911 Ga0496108_1581274 Ga0496108_1581274_62_490 133
263 3300048917 Ga0496114_0002088 Ga0496114_0002088_10597_11028 133
264 3300048918 Ga0496115_0218513 Ga0496115_0218513_837_1268 133
265 3300049568 Ga0501031_0023510 Ga0501031_0023510_3452_3880 133
266 3300049570 Ga0501033_0033473 Ga0501033_0033473_1935_2363 133
267 3300049571 Ga0501034_0631203 Ga0501034_0631203_277_705 133
268 3300049575 Ga0501039_0009525 Ga0501039_0009525_3224_3652 133
269 3300049580 Ga0501046_0000258 Ga0501046_0000258_53370_53798 133
270 3300049581 Ga0501047_0000977 Ga0501047_0000977_3280_3708 133
271 3300049585 Ga0501069_0109389 Ga0501069_0109389_780_1208 133
272 3300049589 Ga0501073_0016701 Ga0501073_0016701_3528_3956 133
273 3300049742 Ga0501080_0014125 Ga0501080_0014125_3381_3809 133
274 3300049822 Ga0501035_0080665 Ga0501035_0080665_93_521 133
275 3300049823 Ga0501044_0020441 Ga0501044_0020441_93_521 133
276 3300050507 nmdc:mga05p37_19171_c1 nmdc:mga05p37_19171_c1_7287_7715 133
277 3300050510 nmdc:mga06r32_240521_c1 nmdc:mga06r32_240521_c1_1204_1632 133
278 3300050514 nmdc:mga08x19_1124062_c1 nmdc:mga08x19_1124062_c1_95_529 133
279 3300050515 nmdc:mga0a205_1046866_c1 nmdc:mga0a205_1046866_c1_84_614 133
280 3300053077 Ga0495601_0051819 Ga0495601_0051819_1726_2154 133
281 3300053077 Ga0495601_0074277 Ga0495601_0074277_559_999 133
282 3300053077 Ga0495601_0265388 Ga0495601_0265388_371_802 133
283 3300053077 Ga0495601_0382164 Ga0495601_0382164_49_618 133
284 3300053084 Ga0495595_0064272 Ga0495595_0064272_826_1257 133
285 3300053084 Ga0495595_0215182 Ga0495595_0215182_239_667 133
286 3300053084 Ga0495595_0521376 Ga0495595_0521376_163_591 133
287 3300053085 Ga0495619_0004782 Ga0495619_0004782_4733_5173 133
288 3300053085 Ga0495619_0006716 Ga0495619_0006716_4863_5294 133
289 3300053085 Ga0495619_0138076 Ga0495619_0138076_149_577 133
290 3300044765 Ga0466970_0332934 Ga0466970_0332934_302_739 134
291 3300046473 Ga0495582_0100246 Ga0495582_0100246_1080_1508 134
292 3300046499 Ga0495594_0043164 Ga0495594_0043164_47_475 134
293 3300046517 Ga0495630_0118473 Ga0495630_0118473_1252_1680 134
294 3300046535 Ga0495586_0062284 Ga0495586_0062284_1444_1872 134
295 3300046642 Ga0495634_0373011 Ga0495634_0373011_252_680 134
296 3300046681 Ga0495647_0048000 Ga0495647_0048000_1015_1443 134
297 3300046683 Ga0495658_0034712 Ga0495658_0034712_1325_1753 134
298 3300047322 Ga0495680_0042118 Ga0495680_0042118_2482_2910 134
299 3300005328 Ga0070676_10011237 Ga0070676_100112376 135
300 3300005338 Ga0068868_100048308 Ga0068868_1000483082 135
301 3300005339 Ga0070660_100037692 Ga0070660_1000376924 135
302 3300005340 Ga0070689_100000001 Ga0070689_100000001566 135
303 3300005344 Ga0070661_100161254 Ga0070661_1001612543 135
304 3300005355 Ga0070671_100314082 Ga0070671_1003140822 135
305 3300005366 Ga0070659_100327778 Ga0070659_1003277782 135
306 3300005455 Ga0070663_100705151 Ga0070663_1007051511 135
307 3300005458 Ga0070681_10682973 Ga0070681_106829732 135
308 3300005535 Ga0070684_100645644 Ga0070684_1006456442 135
309 3300005563 Ga0068855_100393353 Ga0068855_1003933532 135
310 3300005578 Ga0068854_100075900 Ga0068854_1000759001 135
311 3300005578 Ga0068854_100228764 Ga0068854_1002287642 135
