F462234
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 548 | 295 | 548 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300025922|Ga0207646_10718046|Ga0207646_107180462 |
| Length | 177 |
| Sequence | VGALVRLLASSAGDAAIDLDGPAQLDGTMKVKGRGTSAGQSGPAASALIDKRIDELGDWRGKMLARLRALIHKADPDIVEEWKWMGTPIFSHAGIVCTGETYKAVVKLTFAKGAALKDPAGLFNSSLEGNVRRAIDVHEGEKVNEAALKDLIRAAVALNVEGKTKTGTKTKSARKAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 149 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 150 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 153 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 162 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 163 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 165 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 166 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 170 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 173 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 181 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 187 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 252 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 253 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 278 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 279 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 293 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.46 |
| Nodule | 0 |
| Rhizoplane | 3.65 |
| Rhizosphere | 93.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10194032 | 3300001989 | Bacteria | 597 |
| 2 | JGI24743J22301_10008365 | 3300001991 | Bacteria | 1814 |
| 3 | Ga0065712_10076784 | 3300005290 | Bacteria | 3603 |
| 4 | Ga0065712_10132493 | 3300005290 | Bacteria | 1533 |
| 5 | Ga0065715_10107365 | 3300005293 | Bacteria | 2761 |
| 6 | Ga0065715_10268803 | 3300005293 | Bacteria | 1091 |
| 7 | Ga0065715_10291854 | 3300005293 | Bacteria | 1061 |
| 8 | Ga0065715_10869015 | 3300005293 | Bacteria | 585 |
| 9 | Ga0065707_10027610 | 3300005295 | Bacteria | 1566 |
| 10 | Ga0065707_10115429 | 3300005295 | Bacteria | 2267 |
| 11 | Ga0070676_10011237 | 3300005328 | Bacteria | 4868 |
| 12 | Ga0070683_100128551 | 3300005329 | Bacteria | 2396 |
| 13 | Ga0070683_100237802 | 3300005329 | Bacteria | 1732 |
| 14 | Ga0070690_100279245 | 3300005330 | Bacteria | 1191 |
| 15 | Ga0070670_100243971 | 3300005331 | Bacteria | 1564 |
| 16 | Ga0070670_100272122 | 3300005331 | Bacteria | 1478 |
| 17 | Ga0070680_100024536 | 3300005336 | Bacteria | 4818 |
| 18 | Ga0068868_100048308 | 3300005338 | Bacteria | 3338 |
| 19 | Ga0068868_100053829 | 3300005338 | Bacteria | 3171 |
| 20 | Ga0068868_100131338 | 3300005338 | Bacteria | 2049 |
| 21 | Ga0068868_100552163 | 3300005338 | Unclassified | 1015 |
| 22 | Ga0070660_100037692 | 3300005339 | Bacteria | 3665 |
| 23 | Ga0070689_100000001 | 3300005340 | Bacteria | 1334580 |
| 24 | Ga0070689_100000101 | 3300005340 | Bacteria | 50092 |
| 25 | Ga0070661_100161254 | 3300005344 | Bacteria | 1698 |
| 26 | Ga0070675_100042568 | 3300005354 | Bacteria | 3710 |
| 27 | Ga0070671_100314082 | 3300005355 | Bacteria | 1335 |
| 28 | Ga0070674_100678123 | 3300005356 | Bacteria | 879 |
| 29 | Ga0070673_100483734 | 3300005364 | Bacteria | 1118 |
| 30 | Ga0070673_101523971 | 3300005364 | Bacteria | 631 |
| 31 | Ga0070688_100000001 | 3300005365 | Bacteria | 106331 |
| 32 | Ga0070688_100067590 | 3300005365 | Bacteria | 2277 |
| 33 | Ga0070659_100327778 | 3300005366 | Bacteria | 1281 |
| 34 | Ga0070667_100638324 | 3300005367 | Bacteria | 983 |
| 35 | Ga0070709_10134980 | 3300005434 | Bacteria | 1689 |
| 36 | Ga0070710_10126867 | 3300005437 | Bacteria | 1551 |
| 37 | Ga0070710_10385507 | 3300005437 | Unclassified | 936 |
| 38 | Ga0070711_101462076 | 3300005439 | Bacteria | 596 |
| 39 | Ga0070705_100000257 | 3300005440 | Bacteria | 31587 |
| 40 | Ga0070663_100173922 | 3300005455 | Bacteria | 1666 |
| 41 | Ga0070663_100705151 | 3300005455 | Bacteria | 858 |
| 42 | Ga0070678_100065502 | 3300005456 | Bacteria | 2698 |
| 43 | Ga0070678_100317871 | 3300005456 | Bacteria | 1329 |
| 44 | Ga0070678_100834834 | 3300005456 | Bacteria | 839 |
| 45 | Ga0070662_100030034 | 3300005457 | Bacteria | 3799 |
| 46 | Ga0070681_10247445 | 3300005458 | Bacteria | 1696 |
| 47 | Ga0070681_10360312 | 3300005458 | Bacteria | 1364 |
| 48 | Ga0070681_10682973 | 3300005458 | Bacteria | 942 |
| 49 | Ga0070685_10092012 | 3300005466 | Bacteria | 1837 |
| 50 | Ga0070685_10129576 | 3300005466 | Bacteria | 1576 |
| 51 | Ga0070706_100182330 | 3300005467 | Bacteria | 1960 |
| 52 | Ga0070707_100164279 | 3300005468 | Bacteria | 2163 |
| 53 | Ga0070707_100557892 | 3300005468 | Bacteria | 1108 |
| 54 | Ga0070698_100003314 | 3300005471 | Bacteria | 17717 |
| 55 | Ga0070698_100696887 | 3300005471 | Bacteria | 958 |
| 56 | Ga0070698_101052491 | 3300005471 | Bacteria | 762 |
| 57 | Ga0070699_100086457 | 3300005518 | Bacteria | 2736 |
| 58 | Ga0070699_100329802 | 3300005518 | Bacteria | 1372 |
| 59 | Ga0070679_100054622 | 3300005530 | Bacteria | 3977 |
| 60 | Ga0070679_100137445 | 3300005530 | Bacteria | 2425 |
| 61 | Ga0070684_100133335 | 3300005535 | Bacteria | 2242 |
| 62 | Ga0070684_100141544 | 3300005535 | Bacteria | 2175 |
| 63 | Ga0070684_100587576 | 3300005535 | Bacteria | 1035 |
| 64 | Ga0070684_100645644 | 3300005535 | Bacteria | 985 |
| 65 | Ga0068853_100057925 | 3300005539 | Bacteria | 3344 |
| 66 | Ga0068853_100662200 | 3300005539 | Bacteria | 994 |
| 67 | Ga0070686_100743803 | 3300005544 | Bacteria | 786 |
| 68 | Ga0070695_100185335 | 3300005545 | Bacteria | 1477 |
| 69 | Ga0070696_100092279 | 3300005546 | Bacteria | 2158 |
| 70 | Ga0070696_100560238 | 3300005546 | Bacteria | 917 |
| 71 | Ga0070665_100226350 | 3300005548 | Bacteria | 1870 |
| 72 | Ga0070665_100557095 | 3300005548 | Bacteria | 1159 |
| 73 | Ga0068855_100097809 | 3300005563 | Bacteria | 3381 |
| 74 | Ga0068855_100310169 | 3300005563 | Bacteria | 1746 |
| 75 | Ga0068855_100393353 | 3300005563 | Bacteria | 1520 |
| 76 | Ga0070664_100035559 | 3300005564 | Bacteria | 4182 |
| 77 | Ga0070664_100614192 | 3300005564 | Bacteria | 1009 |
| 78 | Ga0068857_100093482 | 3300005577 | Bacteria | 2693 |
| 79 | Ga0068854_100075900 | 3300005578 | Bacteria | 2469 |
| 80 | Ga0068854_100228764 | 3300005578 | Bacteria | 1475 |
| 81 | Ga0068854_100944915 | 3300005578 | Bacteria | 760 |
| 82 | Ga0068856_100017387 | 3300005614 | Bacteria | 6969 |