312 3300005616 Ga0068852_101061197 Ga0068852_1010611971 135
313 3300005616 Ga0068852_102188430 Ga0068852_1021884301 135
314 3300005985 Ga0081539_10002066 Ga0081539_1000206623 135
315 3300009093 Ga0105240_10059121 Ga0105240_100591216 135
316 3300009147 Ga0114129_10751851 Ga0114129_107518513 135
317 3300009177 Ga0105248_10219748 Ga0105248_102197482 135
318 3300013100 Ga0157373_10526973 Ga0157373_105269732 135
319 3300013102 Ga0157371_10255416 Ga0157371_102554163 135
320 3300013104 Ga0157370_10172784 Ga0157370_101727842 135
321 3300013105 Ga0157369_10294707 Ga0157369_102947072 135
322 3300013307 Ga0157372_10200042 Ga0157372_102000423 135
323 3300013307 Ga0157372_10350903 Ga0157372_103509032 135
324 3300015265 Ga0182005_1042836 Ga0182005_10428363 135
325 3300025907 Ga0207645_10016805 Ga0207645_100168054 135
326 3300025909 Ga0207705_10341692 Ga0207705_103416922 135
327 3300025919 Ga0207657_10046799 Ga0207657_100467994 135
328 3300025921 Ga0207652_10587638 Ga0207652_105876382 135
329 3300025922 Ga0207646_10521504 Ga0207646_105215041 135
330 3300025931 Ga0207644_10134521 Ga0207644_101345212 135
331 3300025931 Ga0207644_10227184 Ga0207644_102271842 135
332 3300025936 Ga0207670_10000002 Ga0207670_10000002461 135
333 3300025940 Ga0207691_10754003 Ga0207691_107540031 135
334 3300025944 Ga0207661_11015252 Ga0207661_110152522 135
335 3300025945 Ga0207679_11993590 Ga0207679_119935901 135
336 3300025949 Ga0207667_10049769 Ga0207667_100497696 135
337 3300025960 Ga0207651_10654016 Ga0207651_106540162 135
338 3300026023 Ga0207677_10145591 Ga0207677_101455912 135
339 3300026041 Ga0207639_10483036 Ga0207639_104830362 135
340 3300026089 Ga0207648_10374689 Ga0207648_103746893 135
341 3300034816 Ga0373930_0000190 Ga0373930_0000190_687_1106 135
342 3300034819 Ga0373958_0001725 Ga0373958_0001725_1357_1776 135
343 3300034820 Ga0373959_0002213 Ga0373959_0002213_374_793 135
344 3300035084 Ga0373928_0016570 Ga0373928_0016570_999_1418 135
345 3300035085 Ga0373929_0002028 Ga0373929_0002028_2384_2803 135
346 3300035088 Ga0373940_0002904 Ga0373940_0002904_1619_2038 135
347 3300035090 Ga0373949_0003873 Ga0373949_0003873_774_1193 135
348 3300035091 Ga0373951_0000928 Ga0373951_0000928_1940_2359 135
349 3300035092 Ga0373952_0000354 Ga0373952_0000354_5966_6385 135
350 3300035112 Ga0373932_0000157 Ga0373932_0000157_8859_9278 135
351 3300035114 Ga0373939_0000138 Ga0373939_0000138_19770_20189 135
352 3300035115 Ga0373941_0006216 Ga0373941_0006216_1312_1731 135
353 3300035121 Ga0373960_0001327 Ga0373960_0001327_3807_4226 135
354 3300035207 Ga0373942_0001220 Ga0373942_0001220_3855_4274 135
355 3300035241 Ga0373961_0031744 Ga0373961_0031744_745_1164 135
356 3300035242 Ga0373962_0000383 Ga0373962_0000383_9032_9451 135
357 3300035691 Ga0373931_0003364 Ga0373931_0003364_800_1219 135
358 3300037312 Ga0395899_0000019 Ga0395899_0000019_374245_374652 135
359 3300044684 Ga0466966_0031693 Ga0466966_0031693_345_767 135
360 3300045049 Ga0466959_0005273 Ga0466959_0005273_1833_2255 135
361 3300045051 Ga0451576_0009094 Ga0451576_0009094_1010_1429 135
362 3300046454 Ga0495592_0010328 Ga0495592_0010328_3223_3639 135
363 3300046463 Ga0495653_0023865 Ga0495653_0023865_1623_2042 135