| 83 | Ga0068856_100251061 | 3300005614 | Bacteria | 1784 |
| 84 | Ga0070702_100522686 | 3300005615 | Bacteria | 876 |
| 85 | Ga0068852_100209420 | 3300005616 | Bacteria | 1849 |
| 86 | Ga0068852_101061197 | 3300005616 | Bacteria | 830 |
| 87 | Ga0068852_102188430 | 3300005616 | Bacteria | 575 |
| 88 | Ga0068859_100034183 | 3300005617 | Bacteria | 5103 |
| 89 | Ga0068859_100977571 | 3300005617 | Bacteria | 929 |
| 90 | Ga0068859_101757604 | 3300005617 | Bacteria | 685 |
| 91 | Ga0068866_10026547 | 3300005718 | Bacteria | 2736 |
| 92 | Ga0068866_10073036 | 3300005718 | Bacteria | 1819 |
| 93 | Ga0068866_10387482 | 3300005718 | Bacteria | 898 |
| 94 | Ga0068861_100189500 | 3300005719 | Bacteria | 1718 |
| 95 | Ga0068861_100555659 | 3300005719 | Bacteria | 1047 |
| 96 | Ga0068861_101965896 | 3300005719 | Bacteria | 583 |
| 97 | Ga0068863_100327412 | 3300005841 | Bacteria | 1489 |
| 98 | Ga0068858_100002668 | 3300005842 | Bacteria | 17950 |
| 99 | Ga0068858_100010011 | 3300005842 | Bacteria | 9005 |
| 100 | Ga0068860_101341727 | 3300005843 | Bacteria | 736 |
| 101 | Ga0068860_101369707 | 3300005843 | Bacteria | 729 |
| 102 | Ga0068862_100329106 | 3300005844 | Bacteria | 1412 |
| 103 | Ga0068862_100951623 | 3300005844 | Bacteria | 847 |
| 104 | Ga0081455_10001198 | 3300005937 | Bacteria | 32472 |
| 105 | Ga0081539_10002066 | 3300005985 | Bacteria | 30089 |
| 106 | Ga0070717_10207889 | 3300006028 | Bacteria | 1717 |
| 107 | Ga0075365_10070994 | 3300006038 | Bacteria | 2343 |
| 108 | Ga0075362_10000363 | 3300006177 | Bacteria | 13081 |
| 109 | Ga0075366_10022348 | 3300006195 | Bacteria | 3678 |
| 110 | Ga0097621_100004225 | 3300006237 | Bacteria | 9974 |
| 111 | Ga0097621_100201189 | 3300006237 | Bacteria | 1729 |
| 112 | Ga0097621_101999760 | 3300006237 | Bacteria | 554 |
| 113 | Ga0068871_100046325 | 3300006358 | Bacteria | 3502 |
| 114 | Ga0068871_100079058 | 3300006358 | Bacteria | 2720 |
| 115 | Ga0068871_100304635 | 3300006358 | Bacteria | 1399 |
| 116 | Ga0068871_100775412 | 3300006358 | Bacteria | 882 |
| 117 | Ga0068871_100808094 | 3300006358 | Bacteria | 865 |
| 118 | Ga0075428_100179306 | 3300006844 | Bacteria | 2293 |
| 119 | Ga0075431_101652549 | 3300006847 | Bacteria | 598 |
| 120 | Ga0075433_10005620 | 3300006852 | Bacteria | 9856 |
| 121 | Ga0075433_10653137 | 3300006852 | Bacteria | 922 |
| 122 | Ga0075434_100034229 | 3300006871 | Bacteria | 5016 |
| 123 | Ga0075434_101321057 | 3300006871 | Bacteria | 732 |
| 124 | Ga0068865_100014987 | 3300006881 | Bacteria | 4936 |
| 125 | Ga0068865_100172987 | 3300006881 | Bacteria | 1657 |
| 126 | Ga0075436_100008890 | 3300006914 | Bacteria | 6872 |
| 127 | Ga0097620_100034180 | 3300006931 | Bacteria | 5103 |
| 128 | Ga0097620_100911930 | 3300006931 | Bacteria | 963 |
| 129 | Ga0097620_100977415 | 3300006931 | Bacteria | 929 |
| 130 | Ga0097620_101757593 | 3300006931 | Bacteria | 685 |
| 131 | Ga0075435_100027708 | 3300007076 | Bacteria | 4435 |
| 132 | Ga0105240_10003190 | 3300009093 | Bacteria | 25760 |
| 133 | Ga0105240_10013677 | 3300009093 | Bacteria | 11129 |
| 134 | Ga0105240_10021753 | 3300009093 | Bacteria | 8523 |
| 135 | Ga0105240_10050819 | 3300009093 | Bacteria | 5223 |
| 136 | Ga0105240_10059121 | 3300009093 | Bacteria | 4785 |
| 137 | Ga0111539_10244451 | 3300009094 | Bacteria | 2089 |
| 138 | Ga0105245_10251248 | 3300009098 | Bacteria | 1718 |
| 139 | Ga0105245_10681560 | 3300009098 | Bacteria | 1060 |
| 140 | Ga0105245_11402222 | 3300009098 | Bacteria | 749 |
| 141 | Ga0105247_10037076 | 3300009101 | Bacteria | 2974 |
| 142 | Ga0105247_10093456 | 3300009101 | Bacteria | 1912 |
| 143 | Ga0105247_10252371 | 3300009101 | Bacteria | 1206 |
| 144 | Ga0114129_10014611 | 3300009147 | Bacteria | 11188 |
| 145 | Ga0114129_10018464 | 3300009147 | Bacteria | 9934 |
| 146 | Ga0114129_10053679 | 3300009147 | Bacteria | 5653 |
| 147 | Ga0114129_10747813 | 3300009147 | Bacteria | 1252 |
| 148 | Ga0114129_10751851 | 3300009147 | Bacteria | 1248 |
| 149 | Ga0114129_11314397 | 3300009147 | Bacteria | 896 |
| 150 | Ga0114129_12754912 | 3300009147 | Bacteria | 585 |
| 151 | Ga0105243_10072216 | 3300009148 | Bacteria | 2793 |
| 152 | Ga0105243_10863941 | 3300009148 | Bacteria | 897 |
| 153 | Ga0105241_10004901 | 3300009174 | Bacteria | 9872 |
| 154 | Ga0105241_10082389 | 3300009174 | Bacteria | 2521 |
| 155 | Ga0105242_10050465 | 3300009176 | Bacteria | 3387 |
| 156 | Ga0105242_10088116 | 3300009176 | Bacteria | 2607 |
| 157 | Ga0105242_10095366 | 3300009176 | Bacteria | 2511 |
| 158 | Ga0105242_12595662 | 3300009176 | Bacteria | 556 |
| 159 | Ga0105248_10016703 | 3300009177 | Bacteria | 8080 |
| 160 | Ga0105248_10105109 | 3300009177 | Bacteria | 3183 |
| 161 | Ga0105248_10131281 | 3300009177 | Bacteria | 2826 |
| 162 | Ga0105248_10219748 | 3300009177 | Bacteria | 2139 |
| 163 | Ga0105248_10994150 | 3300009177 | Bacteria | 948 |
| 164 | Ga0105237_10007563 | 3300009545 | Bacteria | 11875 |
| 165 | Ga0105237_10265903 | 3300009545 | Bacteria | 1718 |
| 166 | Ga0105238_10023968 | 3300009551 | Bacteria | 6222 |
| 167 | Ga0105238_10596671 | 3300009551 | Bacteria | 1112 |
| 168 | Ga0105238_10621610 | 3300009551 | Bacteria | 1089 |
| 169 | Ga0105238_11468180 | 3300009551 | Bacteria | 710 |
| 170 | Ga0105249_10111933 | 3300009553 | Bacteria | 2581 |
| 171 | Ga0105239_10084586 | 3300010375 | Bacteria | 3494 |
| 172 | Ga0105239_10095116 | 3300010375 | Bacteria | 3291 |
| 173 | Ga0105239_10290497 | 3300010375 | Bacteria | 1841 |
| 174 | Ga0105239_10830208 | 3300010375 | Bacteria | 1059 |
| 175 | Ga0105239_10900287 | 3300010375 | Bacteria | 1016 |
| 176 | Ga0105246_10157177 | 3300011119 | Unclassified | 1728 |
| 177 | Ga0105246_10164490 | 3300011119 | Bacteria | 1693 |
| 178 | Ga0105246_10429306 | 3300011119 | Bacteria | 1105 |
| 179 | Ga0157373_10526973 | 3300013100 | Bacteria | 855 |
| 180 | Ga0157371_10255416 | 3300013102 | Bacteria | 1263 |
| 181 | Ga0157370_10169793 | 3300013104 | Bacteria | 2028 |
| 182 | Ga0157370_10172784 | 3300013104 | Bacteria | 2008 |
| 183 | Ga0157370_10984598 | 3300013104 | Bacteria | 764 |
| 184 | Ga0157369_10294707 | 3300013105 | Bacteria | 1688 |
| 185 | Ga0157369_10431371 | 3300013105 | Bacteria | 1366 |
| 186 | Ga0157369_10678418 | 3300013105 | Bacteria | 1062 |
| 187 | Ga0157374_10037668 | 3300013296 | Bacteria | 4440 |
| 188 | Ga0157374_10070419 | 3300013296 | Bacteria | 3295 |
| 189 | Ga0157374_10116705 | 3300013296 | Unclassified | 2572 |
| 190 | Ga0157374_10785018 | 3300013296 | Bacteria | 968 |
| 191 | Ga0157374_11546171 | 3300013296 | Bacteria | 687 |
| 192 | Ga0157378_10005847 | 3300013297 | Bacteria | 10781 |
| 193 | Ga0157378_10017861 | 3300013297 | Bacteria | 6226 |
| 194 | Ga0157378_10284868 | 3300013297 | Bacteria | 1594 |
| 195 | Ga0157378_10923679 | 3300013297 | Bacteria | 904 |
| 196 | Ga0157378_11967509 | 3300013297 | Bacteria | 634 |
| 197 | Ga0163162_10112464 | 3300013306 | Bacteria | 2821 |
| 198 | Ga0163162_10346429 | 3300013306 | Bacteria | 1618 |
| 199 | Ga0163162_11765998 | 3300013306 | Unclassified | 707 |
| 200 | Ga0157372_10130575 | 3300013307 | Bacteria | 2890 |
| 201 | Ga0157372_10200042 | 3300013307 | Bacteria | 2314 |
| 202 | Ga0157372_10293508 | 3300013307 | Bacteria | 1891 |
| 203 | Ga0157372_10350903 | 3300013307 | Bacteria | 1719 |
| 204 | Ga0157375_10006070 | 3300013308 | Bacteria | 10538 |
| 205 | Ga0157375_10049954 | 3300013308 | Bacteria | 4101 |
| 206 | Ga0157375_10271346 | 3300013308 | Bacteria | 1859 |
| 207 | Ga0163163_10309771 | 3300014325 | Bacteria | 1632 |
| 208 | Ga0163163_10361854 | 3300014325 | Bacteria | 1507 |
| 209 | Ga0157380_11170801 | 3300014326 | Bacteria | 811 |
| 210 | Ga0157377_10262497 | 3300014745 | Bacteria | 1124 |
| 211 | Ga0157379_10023299 | 3300014968 | Bacteria | 5493 |
| 212 | Ga0157379_10118300 | 3300014968 | Bacteria | 2383 |
| 213 | Ga0157379_10244968 | 3300014968 | Bacteria | 1626 |
| 214 | Ga0157376_10063664 | 3300014969 | Bacteria | 3108 |
| 215 | Ga0157376_10360946 | 3300014969 | Bacteria | 1393 |
| 216 | Ga0157376_10761883 | 3300014969 | Bacteria | 978 |
| 217 | Ga0157376_11189507 | 3300014969 | Bacteria | 790 |
| 218 | Ga0182005_1042836 | 3300015265 | Bacteria | 1230 |
| 219 | Ga0207666_1010380 | 3300025271 | Bacteria | 1273 |
| 220 | Ga0207697_10000173 | 3300025315 | Bacteria | 32981 |
| 221 | Ga0207697_10195467 | 3300025315 | Bacteria | 889 |
| 222 | Ga0207642_10102160 | 3300025899 | Bacteria | 1442 |
| 223 | Ga0207688_10007915 | 3300025901 | Bacteria | 5785 |
| 224 | Ga0207645_10016805 | 3300025907 | Bacteria | 4838 |
| 225 | Ga0207705_10341692 | 3300025909 | Bacteria | 1152 |
| 226 | Ga0207654_10014094 | 3300025911 | Bacteria | 4125 |
| 227 | Ga0207707_10111879 | 3300025912 | Bacteria | 2387 |
| 228 | Ga0207695_10003747 | 3300025913 | Bacteria | 21137 |
| 229 | Ga0207695_10025050 | 3300025913 | Bacteria | 6692 |
| 230 | Ga0207695_10045629 | 3300025913 | Bacteria | 4650 |
| 231 | Ga0207695_10045878 | 3300025913 | Bacteria | 4635 |
| 232 | Ga0207695_10104126 | 3300025913 | Bacteria | 2828 |
| 233 | Ga0207671_10021522 | 3300025914 | Bacteria | 4889 |
| 234 | Ga0207671_10044095 | 3300025914 | Bacteria | 3298 |
| 235 | Ga0207671_10162139 | 3300025914 | Bacteria | 1732 |
| 236 | Ga0207671_10738935 | 3300025914 | Bacteria | 782 |
| 237 | Ga0207671_10949359 | 3300025914 | Bacteria | 679 |
| 238 | Ga0207662_10369721 | 3300025918 | Bacteria | 967 |
| 239 | Ga0207657_10046799 | 3300025919 | Bacteria | 3788 |
| 240 | Ga0207652_10264124 | 3300025921 | Bacteria | 1553 |
| 241 | Ga0207652_10587638 | 3300025921 | Bacteria | 999 |
| 242 | Ga0207646_10019358 | 3300025922 | Bacteria | 6328 |
| 243 | Ga0207646_10153518 | 3300025922 | Bacteria | 2076 |
| 244 | Ga0207646_10207476 | 3300025922 | Bacteria | 1770 |
| 245 | Ga0207646_10521504 | 3300025922 | Bacteria | 1070 |
| 246 | Ga0207646_10718046 | 3300025922 | Bacteria | 893 |
| 247 | Ga0207694_10014336 | 3300025924 | Bacteria | 5976 |
| 248 | Ga0207694_10419275 | 3300025924 | Bacteria | 1115 |
| 249 | Ga0207650_10098636 | 3300025925 | Bacteria | 2245 |
| 250 | Ga0207650_10228810 | 3300025925 | Bacteria | 1499 |
| 251 | Ga0207659_10026197 | 3300025926 | Bacteria | 3932 |
| 252 | Ga0207687_10725959 | 3300025927 | Bacteria | 844 |
| 253 | Ga0207644_10134521 | 3300025931 | Bacteria | 1897 |
| 254 | Ga0207644_10227184 | 3300025931 | Bacteria | 1482 |
| 255 | Ga0207644_10518538 | 3300025931 | Bacteria | 984 |
| 256 | Ga0207690_10103710 | 3300025932 | Bacteria | 2036 |
| 257 | Ga0207670_10000002 | 3300025936 | Bacteria | 783058 |
| 258 | Ga0207670_10000012 | 3300025936 | Bacteria | 246808 |
| 259 | Ga0207670_10263964 | 3300025936 | Bacteria | 1336 |
| 260 | Ga0207669_10042111 | 3300025937 | Bacteria | 2663 |
| 261 | Ga0207704_10174511 | 3300025938 | Bacteria | 1546 |
| 262 | Ga0207691_10754003 | 3300025940 | Bacteria | 819 |
| 263 | Ga0207711_10064760 | 3300025941 | Bacteria | 3158 |
| 264 | Ga0207711_10106196 | 3300025941 | Bacteria | 2491 |
| 265 | Ga0207711_10631861 | 3300025941 | Bacteria | 999 |
| 266 | Ga0207689_10626485 | 3300025942 | Bacteria | 906 |
| 267 | Ga0207661_10078568 | 3300025944 | Bacteria | 2717 |
| 268 | Ga0207661_10287051 | 3300025944 | Bacteria | 1472 |
| 269 | Ga0207661_10288691 | 3300025944 | Bacteria | 1468 |
| 270 | Ga0207661_11015252 | 3300025944 | Bacteria | 764 |
| 271 | Ga0207661_11282421 | 3300025944 | Bacteria | 673 |
| 272 | Ga0207679_10030460 | 3300025945 | Bacteria | 3768 |
| 273 | Ga0207679_10034339 | 3300025945 | Bacteria | 3577 |
| 274 | Ga0207679_10363743 | 3300025945 | Bacteria | 1264 |
| 275 | Ga0207679_10457720 | 3300025945 | Bacteria | 1132 |
| 276 | Ga0207679_11993590 | 3300025945 | Bacteria | 528 |
| 277 | Ga0207679_12176906 | 3300025945 | Bacteria | 503 |
| 278 | Ga0207667_10039807 | 3300025949 | Bacteria | 5006 |
| 279 | Ga0207667_10049769 | 3300025949 | Bacteria | 4424 |
| 280 | Ga0207667_10212252 | 3300025949 | Bacteria | 1984 |
| 281 | Ga0207651_10654016 | 3300025960 | Bacteria | 923 |
| 282 | Ga0207651_12005726 | 3300025960 | Bacteria | 520 |
| 283 | Ga0207640_11739770 | 3300025981 | Bacteria | 563 |
| 284 | Ga0207677_10008313 | 3300026023 | Bacteria | 5787 |
| 285 | Ga0207677_10145591 | 3300026023 | Bacteria | 1820 |
| 286 | Ga0207703_10001937 | 3300026035 | Bacteria | 18323 |
| 287 | Ga0207703_10037266 | 3300026035 | Bacteria | 3873 |
| 288 | Ga0207703_10998975 | 3300026035 | Bacteria | 803 |
| 289 | Ga0207639_10036972 | 3300026041 | Bacteria | 3623 |
| 290 | Ga0207639_10483036 | 3300026041 | Bacteria | 1129 |
| 291 | Ga0207678_10189061 | 3300026067 | Bacteria | 1759 |
| 292 | Ga0207702_10020443 | 3300026078 | Bacteria | 5484 |
| 293 | Ga0207702_10041493 | 3300026078 | Bacteria | 3859 |
| 294 | Ga0207702_10087494 | 3300026078 | Bacteria | 2720 |
| 295 | Ga0207648_10374689 | 3300026089 | Bacteria | 1286 |