364 3300046511 Ga0495608_0336005 Ga0495608_0336005_312_731 135
365 3300046516 Ga0495628_0031961 Ga0495628_0031961_3348_3764 135
366 3300046517 Ga0495630_0433423 Ga0495630_0433423_389_808 135
367 3300046529 Ga0495652_0013888 Ga0495652_0013888_4603_5019 135
368 3300046543 Ga0495645_0012448 Ga0495645_0012448_2085_2501 135
369 3300046559 Ga0495667_0072161 Ga0495667_0072161_636_1055 135
370 3300046678 Ga0495599_0009115 Ga0495599_0009115_1731_2147 135
371 3300046689 Ga0495613_0392185 Ga0495613_0392185_358_777 135
372 3300046809 Ga0495600_0286281 Ga0495600_0286281_585_1004 135
373 3300047322 Ga0495680_0216762 Ga0495680_0216762_121_540 135
374 3300047673 Ga0495593_0443683 Ga0495593_0443683_191_598 135
375 3300048905 Ga0496102_1783886 Ga0496102_1783886_89_508 135
376 3300048925 Ga0496122_0044838 Ga0496122_0044838_1823_2251 135
377 3300048926 Ga0496123_0025405 Ga0496123_0025405_3901_4329 135
378 3300048928 Ga0496125_0061258 Ga0496125_0061258_776_1204 135
379 3300049459 Ga0495678_187849 Ga0495678_187849_132_560 135
380 3300050507 nmdc:mga05p37_118491_c1 nmdc:mga05p37_118491_c1_584_991 135
381 3300050514 nmdc:mga08x19_490821_c1 nmdc:mga08x19_490821_c1_295_714 135
382 3300053085 Ga0495619_0006938 Ga0495619_0006938_476_895 135
383 3300053092 Ga0500583_0433699 Ga0500583_0433699_69_509 135
384 3300059645 Ga0587076_018069 Ga0587076_018069_96_578 135
385 3300059647 Ga0587079_159391 Ga0587079_159391_65_547 135
386 3300005293 Ga0065715_10291854 Ga0065715_102918542 136
387 3300061734 Ga0530510_0395037 Ga0530510_0395037_53_466 137
388 3300005331 Ga0070670_100272122 Ga0070670_1002721223 138
389 3300005338 Ga0068868_100552163 Ga0068868_1005521632 138
390 3300005437 Ga0070710_10385507 Ga0070710_103855072 138
391 3300005535 Ga0070684_100587576 Ga0070684_1005875762 138
392 3300005548 Ga0070665_100226350 Ga0070665_1002263501 138
393 3300005577 Ga0068857_100093482 Ga0068857_1000934824 138
394 3300005843 Ga0068860_101341727 Ga0068860_1013417272 138
395 3300006237 Ga0097621_100004225 Ga0097621_1000042256 138
396 3300006358 Ga0068871_100079058 Ga0068871_1000790582 138
397 3300009174 Ga0105241_10004901 Ga0105241_100049017 138
398 3300009177 Ga0105248_10994150 Ga0105248_109941501 138
399 3300009545 Ga0105237_10265903 Ga0105237_102659032 138
400 3300009551 Ga0105238_10023968 Ga0105238_100239682 138
401 3300010375 Ga0105239_10830208 Ga0105239_108302081 138
402 3300011119 Ga0105246_10157177 Ga0105246_101571772 138
403 3300013296 Ga0157374_10070419 Ga0157374_100704192 138
404 3300013297 Ga0157378_10017861 Ga0157378_100178616 138
405 3300014968 Ga0157379_10118300 Ga0157379_101183003 138
406 3300025911 Ga0207654_10014094 Ga0207654_100140943 138
407 3300025914 Ga0207671_10949359 Ga0207671_109493591 138
408 3300025924 Ga0207694_10014336 Ga0207694_100143362 138
409 3300025925 Ga0207650_10228810 Ga0207650_102288104 138
410 3300025945 Ga0207679_10030460 Ga0207679_100304605 138
411 3300026078 Ga0207702_10041493 Ga0207702_100414934 138
412 3300026116 Ga0207674_10016506 Ga0207674_100165068 138
413 3300028379 Ga0268266_10004587 Ga0268266_100045874 138
414 3300028381 Ga0268264_10918900 Ga0268264_109189001 138
415 3300035692 Ga0373935_0374018 Ga0373935_0374018_116_601 138
416 3300036401 Ga0373937_0666696 Ga0373937_0666696_409_894 138
417 3300046476 Ga0495662_0234314 Ga0495662_0234314_11_496 138
418 3300046809 Ga0495600_0519598 Ga0495600_0519598_18_503 138
419 3300048903 Ga0496100_0056589 Ga0496100_0056589_34_519 138
420 3300048904 Ga0496101_0017382 Ga0496101_0017382_2279_2764 138
421 3300048905 Ga0496102_0041163 Ga0496102_0041163_1367_1852 138
422 3300048907 Ga0496104_0036250 Ga0496104_0036250_3080_3565 138
423 3300048910 Ga0496107_0021957 Ga0496107_0021957_2037_2522 138
424 3300048912 Ga0496109_0290550 Ga0496109_0290550_656_1141 138
425 3300048917 Ga0496114_0022030 Ga0496114_0022030_4627_5112 138
426 3300048918 Ga0496115_0047999 Ga0496115_0047999_2294_2779 138
427 3300005937 Ga0081455_10001198 Ga0081455_1000119828 139
428 3300001989 JGI24739J22299_10194032 JGI24739J22299_101940321 140
429 3300001991 JGI24743J22301_10008365 JGI24743J22301_100083652 140
430 3300005290 Ga0065712_10076784 Ga0065712_100767842 140
431 3300005293 Ga0065715_10107365 Ga0065715_101073655 140
432 3300005293 Ga0065715_10268803 Ga0065715_102688032 140
433 3300005295 Ga0065707_10027610 Ga0065707_100276102 140
434 3300005329 Ga0070683_100128551 Ga0070683_1001285512 140
435 3300005331 Ga0070670_100243971 Ga0070670_1002439712 140
436 3300005338 Ga0068868_100131338 Ga0068868_1001313382 140
437 3300005354 Ga0070675_100042568 Ga0070675_1000425682 140
438 3300005364 Ga0070673_101523971 Ga0070673_1015239711 140
439 3300005365 Ga0070688_100067590 Ga0070688_1000675903 140
440 3300005440 Ga0070705_100000257 Ga0070705_10000025734 140
441 3300005455 Ga0070663_100173922 Ga0070663_1001739221 140
442 3300005456 Ga0070678_100065502 Ga0070678_1000655025 140
443 3300005456 Ga0070678_100834834 Ga0070678_1008348341 140
444 3300005467 Ga0070706_100182330 Ga0070706_1001823301 140
445 3300005468 Ga0070707_100164279 Ga0070707_1001642794 140
446 3300005468 Ga0070707_100557892 Ga0070707_1005578922 140
447 3300005471 Ga0070698_100003314 Ga0070698_1000033143 140
448 3300005471 Ga0070698_100696887 Ga0070698_1006968872 140
449 3300005518 Ga0070699_100086457 Ga0070699_1000864575 140
450 3300005518 Ga0070699_100329802 Ga0070699_1003298022 140
451 3300005539 Ga0068853_100057925 Ga0068853_1000579253 140
452 3300005544 Ga0070686_100743803 Ga0070686_1007438032 140
453 3300005545 Ga0070695_100185335 Ga0070695_1001853352 140
454 3300005546 Ga0070696_100092279 Ga0070696_1000922794 140
455 3300005546 Ga0070696_100560238 Ga0070696_1005602382 140
456 3300005548 Ga0070665_100557095 Ga0070665_1005570952 140
457 3300005564 Ga0070664_100035559 Ga0070664_1000355592 140
458 3300005615 Ga0070702_100522686 Ga0070702_1005226861 140
459 3300005842 Ga0068858_100010011 Ga0068858_10001001110 140
460 3300005843 Ga0068860_101369707 Ga0068860_1013697071 140
461 3300006358 Ga0068871_100304635 Ga0068871_1003046352 140
462 3300006844 Ga0075428_100179306 Ga0075428_1001793064 140
463 3300006871 Ga0075434_101321057 Ga0075434_1013210571 140
464 3300006881 Ga0068865_100172987 Ga0068865_1001729873 140
465 3300009094 Ga0111539_10244451 Ga0111539_102444515 140
466 3300009098 Ga0105245_11402222 Ga0105245_114022221 140
467 3300009101 Ga0105247_10093456 Ga0105247_100934564 140
468 3300009147 Ga0114129_10014611 Ga0114129_100146115 140