| 296 | Ga0207674_10016506 | 3300026116 | Bacteria | 8081 |
| 297 | Ga0207675_100217558 | 3300026118 | Bacteria | 1840 |
| 298 | Ga0207683_10086652 | 3300026121 | Bacteria | 2784 |
| 299 | Ga0207428_10602153 | 3300027907 | Bacteria | 792 |
| 300 | Ga0268266_10004587 | 3300028379 | Bacteria | 13190 |
| 301 | Ga0268266_10211401 | 3300028379 | Bacteria | 1779 |
| 302 | Ga0268266_10458147 | 3300028379 | Bacteria | 1213 |
| 303 | Ga0268264_10841290 | 3300028381 | Bacteria | 919 |
| 304 | Ga0268264_10918900 | 3300028381 | Bacteria | 879 |
| 305 | Ga0265336_10025059 | 3300028666 | Bacteria | 1880 |
| 306 | Ga0265338_10047899 | 3300028800 | Bacteria | 3896 |
| 307 | Ga0265338_10169526 | 3300028800 | Bacteria | 1676 |
| 308 | Ga0265332_10071452 | 3300031238 | Bacteria | 1478 |
| 309 | Ga0265332_10140063 | 3300031238 | Bacteria | 1014 |
| 310 | Ga0265320_10025873 | 3300031240 | Bacteria | 3079 |
| 311 | Ga0265325_10069848 | 3300031241 | Bacteria | 1765 |
| 312 | Ga0265340_10001919 | 3300031247 | Bacteria | 11878 |
| 313 | Ga0265339_10005596 | 3300031249 | Bacteria | 8345 |
| 314 | Ga0265327_10334412 | 3300031251 | Bacteria | 663 |
| 315 | Ga0265316_10187562 | 3300031344 | Bacteria | 1538 |
| 316 | Ga0265314_10203779 | 3300031711 | Bacteria | 1167 |
| 317 | Ga0265342_10002056 | 3300031712 | Bacteria | 17870 |
| 318 | Ga0307405_10264235 | 3300031731 | Bacteria | 1287 |
| 319 | Ga0307413_10292404 | 3300031824 | Bacteria | 1231 |
| 320 | Ga0307406_10335624 | 3300031901 | Bacteria | 1175 |
| 321 | Ga0307407_10117357 | 3300031903 | Bacteria | 1681 |
| 322 | Ga0307409_100350603 | 3300031995 | Bacteria | 1393 |
| 323 | Ga0307409_100436971 | 3300031995 | Bacteria | 1260 |
| 324 | Ga0307416_100138336 | 3300032002 | Bacteria | 2208 |
| 325 | Ga0373930_0000190 | 3300034816 | Bacteria | 7423 |
| 326 | Ga0373958_0001725 | 3300034819 | Bacteria | 2969 |
| 327 | Ga0373959_0002213 | 3300034820 | Bacteria | 3100 |
| 328 | Ga0373928_0016570 | 3300035084 | Bacteria | 1509 |
| 329 | Ga0373929_0002028 | 3300035085 | Bacteria | 3770 |
| 330 | Ga0373940_0002904 | 3300035088 | Bacteria | 3415 |
| 331 | Ga0373949_0003873 | 3300035090 | Bacteria | 3477 |
| 332 | Ga0373951_0000928 | 3300035091 | Bacteria | 7886 |
| 333 | Ga0373952_0000354 | 3300035092 | Bacteria | 7749 |
| 334 | Ga0373923_0515455 | 3300035111 | Bacteria | 584 |
| 335 | Ga0373932_0000157 | 3300035112 | Bacteria | 19830 |
| 336 | Ga0373939_0000138 | 3300035114 | Bacteria | 20969 |
| 337 | Ga0373941_0006216 | 3300035115 | Bacteria | 2865 |
| 338 | Ga0373953_0115664 | 3300035117 | Bacteria | 1137 |
| 339 | Ga0373954_0030358 | 3300035118 | Bacteria | 2492 |
| 340 | Ga0373960_0001327 | 3300035121 | Bacteria | 5444 |
| 341 | Ga0373943_0008200 | 3300035170 | Bacteria | 4689 |
| 342 | Ga0373942_0001220 | 3300035207 | Bacteria | 6767 |
| 343 | Ga0373961_0031744 | 3300035241 | Bacteria | 1477 |
| 344 | Ga0373962_0000383 | 3300035242 | Bacteria | 9648 |
| 345 | Ga0373931_0003364 | 3300035691 | Bacteria | 7168 |
| 346 | Ga0373935_0374018 | 3300035692 | Unclassified | 1019 |
| 347 | Ga0373933_0005592 | 3300035724 | Bacteria | 6848 |
| 348 | Ga0373933_0106380 | 3300035724 | Bacteria | 1746 |
| 349 | Ga0373937_0020221 | 3300036401 | Bacteria | 5967 |
| 350 | Ga0373937_0488243 | 3300036401 | Bacteria | 1170 |
| 351 | Ga0373937_0584231 | 3300036401 | Bacteria | 1061 |
| 352 | Ga0373937_0666696 | 3300036401 | Unclassified | 986 |
| 353 | Ga0373937_0903175 | 3300036401 | Bacteria | 832 |
| 354 | Ga0373937_0950083 | 3300036401 | Bacteria | 808 |
| 355 | Ga0373937_0983606 | 3300036401 | Bacteria | 792 |
| 356 | Ga0373925_0240363 | 3300037068 | Bacteria | 1450 |
| 357 | Ga0373925_1768906 | 3300037068 | Bacteria | 504 |
| 358 | Ga0395899_0000019 | 3300037312 | Bacteria | 411777 |
| 359 | Ga0436364_1460136 | 3300037853 | Bacteria | 559 |
| 360 | Ga0395901_0783806 | 3300038443 | Bacteria | 944 |
| 361 | Ga0450893_0123964 | 3300042532 | Bacteria | 541 |
| 362 | Ga0466966_0031693 | 3300044684 | Bacteria | 3428 |
| 363 | Ga0466970_0332934 | 3300044765 | Bacteria | 860 |
| 364 | Ga0466959_0005273 | 3300045049 | Bacteria | 8831 |
| 365 | Ga0451576_0009094 | 3300045051 | Bacteria | 11560 |
| 366 | Ga0451576_0062809 | 3300045051 | Bacteria | 3871 |
| 367 | Ga0495592_0010328 | 3300046454 | Bacteria | 7038 |
| 368 | Ga0495592_0012697 | 3300046454 | Bacteria | 6402 |
| 369 | Ga0495592_0222510 | 3300046454 | Bacteria | 1261 |
| 370 | Ga0495629_0625001 | 3300046459 | Bacteria | 719 |
| 371 | Ga0495651_0019400 | 3300046462 | Bacteria | 5270 |
| 372 | Ga0495651_0305973 | 3300046462 | Bacteria | 1065 |
| 373 | Ga0495653_0023865 | 3300046463 | Bacteria | 4937 |
| 374 | Ga0495653_0232733 | 3300046463 | Bacteria | 1232 |
| 375 | Ga0495580_0116131 | 3300046472 | Bacteria | 1859 |
| 376 | Ga0495582_0100246 | 3300046473 | Bacteria | 1621 |
| 377 | Ga0495662_0089186 | 3300046476 | Bacteria | 1502 |
| 378 | Ga0495662_0234314 | 3300046476 | Unclassified | 905 |
| 379 | Ga0495664_0009481 | 3300046477 | Bacteria | 5448 |
| 380 | Ga0495594_0043164 | 3300046499 | Bacteria | 2471 |
| 381 | Ga0495608_0100893 | 3300046511 | Bacteria | 1861 |
| 382 | Ga0495608_0336005 | 3300046511 | Bacteria | 931 |
| 383 | Ga0495618_0320603 | 3300046514 | Bacteria | 960 |
| 384 | Ga0495628_0031632 | 3300046516 | Bacteria | 4279 |
| 385 | Ga0495628_0031961 | 3300046516 | Bacteria | 4253 |
| 386 | Ga0495628_0383723 | 3300046516 | Bacteria | 1028 |
| 387 | Ga0495630_0001715 | 3300046517 | Bacteria | 15275 |
| 388 | Ga0495630_0098503 | 3300046517 | Bacteria | 2211 |
| 389 | Ga0495630_0118473 | 3300046517 | Bacteria | 2008 |
| 390 | Ga0495630_0433423 | 3300046517 | Bacteria | 1007 |
| 391 | Ga0495642_0037283 | 3300046528 | Bacteria | 1967 |
| 392 | Ga0495642_0496577 | 3300046528 | Bacteria | 540 |
| 393 | Ga0495652_0005289 | 3300046529 | Bacteria | 12170 |
| 394 | Ga0495652_0013888 | 3300046529 | Bacteria | 7244 |
| 395 | Ga0495665_0131718 | 3300046531 | Bacteria | 1309 |
| 396 | Ga0495665_0273764 | 3300046531 | Bacteria | 867 |
| 397 | Ga0495640_0058582 | 3300046533 | Bacteria | 2626 |
| 398 | Ga0495640_0259525 | 3300046533 | Bacteria | 1086 |
| 399 | Ga0495586_0050873 | 3300046535 | Bacteria | 2242 |
| 400 | Ga0495586_0062284 | 3300046535 | Bacteria | 2030 |
| 401 | Ga0495586_0228772 | 3300046535 | Bacteria | 1058 |
| 402 | Ga0495587_0318792 | 3300046536 | Bacteria | 868 |
| 403 | Ga0495645_0004376 | 3300046543 | Bacteria | 9646 |
| 404 | Ga0495645_0012448 | 3300046543 | Bacteria | 5995 |
| 405 | Ga0495645_0045675 | 3300046543 | Bacteria | 3196 |
| 406 | Ga0495645_0093075 | 3300046543 | Bacteria | 2152 |
| 407 | Ga0495645_0559087 | 3300046543 | Bacteria | 708 |
| 408 | Ga0495622_0131859 | 3300046557 | Bacteria | 1138 |
| 409 | Ga0495667_0072161 | 3300046559 | Bacteria | 2251 |
| 410 | Ga0495667_0288240 | 3300046559 | Bacteria | 1041 |
| 411 | Ga0495634_0079517 | 3300046642 | Bacteria | 2147 |
| 412 | Ga0495634_0373011 | 3300046642 | Bacteria | 851 |
| 413 | Ga0495634_0623057 | 3300046642 | Bacteria | 625 |
| 414 | Ga0495635_0125875 | 3300046663 | Bacteria | 1747 |
| 415 | Ga0495635_0134835 | 3300046663 | Bacteria | 1683 |
| 416 | Ga0495659_0005932 | 3300046664 | Bacteria | 3863 |
| 417 | Ga0495657_0298040 | 3300046675 | Bacteria | 962 |
| 418 | Ga0495599_0009115 | 3300046678 | Bacteria | 6050 |
| 419 | Ga0495623_0008411 | 3300046679 | Bacteria | 6706 |
| 420 | Ga0495623_0023472 | 3300046679 | Bacteria | 3981 |
| 421 | Ga0495646_0031461 | 3300046680 | Bacteria | 3306 |
| 422 | Ga0495647_0047070 | 3300046681 | Bacteria | 1663 |
| 423 | Ga0495647_0048000 | 3300046681 | Bacteria | 1649 |
| 424 | Ga0495647_0117742 | 3300046681 | Bacteria | 1115 |
| 425 | Ga0495658_0007509 | 3300046683 | Bacteria | 5400 |
| 426 | Ga0495658_0034712 | 3300046683 | Bacteria | 2769 |
| 427 | Ga0495669_0040346 | 3300046684 | Bacteria | 2070 |
| 428 | Ga0495613_0000501 | 3300046689 | Bacteria | 33165 |
| 429 | Ga0495613_0315689 | 3300046689 | Bacteria | 1079 |
| 430 | Ga0495613_0392185 | 3300046689 | Bacteria | 948 |
| 431 | Ga0495600_0024267 | 3300046809 | Bacteria | 3903 |
| 432 | Ga0495600_0286281 | 3300046809 | Bacteria | 1042 |
| 433 | Ga0495600_0519598 | 3300046809 | Unclassified | 730 |
| 434 | Ga0495604_0043490 | 3300047317 | Bacteria | 3516 |
| 435 | Ga0495604_0054215 | 3300047317 | Bacteria | 3095 |
| 436 | Ga0495604_0163604 | 3300047317 | Bacteria | 1570 |
| 437 | Ga0495674_0026206 | 3300047319 | Bacteria | 5336 |
| 438 | Ga0495674_0060670 | 3300047319 | Bacteria | 3299 |
| 439 | Ga0495674_0776331 | 3300047319 | Bacteria | 747 |
| 440 | Ga0495674_1006766 | 3300047319 | Bacteria | 638 |
| 441 | Ga0495676_0408297 | 3300047321 | Bacteria | 900 |
| 442 | Ga0495680_0029148 | 3300047322 | Bacteria | 4522 |
| 443 | Ga0495680_0042118 | 3300047322 | Bacteria | 3626 |
| 444 | Ga0495680_0216762 | 3300047322 | Bacteria | 1368 |
| 445 | Ga0495680_0221233 | 3300047322 | Bacteria | 1351 |
| 446 | Ga0495680_0368071 | 3300047322 | Unclassified | 998 |
| 447 | Ga0495675_0030348 | 3300047444 | Bacteria | 3449 |
| 448 | Ga0495675_0092974 | 3300047444 | Bacteria | 1892 |
| 449 | Ga0495685_144491 | 3300047447 | Bacteria | 774 |
| 450 | Ga0495684_0000965 | 3300047471 | Bacteria | 23436 |
| 451 | Ga0495684_0000985 | 3300047471 | Bacteria | 23151 |
| 452 | Ga0495686_0477423 | 3300047472 | Bacteria | 659 |
| 453 | Ga0495593_0443683 | 3300047673 | Bacteria | 649 |
| 454 | Ga0495602_0052199 | 3300048088 | Bacteria | 3634 |
| 455 | Ga0495602_0060547 | 3300048088 | Bacteria | 3298 |
| 456 | Ga0495614_0397125 | 3300048089 | Bacteria | 647 |
| 457 | Ga0496100_0056589 | 3300048903 | Bacteria | 2566 |
| 458 | Ga0496100_0361963 | 3300048903 | Bacteria | 1098 |
| 459 | Ga0496101_0017382 | 3300048904 | Bacteria | 4879 |
| 460 | Ga0496102_0041163 | 3300048905 | Bacteria | 4183 |
| 461 | Ga0496102_1783886 | 3300048905 | Bacteria | 533 |
| 462 | Ga0496104_0004247 | 3300048907 | Bacteria | 12444 |
| 463 | Ga0496104_0036250 | 3300048907 | Bacteria | 4611 |
| 464 | Ga0496105_0317164 | 3300048908 | Bacteria | 1250 |
| 465 | Ga0496107_0021957 | 3300048910 | Bacteria | 4509 |
| 466 | Ga0496107_0523554 | 3300048910 | Bacteria | 879 |
| 467 | Ga0496108_0607706 | 3300048911 | Bacteria | 953 |
| 468 | Ga0496108_1581274 | 3300048911 | Bacteria | 543 |
| 469 | Ga0496109_0105997 | 3300048912 | Bacteria | 2611 |
| 470 | Ga0496109_0290550 | 3300048912 | Bacteria | 1541 |
| 471 | Ga0496110_0142980 | 3300048913 | Bacteria | 2163 |
| 472 | Ga0496113_0835433 | 3300048916 | Bacteria | 731 |
| 473 | Ga0496114_0002088 | 3300048917 | Bacteria | 15192 |
| 474 | Ga0496114_0022030 | 3300048917 | Bacteria | 5188 |
| 475 | Ga0496115_0047999 | 3300048918 | Bacteria | 3415 |
| 476 | Ga0496115_0218513 | 3300048918 | Bacteria | 1573 |
| 477 | Ga0496122_0044838 | 3300048925 | Bacteria | 3446 |
| 478 | Ga0496123_0025405 | 3300048926 | Bacteria | 4467 |
| 479 | Ga0496125_0061258 | 3300048928 | Bacteria | 3019 |
| 480 | Ga0496126_0556773 | 3300048929 | Bacteria | 909 |
| 481 | Ga0495678_187849 | 3300049459 | Bacteria | 644 |
| 482 | Ga0501031_0023510 | 3300049568 | Bacteria | 4017 |
| 483 | Ga0501032_0006619 | 3300049569 | Bacteria | 8506 |
| 484 | Ga0501033_0033473 | 3300049570 | Bacteria | 3857 |
| 485 | Ga0501034_0631203 | 3300049571 | Bacteria | 974 |
| 486 | Ga0501036_0009240 | 3300049572 | Bacteria | 8105 |
| 487 | Ga0501037_0001053 | 3300049573 | Bacteria | 20410 |
| 488 | Ga0501038_0001986 | 3300049574 | Bacteria | 18917 |
| 489 | Ga0501039_0009525 | 3300049575 | Bacteria | 7403 |
| 490 | Ga0501043_0001018 | 3300049579 | Bacteria | 24636 |
| 491 | Ga0501046_0000258 | 3300049580 | Bacteria | 53994 |
| 492 | Ga0501046_0396966 | 3300049580 | Bacteria | 997 |
| 493 | Ga0501047_0000977 | 3300049581 | Bacteria | 28782 |
| 494 | Ga0501068_0105988 | 3300049584 | Bacteria | 1745 |
| 495 | Ga0501069_0109389 | 3300049585 | Bacteria | 1573 |
| 496 | Ga0501073_0016701 | 3300049589 | Bacteria | 5318 |
| 497 | Ga0501073_1081196 | 3300049589 | Bacteria | 551 |
| 498 | Ga0501074_0164907 | 3300049590 | Bacteria | 1582 |
| 499 | Ga0501074_0874693 | 3300049590 | Bacteria | 633 |
| 500 | Ga0501075_0293412 | 3300049591 | Bacteria | 1239 |
| 501 | Ga0501076_0912039 | 3300049592 | Bacteria | 724 |
| 502 | Ga0501080_0014125 | 3300049742 | Bacteria | 7350 |
| 503 | Ga0501035_0080665 | 3300049822 | Bacteria | 2872 |
| 504 | Ga0501044_0020441 | 3300049823 | Bacteria | 7069 |
| 505 | Ga0501044_0428637 | 3300049823 | Bacteria | 1232 |
| 506 | Ga0501045_0538802 | 3300049824 | Bacteria | 866 |
| 507 | nmdc:mga03683_207867_c1 | 3300050489 | Bacteria | 900 |
| 508 | nmdc:mga03683_419311_c1 | 3300050489 | Bacteria | 641 |
| 509 | nmdc:mga00v17_721694_c1 | 3300050491 | Bacteria | 638 |
| 510 | nmdc:mga0k408_659704_c1 | 3300050493 | Bacteria | 615 |