469 3300009147 Ga0114129_10747813 Ga0114129_107478132 140
470 3300009147 Ga0114129_11314397 Ga0114129_113143971 140
471 3300009148 Ga0105243_10863941 Ga0105243_108639413 140
472 3300009176 Ga0105242_10095366 Ga0105242_100953665 140
473 3300009176 Ga0105242_12595662 Ga0105242_125956621 140
474 3300011119 Ga0105246_10164490 Ga0105246_101644904 140
475 3300013308 Ga0157375_10271346 Ga0157375_102713463 140
476 3300014325 Ga0163163_10361854 Ga0163163_103618543 140
477 3300014969 Ga0157376_10063664 Ga0157376_100636645 140
478 3300025271 Ga0207666_1010380 Ga0207666_10103802 140
479 3300025315 Ga0207697_10000173 Ga0207697_100001735 140
480 3300025315 Ga0207697_10195467 Ga0207697_101954671 140
481 3300025901 Ga0207688_10007915 Ga0207688_100079155 140
482 3300025922 Ga0207646_10153518 Ga0207646_101535182 140
483 3300025922 Ga0207646_10207476 Ga0207646_102074763 140
484 3300025925 Ga0207650_10098636 Ga0207650_100986365 140
485 3300025926 Ga0207659_10026197 Ga0207659_100261974 140
486 3300025932 Ga0207690_10103710 Ga0207690_101037102 140
487 3300025937 Ga0207669_10042111 Ga0207669_100421112 140
488 3300025938 Ga0207704_10174511 Ga0207704_101745112 140
489 3300025944 Ga0207661_10078568 Ga0207661_100785682 140
490 3300025945 Ga0207679_10034339 Ga0207679_100343394 140
491 3300025960 Ga0207651_12005726 Ga0207651_120057261 140
492 3300025981 Ga0207640_11739770 Ga0207640_117397702 140
493 3300026023 Ga0207677_10008313 Ga0207677_100083133 140
494 3300026035 Ga0207703_10037266 Ga0207703_100372665 140
495 3300026035 Ga0207703_10998975 Ga0207703_109989752 140
496 3300026041 Ga0207639_10036972 Ga0207639_100369724 140
497 3300026067 Ga0207678_10189061 Ga0207678_101890612 140
498 3300026121 Ga0207683_10086652 Ga0207683_100866525 140
499 3300027907 Ga0207428_10602153 Ga0207428_106021532 140
500 3300028379 Ga0268266_10458147 Ga0268266_104581472 140
501 3300031731 Ga0307405_10264235 Ga0307405_102642352 140
502 3300031824 Ga0307413_10292404 Ga0307413_102924041 140
503 3300031901 Ga0307406_10335624 Ga0307406_103356242 140
504 3300031903 Ga0307407_10117357 Ga0307407_101173572 140
505 3300031995 Ga0307409_100350603 Ga0307409_1003506031 140
506 3300032002 Ga0307416_100138336 Ga0307416_1001383363 140
507 3300035724 Ga0373933_0106380 Ga0373933_0106380_1049_1504 140
508 3300036401 Ga0373937_0488243 Ga0373937_0488243_269_697 140
509 3300036401 Ga0373937_0983606 Ga0373937_0983606_39_494 140
510 3300037068 Ga0373925_1768906 Ga0373925_1768906_12_434 140
511 3300042532 Ga0450893_0123964 Ga0450893_0123964_89_511 140
512 3300045051 Ga0451576_0062809 Ga0451576_0062809_569_1003 140
513 3300046459 Ga0495629_0625001 Ga0495629_0625001_68_493 140
514 3300046462 Ga0495651_0305973 Ga0495651_0305973_192_617 140
515 3300046511 Ga0495608_0100893 Ga0495608_0100893_1276_1704 140
516 3300046516 Ga0495628_0383723 Ga0495628_0383723_531_959 140
517 3300046517 Ga0495630_0001715 Ga0495630_0001715_11341_11769 140
518 3300046528 Ga0495642_0037283 Ga0495642_0037283_210_650 140
519 3300046531 Ga0495665_0131718 Ga0495665_0131718_733_1164 140
520 3300046535 Ga0495586_0050873 Ga0495586_0050873_499_933 140
521 3300046543 Ga0495645_0045675 Ga0495645_0045675_534_962 140