| 511 | nmdc:mga05p37_110882_c2 | 3300050507 | Bacteria | 2898 |
| 512 | nmdc:mga05p37_1163168_c1 | 3300050507 | Bacteria | 801 |
| 513 | nmdc:mga05p37_118491_c1 | 3300050507 | Bacteria | 3253 |
| 514 | nmdc:mga05p37_19171_c1 | 3300050507 | Bacteria | 8274 |
| 515 | nmdc:mga05p37_3539_c1 | 3300050507 | Bacteria | 18225 |
| 516 | nmdc:mga05p37_366953_c1 | 3300050507 | Bacteria | 1691 |
| 517 | nmdc:mga09592_622283_c1 | 3300050508 | Bacteria | 924 |
| 518 | nmdc:mga0qj67_172671_c1 | 3300050509 | Bacteria | 1755 |
| 519 | nmdc:mga06r32_240521_c1 | 3300050510 | Bacteria | 1798 |
| 520 | nmdc:mga06r32_48184_c1 | 3300050510 | Bacteria | 4073 |
| 521 | nmdc:mga08y16_102464_c1 | 3300050511 | Bacteria | 2980 |
| 522 | nmdc:mga08y16_433823_c1 | 3300050511 | Bacteria | 1342 |
| 523 | nmdc:mga0n895_10417_c1 | 3300050512 | Bacteria | 8210 |
| 524 | nmdc:mga0n895_104199_c1 | 3300050512 | Bacteria | 2849 |
| 525 | nmdc:mga0rr50_15448_c1 | 3300050513 | Bacteria | 5042 |
| 526 | nmdc:mga0rr50_46356_c1 | 3300050513 | Bacteria | 3200 |
| 527 | nmdc:mga0rr50_67727_c1 | 3300050513 | Bacteria | 2713 |
| 528 | nmdc:mga08x19_1124062_c1 | 3300050514 | Bacteria | 557 |
| 529 | nmdc:mga08x19_490821_c1 | 3300050514 | Bacteria | 866 |
| 530 | nmdc:mga08x19_6557_c1 | 3300050514 | Bacteria | 6896 |
| 531 | nmdc:mga0a205_1046866_c1 | 3300050515 | Bacteria | 663 |
| 532 | nmdc:mga0a205_41606_c1 | 3300050515 | Bacteria | 4426 |
| 533 | nmdc:mga0a205_595710_c1 | 3300050515 | Bacteria | 959 |
| 534 | Ga0495601_0051819 | 3300053077 | Bacteria | 2591 |
| 535 | Ga0495601_0074277 | 3300053077 | Bacteria | 2175 |
| 536 | Ga0495601_0265388 | 3300053077 | Bacteria | 1120 |
| 537 | Ga0495601_0382164 | 3300053077 | Bacteria | 914 |
| 538 | Ga0495595_0064272 | 3300053084 | Bacteria | 1724 |
| 539 | Ga0495595_0215182 | 3300053084 | Bacteria | 958 |
| 540 | Ga0495595_0521376 | 3300053084 | Bacteria | 606 |
| 541 | Ga0495619_0004782 | 3300053085 | Bacteria | 8613 |
| 542 | Ga0495619_0006716 | 3300053085 | Bacteria | 7279 |
| 543 | Ga0495619_0006938 | 3300053085 | Bacteria | 7163 |
| 544 | Ga0495619_0138076 | 3300053085 | Bacteria | 1677 |
| 545 | Ga0500583_0433699 | 3300053092 | Bacteria | 626 |
| 546 | Ga0587076_018069 | 3300059645 | Bacteria | 1132 |
| 547 | Ga0587079_159391 | 3300059647 | Bacteria | 589 |
| 548 | Ga0530510_0395037 | 3300061734 | Bacteria | 1042 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046543 | Ga0495645_0093075 | Ga0495645_0093075_1173_1733 | 117 |
| 2 | 3300005617 | Ga0068859_100977571 | Ga0068859_1009775712 | 124 |
| 3 | 3300006931 | Ga0097620_100977415 | Ga0097620_1009774152 | 124 |
| 4 | 3300046681 | Ga0495647_0047070 | Ga0495647_0047070_1089_1586 | 128 |
| 5 | 3300049569 | Ga0501032_0006619 | Ga0501032_0006619_1518_1958 | 129 |
| 6 | 3300049572 | Ga0501036_0009240 | Ga0501036_0009240_809_1249 | 129 |
| 7 | 3300049573 | Ga0501037_0001053 | Ga0501037_0001053_19731_20171 | 129 |
| 8 | 3300049574 | Ga0501038_0001986 | Ga0501038_0001986_3282_3722 | 129 |
| 9 | 3300049579 | Ga0501043_0001018 | Ga0501043_0001018_3405_3845 | 129 |
| 10 | 3300049584 | Ga0501068_0105988 | Ga0501068_0105988_104_544 | 129 |
| 11 | 3300049590 | Ga0501074_0164907 | Ga0501074_0164907_950_1390 | 129 |
| 12 | 3300006237 | Ga0097621_101999760 | Ga0097621_1019997601 | 130 |
| 13 | 3300006358 | Ga0068871_100808094 | Ga0068871_1008080941 | 130 |
| 14 | 3300009093 | Ga0105240_10003190 | Ga0105240_1000319026 | 130 |
| 15 | 3300009098 | Ga0105245_10681560 | Ga0105245_106815602 | 130 |
| 16 | 3300010375 | Ga0105239_10900287 | Ga0105239_109002871 | 130 |
| 17 | 3300011119 | Ga0105246_10429306 | Ga0105246_104293062 | 130 |
| 18 | 3300014968 | Ga0157379_10023299 | Ga0157379_100232991 | 130 |
| 19 | 3300025927 | Ga0207687_10725959 | Ga0207687_107259592 | 130 |
| 20 | 3300025931 | Ga0207644_10518538 | Ga0207644_105185382 | 130 |
| 21 | 3300036401 | Ga0373937_0950083 | Ga0373937_0950083_279_713 | 130 |
| 22 | 3300048929 | Ga0496126_0556773 | Ga0496126_0556773_182_613 | 130 |
| 23 | 3300049823 | Ga0501044_0428637 | Ga0501044_0428637_271_699 | 130 |
| 24 | 3300005466 | Ga0070685_10129576 | Ga0070685_101295762 | 131 |
| 25 | 3300005563 | Ga0068855_100310169 | Ga0068855_1003101694 | 131 |
| 26 | 3300005614 | Ga0068856_100251061 | Ga0068856_1002510613 | 131 |
| 27 | 3300005617 | Ga0068859_100034183 | Ga0068859_1000341834 | 131 |
| 28 | 3300005842 | Ga0068858_100002668 | Ga0068858_10000266816 | 131 |
| 29 | 3300006931 | Ga0097620_100034180 | Ga0097620_1000341804 | 131 |
| 30 | 3300009093 | Ga0105240_10021753 | Ga0105240_100217537 | 131 |
| 31 | 3300009101 | Ga0105247_10252371 | Ga0105247_102523711 | 131 |
| 32 | 3300009147 | Ga0114129_12754912 | Ga0114129_127549122 | 131 |
| 33 | 3300009177 | Ga0105248_10016703 | Ga0105248_100167038 | 131 |
| 34 | 3300009551 | Ga0105238_11468180 | Ga0105238_114681802 | 131 |
| 35 | 3300010375 | Ga0105239_10095116 | Ga0105239_100951165 | 131 |
| 36 | 3300014968 | Ga0157379_10244968 | Ga0157379_102449682 | 131 |
| 37 | 3300025913 | Ga0207695_10025050 | Ga0207695_100250508 | 131 |
| 38 | 3300025914 | Ga0207671_10162139 | Ga0207671_101621392 | 131 |
| 39 | 3300025924 | Ga0207694_10419275 | Ga0207694_104192752 | 131 |
| 40 | 3300025941 | Ga0207711_10106196 | Ga0207711_101061962 | 131 |
| 41 | 3300025949 | Ga0207667_10212252 | Ga0207667_102122521 | 131 |
| 42 | 3300026035 | Ga0207703_10001937 | Ga0207703_1000193711 | 131 |
| 43 | 3300026078 | Ga0207702_10087494 | Ga0207702_100874945 | 131 |
| 44 | 3300005336 | Ga0070680_100024536 | Ga0070680_1000245363 | 132 |
| 45 | 3300005458 | Ga0070681_10360312 | Ga0070681_103603122 | 132 |
| 46 | 3300005530 | Ga0070679_100054622 | Ga0070679_1000546226 | 132 |
| 47 | 3300005535 | Ga0070684_100133335 | Ga0070684_1001333351 | 132 |
| 48 | 3300005719 | Ga0068861_100189500 | Ga0068861_1001895002 | 132 |
| 49 | 3300006038 | Ga0075365_10070994 | Ga0075365_100709943 | 132 |
| 50 | 3300006847 | Ga0075431_101652549 | Ga0075431_1016525491 | 132 |
| 51 | 3300006852 | Ga0075433_10005620 | Ga0075433_1000562014 | 132 |
| 52 | 3300006871 | Ga0075434_100034229 | Ga0075434_1000342296 | 132 |
| 53 | 3300006914 | Ga0075436_100008890 | Ga0075436_1000088905 | 132 |
| 54 | 3300007076 | Ga0075435_100027708 | Ga0075435_1000277085 | 132 |
| 55 | 3300009147 | Ga0114129_10018464 | Ga0114129_100184649 | 132 |
| 56 | 3300009147 | Ga0114129_10053679 | Ga0114129_100536797 | 132 |
| 57 | 3300013104 | Ga0157370_10169793 | Ga0157370_101697931 | 132 |
| 58 | 3300013296 | Ga0157374_10116705 | Ga0157374_101167054 | 132 |
| 59 | 3300013306 | Ga0163162_11765998 | Ga0163162_117659981 | 132 |
| 60 | 3300014969 | Ga0157376_10360946 | Ga0157376_103609462 | 132 |
| 61 | 3300025922 | Ga0207646_10019358 | Ga0207646_100193582 | 132 |
| 62 | 3300047317 | Ga0495604_0043490 | Ga0495604_0043490_1564_1998 | 132 |
| 63 | 3300047444 | Ga0495675_0030348 | Ga0495675_0030348_1148_1582 | 132 |
| 64 | 3300050489 | nmdc:mga03683_207867_c1 | nmdc:mga03683_207867_c1_73_513 | 132 |
| 65 | 3300050489 | nmdc:mga03683_419311_c1 | nmdc:mga03683_419311_c1_119_559 | 132 |
| 66 | 3300050491 | nmdc:mga00v17_721694_c1 | nmdc:mga00v17_721694_c1_22_462 | 132 |
| 67 | 3300050493 | nmdc:mga0k408_659704_c1 | nmdc:mga0k408_659704_c1_49_489 | 132 |
| 68 | 3300050507 | nmdc:mga05p37_3539_c1 | nmdc:mga05p37_3539_c1_5904_6332 | 132 |
| 69 | 3300050508 | nmdc:mga09592_622283_c1 | nmdc:mga09592_622283_c1_125_592 | 132 |
| 70 | 3300050509 | nmdc:mga0qj67_172671_c1 | nmdc:mga0qj67_172671_c1_161_628 | 132 |
| 71 | 3300050510 | nmdc:mga06r32_48184_c1 | nmdc:mga06r32_48184_c1_1729_2196 | 132 |
| 72 | 3300050512 | nmdc:mga0n895_10417_c1 | nmdc:mga0n895_10417_c1_5003_5452 | 132 |
| 73 | 3300050512 | nmdc:mga0n895_104199_c1 | nmdc:mga0n895_104199_c1_1212_1679 | 132 |
| 74 | 3300050513 | nmdc:mga0rr50_15448_c1 | nmdc:mga0rr50_15448_c1_2334_2783 | 132 |
| 75 | 3300050513 | nmdc:mga0rr50_67727_c1 | nmdc:mga0rr50_67727_c1_543_1010 | 132 |
| 76 | 3300050514 | nmdc:mga08x19_6557_c1 | nmdc:mga08x19_6557_c1_5794_6243 | 132 |
| 77 | 3300050515 | nmdc:mga0a205_41606_c1 | nmdc:mga0a205_41606_c1_2542_2991 | 132 |
| 78 | 3300005290 | Ga0065712_10132493 | Ga0065712_101324933 | 133 |
| 79 | 3300005293 | Ga0065715_10869015 | Ga0065715_108690151 | 133 |
| 80 | 3300005295 | Ga0065707_10115429 | Ga0065707_101154295 | 133 |
| 81 | 3300005329 | Ga0070683_100237802 | Ga0070683_1002378022 | 133 |
| 82 | 3300005330 | Ga0070690_100279245 | Ga0070690_1002792451 | 133 |
| 83 | 3300005338 | Ga0068868_100053829 | Ga0068868_1000538295 | 133 |
| 84 | 3300005340 | Ga0070689_100000101 | Ga0070689_10000010117 | 133 |
| 85 | 3300005356 | Ga0070674_100678123 | Ga0070674_1006781232 | 133 |
| 86 | 3300005364 | Ga0070673_100483734 | Ga0070673_1004837341 | 133 |
| 87 | 3300005365 | Ga0070688_100000001 | Ga0070688_10000000119 | 133 |
| 88 | 3300005367 | Ga0070667_100638324 | Ga0070667_1006383243 | 133 |
| 89 | 3300005434 | Ga0070709_10134980 | Ga0070709_101349802 | 133 |
| 90 | 3300005437 | Ga0070710_10126867 | Ga0070710_101268672 | 133 |
| 91 | 3300005439 | Ga0070711_101462076 | Ga0070711_1014620761 | 133 |
| 92 | 3300005456 | Ga0070678_100317871 | Ga0070678_1003178712 | 133 |
| 93 | 3300005457 | Ga0070662_100030034 | Ga0070662_1000300342 | 133 |
| 94 | 3300005458 | Ga0070681_10247445 | Ga0070681_102474452 | 133 |
| 95 | 3300005466 | Ga0070685_10092012 | Ga0070685_100920125 | 133 |
| 96 | 3300005471 | Ga0070698_101052491 | Ga0070698_1010524911 | 133 |
| 97 | 3300005530 | Ga0070679_100137445 | Ga0070679_1001374451 | 133 |
| 98 | 3300005535 | Ga0070684_100141544 | Ga0070684_1001415442 | 133 |
| 99 | 3300005539 | Ga0068853_100662200 | Ga0068853_1006622002 | 133 |
| 100 | 3300005563 | Ga0068855_100097809 | Ga0068855_1000978093 | 133 |
| 101 | 3300005564 | Ga0070664_100614192 | Ga0070664_1006141922 | 133 |
| 102 | 3300005578 | Ga0068854_100944915 | Ga0068854_1009449151 | 133 |
| 103 | 3300005614 | Ga0068856_100017387 | Ga0068856_1000173875 | 133 |
| 104 | 3300005616 | Ga0068852_100209420 | Ga0068852_1002094203 | 133 |
| 105 | 3300005617 | Ga0068859_101757604 | Ga0068859_1017576042 | 133 |
| 106 | 3300005718 | Ga0068866_10026547 | Ga0068866_100265472 | 133 |
| 107 | 3300005718 | Ga0068866_10073036 | Ga0068866_100730361 | 133 |
| 108 | 3300005718 | Ga0068866_10387482 | Ga0068866_103874821 | 133 |
| 109 | 3300005719 | Ga0068861_100555659 | Ga0068861_1005556593 | 133 |
| 110 | 3300005719 | Ga0068861_101965896 | Ga0068861_1019658961 | 133 |
| 111 | 3300005841 | Ga0068863_100327412 | Ga0068863_1003274123 | 133 |
| 112 | 3300005844 | Ga0068862_100329106 | Ga0068862_1003291063 | 133 |
| 113 | 3300005844 | Ga0068862_100951623 | Ga0068862_1009516233 | 133 |
| 114 | 3300006028 | Ga0070717_10207889 | Ga0070717_102078893 | 133 |
| 115 | 3300006177 | Ga0075362_10000363 | Ga0075362_100003635 | 133 |
| 116 | 3300006195 | Ga0075366_10022348 | Ga0075366_100223484 | 133 |
| 117 | 3300006237 | Ga0097621_100201189 | Ga0097621_1002011891 | 133 |
| 118 | 3300006358 | Ga0068871_100046325 | Ga0068871_1000463255 | 133 |
| 119 | 3300006358 | Ga0068871_100775412 | Ga0068871_1007754122 | 133 |
| 120 | 3300006852 | Ga0075433_10653137 | Ga0075433_106531372 | 133 |
| 121 | 3300006881 | Ga0068865_100014987 | Ga0068865_1000149876 | 133 |
| 122 | 3300006931 | Ga0097620_100911930 | Ga0097620_1009119302 | 133 |
| 123 | 3300006931 | Ga0097620_101757593 | Ga0097620_1017575932 | 133 |
| 124 | 3300009093 | Ga0105240_10013677 | Ga0105240_100136772 | 133 |
| 125 | 3300009093 | Ga0105240_10050819 | Ga0105240_100508192 | 133 |
| 126 | 3300009098 | Ga0105245_10251248 | Ga0105245_102512482 | 133 |
| 127 | 3300009101 | Ga0105247_10037076 | Ga0105247_100370762 | 133 |
| 128 | 3300009148 | Ga0105243_10072216 | Ga0105243_100722166 | 133 |
| 129 | 3300009174 | Ga0105241_10082389 | Ga0105241_100823891 | 133 |
| 130 | 3300009176 | Ga0105242_10050465 | Ga0105242_100504653 | 133 |
| 131 | 3300009176 | Ga0105242_10088116 | Ga0105242_100881164 | 133 |
| 132 | 3300009177 | Ga0105248_10105109 | Ga0105248_101051093 | 133 |
| 133 | 3300009177 | Ga0105248_10131281 | Ga0105248_101312813 | 133 |
| 134 | 3300009545 | Ga0105237_10007563 | Ga0105237_1000756310 | 133 |
| 135 | 3300009551 | Ga0105238_10596671 | Ga0105238_105966712 | 133 |
| 136 | 3300009551 | Ga0105238_10621610 | Ga0105238_106216101 | 133 |
| 137 | 3300009553 | Ga0105249_10111933 | Ga0105249_101119333 | 133 |
| 138 | 3300010375 | Ga0105239_10084586 | Ga0105239_100845862 | 133 |
| 139 | 3300010375 | Ga0105239_10290497 | Ga0105239_102904974 | 133 |
| 140 | 3300013104 | Ga0157370_10984598 | Ga0157370_109845982 | 133 |
| 141 | 3300013105 | Ga0157369_10431371 | Ga0157369_104313712 | 133 |
| 142 | 3300013105 | Ga0157369_10678418 | Ga0157369_106784182 | 133 |
| 143 | 3300013296 | Ga0157374_10037668 | Ga0157374_100376683 | 133 |
| 144 | 3300013296 | Ga0157374_10785018 | Ga0157374_107850182 | 133 |