522 3300046642 Ga0495634_0079517 Ga0495634_0079517_543_971 140
523 3300046642 Ga0495634_0623057 Ga0495634_0623057_19_453 140
524 3300046664 Ga0495659_0005932 Ga0495659_0005932_2685_3107 140
525 3300046683 Ga0495658_0007509 Ga0495658_0007509_4088_4516 140
526 3300046684 Ga0495669_0040346 Ga0495669_0040346_1502_1924 140
527 3300046689 Ga0495613_0000501 Ga0495613_0000501_14482_14910 140
528 3300047319 Ga0495674_0026206 Ga0495674_0026206_1354_1782 140
529 3300047321 Ga0495676_0408297 Ga0495676_0408297_334_768 140
530 3300047447 Ga0495685_144491 Ga0495685_144491_135_575 140
531 3300047471 Ga0495684_0000985 Ga0495684_0000985_11087_11515 140
532 3300048910 Ga0496107_0523554 Ga0496107_0523554_93_515 140
533 3300048912 Ga0496109_0105997 Ga0496109_0105997_473_895 140
534 3300048913 Ga0496110_0142980 Ga0496110_0142980_1229_1651 140
535 3300048916 Ga0496113_0835433 Ga0496113_0835433_61_495 140
536 3300049580 Ga0501046_0396966 Ga0501046_0396966_492_923 140
537 3300049589 Ga0501073_1081196 Ga0501073_1081196_93_524 140
538 3300049590 Ga0501074_0874693 Ga0501074_0874693_156_587 140
539 3300049591 Ga0501075_0293412 Ga0501075_0293412_486_917 140
540 3300049592 Ga0501076_0912039 Ga0501076_0912039_78_509 140
541 3300049824 Ga0501045_0538802 Ga0501045_0538802_395_826 140
542 3300050507 nmdc:mga05p37_110882_c2 nmdc:mga05p37_110882_c2_150_572 140
543 3300050507 nmdc:mga05p37_1163168_c1 nmdc:mga05p37_1163168_c1_225_647 140
544 3300050507 nmdc:mga05p37_366953_c1 nmdc:mga05p37_366953_c1_1224_1673 140
545 3300050511 nmdc:mga08y16_102464_c1 nmdc:mga08y16_102464_c1_2226_2654 140
546 3300050511 nmdc:mga08y16_433823_c1 nmdc:mga08y16_433823_c1_222_656 140
547 3300050513 nmdc:mga0rr50_46356_c1 nmdc:mga0rr50_46356_c1_2120_2542 140
548 3300050515 nmdc:mga0a205_595710_c1 nmdc:mga0a205_595710_c1_147_569 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

60

156

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7506 14 132
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6925 14 132
3nk4-assembly1.cif.gz_A crystal structure of full-length sperm receptor zp3 at 2.0 a resolution 0.6021 68 113
3fdd-assembly1.cif.gz_A the crystal structure of the pseudomonas dacunhae aspartate-beta-decarboxylase reveals a novel oligomeric assembly for a pyridoxal-5-phosphate dependent enzyme 0.5756 83 140
6xi8-assembly1.cif.gz_A yeast tfiik (kin28/ccl1/tfb3) complex 0.5413 63 110
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7405 14 132 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7193 14 132 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7049 14 135 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6893 14 135 3.90.1150.200
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6329 32 133 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A2V7X7N0-F1-model_v4 YdhG-like domain-containing protein 0.9942 12 85
AF-A0A349L252-F1-model_v4 YdhG-like domain-containing protein 0.9902 12 138
AF-A0A7V9TMV2-F1-model_v4 DUF1801 domain-containing protein 0.99 7 139
AF-A0A1Q3J442-F1-model_v4 deleted 0.9896 11 138
AF-A0A427CGT7-F1-model_v4 DUF1801 domain-containing protein 0.988 15 132

Feature Viewer

pLDDT pTM Quality
88.9 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map