| 145 | 3300013296 | Ga0157374_11546171 | Ga0157374_115461712 | 133 |
| 146 | 3300013297 | Ga0157378_10005847 | Ga0157378_100058476 | 133 |
| 147 | 3300013297 | Ga0157378_10284868 | Ga0157378_102848682 | 133 |
| 148 | 3300013297 | Ga0157378_10923679 | Ga0157378_109236792 | 133 |
| 149 | 3300013297 | Ga0157378_11967509 | Ga0157378_119675091 | 133 |
| 150 | 3300013306 | Ga0163162_10112464 | Ga0163162_101124646 | 133 |
| 151 | 3300013306 | Ga0163162_10346429 | Ga0163162_103464294 | 133 |
| 152 | 3300013307 | Ga0157372_10130575 | Ga0157372_101305752 | 133 |
| 153 | 3300013307 | Ga0157372_10293508 | Ga0157372_102935082 | 133 |
| 154 | 3300013308 | Ga0157375_10006070 | Ga0157375_100060709 | 133 |
| 155 | 3300013308 | Ga0157375_10049954 | Ga0157375_100499542 | 133 |
| 156 | 3300014325 | Ga0163163_10309771 | Ga0163163_103097713 | 133 |
| 157 | 3300014326 | Ga0157380_11170801 | Ga0157380_111708012 | 133 |
| 158 | 3300014745 | Ga0157377_10262497 | Ga0157377_102624973 | 133 |
| 159 | 3300014969 | Ga0157376_10761883 | Ga0157376_107618832 | 133 |
| 160 | 3300014969 | Ga0157376_11189507 | Ga0157376_111895072 | 133 |
| 161 | 3300025899 | Ga0207642_10102160 | Ga0207642_101021602 | 133 |
| 162 | 3300025912 | Ga0207707_10111879 | Ga0207707_101118792 | 133 |
| 163 | 3300025913 | Ga0207695_10003747 | Ga0207695_100037474 | 133 |
| 164 | 3300025913 | Ga0207695_10045629 | Ga0207695_100456295 | 133 |
| 165 | 3300025913 | Ga0207695_10045878 | Ga0207695_100458782 | 133 |
| 166 | 3300025913 | Ga0207695_10104126 | Ga0207695_101041263 | 133 |
| 167 | 3300025914 | Ga0207671_10021522 | Ga0207671_100215223 | 133 |
| 168 | 3300025914 | Ga0207671_10044095 | Ga0207671_100440952 | 133 |
| 169 | 3300025914 | Ga0207671_10738935 | Ga0207671_107389351 | 133 |
| 170 | 3300025918 | Ga0207662_10369721 | Ga0207662_103697211 | 133 |
| 171 | 3300025921 | Ga0207652_10264124 | Ga0207652_102641241 | 133 |
| 172 | 3300025922 | Ga0207646_10718046 | Ga0207646_107180462 | 133 |
| 173 | 3300025936 | Ga0207670_10000012 | Ga0207670_1000001263 | 133 |
| 174 | 3300025936 | Ga0207670_10263964 | Ga0207670_102639642 | 133 |
| 175 | 3300025941 | Ga0207711_10064760 | Ga0207711_100647604 | 133 |
| 176 | 3300025941 | Ga0207711_10631861 | Ga0207711_106318612 | 133 |
| 177 | 3300025942 | Ga0207689_10626485 | Ga0207689_106264851 | 133 |
| 178 | 3300025944 | Ga0207661_10287051 | Ga0207661_102870512 | 133 |
| 179 | 3300025944 | Ga0207661_10288691 | Ga0207661_102886913 | 133 |
| 180 | 3300025944 | Ga0207661_11282421 | Ga0207661_112824212 | 133 |
| 181 | 3300025945 | Ga0207679_10363743 | Ga0207679_103637433 | 133 |
| 182 | 3300025945 | Ga0207679_10457720 | Ga0207679_104577202 | 133 |
| 183 | 3300025945 | Ga0207679_12176906 | Ga0207679_121769061 | 133 |
| 184 | 3300025949 | Ga0207667_10039807 | Ga0207667_100398075 | 133 |
| 185 | 3300026078 | Ga0207702_10020443 | Ga0207702_100204433 | 133 |
| 186 | 3300026118 | Ga0207675_100217558 | Ga0207675_1002175584 | 133 |
| 187 | 3300028379 | Ga0268266_10211401 | Ga0268266_102114012 | 133 |
| 188 | 3300028381 | Ga0268264_10841290 | Ga0268264_108412902 | 133 |
| 189 | 3300028666 | Ga0265336_10025059 | Ga0265336_100250593 | 133 |
| 190 | 3300028800 | Ga0265338_10047899 | Ga0265338_100478995 | 133 |
| 191 | 3300028800 | Ga0265338_10169526 | Ga0265338_101695263 | 133 |
| 192 | 3300031238 | Ga0265332_10071452 | Ga0265332_100714523 | 133 |
| 193 | 3300031238 | Ga0265332_10140063 | Ga0265332_101400633 | 133 |
| 194 | 3300031240 | Ga0265320_10025873 | Ga0265320_100258735 | 133 |
| 195 | 3300031241 | Ga0265325_10069848 | Ga0265325_100698484 | 133 |
| 196 | 3300031247 | Ga0265340_10001919 | Ga0265340_1000191912 | 133 |
| 197 | 3300031249 | Ga0265339_10005596 | Ga0265339_100055963 | 133 |
| 198 | 3300031251 | Ga0265327_10334412 | Ga0265327_103344122 | 133 |
| 199 | 3300031344 | Ga0265316_10187562 | Ga0265316_101875621 | 133 |
| 200 | 3300031711 | Ga0265314_10203779 | Ga0265314_102037793 | 133 |
| 201 | 3300031712 | Ga0265342_10002056 | Ga0265342_1000205612 | 133 |
| 202 | 3300031995 | Ga0307409_100436971 | Ga0307409_1004369712 | 133 |
| 203 | 3300035111 | Ga0373923_0515455 | Ga0373923_0515455_23_451 | 133 |
| 204 | 3300035117 | Ga0373953_0115664 | Ga0373953_0115664_363_791 | 133 |
| 205 | 3300035118 | Ga0373954_0030358 | Ga0373954_0030358_493_921 | 133 |
| 206 | 3300035170 | Ga0373943_0008200 | Ga0373943_0008200_102_530 | 133 |
| 207 | 3300035724 | Ga0373933_0005592 | Ga0373933_0005592_1622_2050 | 133 |
| 208 | 3300036401 | Ga0373937_0020221 | Ga0373937_0020221_3671_4099 | 133 |
| 209 | 3300036401 | Ga0373937_0584231 | Ga0373937_0584231_501_941 | 133 |
| 210 | 3300036401 | Ga0373937_0903175 | Ga0373937_0903175_309_755 | 133 |
| 211 | 3300037068 | Ga0373925_0240363 | Ga0373925_0240363_225_653 | 133 |
| 212 | 3300037853 | Ga0436364_1460136 | Ga0436364_1460136_66_518 | 133 |
| 213 | 3300038443 | Ga0395901_0783806 | Ga0395901_0783806_102_530 | 133 |
| 214 | 3300046454 | Ga0495592_0012697 | Ga0495592_0012697_606_1034 | 133 |
| 215 | 3300046454 | Ga0495592_0222510 | Ga0495592_0222510_300_731 | 133 |
| 216 | 3300046462 | Ga0495651_0019400 | Ga0495651_0019400_1218_1646 | 133 |
| 217 | 3300046463 | Ga0495653_0232733 | Ga0495653_0232733_161_589 | 133 |
| 218 | 3300046472 | Ga0495580_0116131 | Ga0495580_0116131_1356_1784 | 133 |
| 219 | 3300046476 | Ga0495662_0089186 | Ga0495662_0089186_1054_1482 | 133 |
| 220 | 3300046477 | Ga0495664_0009481 | Ga0495664_0009481_4614_5054 | 133 |
| 221 | 3300046514 | Ga0495618_0320603 | Ga0495618_0320603_302_733 | 133 |
| 222 | 3300046516 | Ga0495628_0031632 | Ga0495628_0031632_1217_1645 | 133 |
| 223 | 3300046517 | Ga0495630_0098503 | Ga0495630_0098503_715_1143 | 133 |
| 224 | 3300046528 | Ga0495642_0496577 | Ga0495642_0496577_43_471 | 133 |
| 225 | 3300046529 | Ga0495652_0005289 | Ga0495652_0005289_1787_2215 | 133 |
| 226 | 3300046531 | Ga0495665_0273764 | Ga0495665_0273764_361_789 | 133 |
| 227 | 3300046533 | Ga0495640_0058582 | Ga0495640_0058582_1491_1919 | 133 |
| 228 | 3300046533 | Ga0495640_0259525 | Ga0495640_0259525_320_763 | 133 |
| 229 | 3300046535 | Ga0495586_0228772 | Ga0495586_0228772_547_978 | 133 |
| 230 | 3300046536 | Ga0495587_0318792 | Ga0495587_0318792_92_520 | 133 |
| 231 | 3300046543 | Ga0495645_0004376 | Ga0495645_0004376_7471_7899 | 133 |
| 232 | 3300046543 | Ga0495645_0559087 | Ga0495645_0559087_98_538 | 133 |
| 233 | 3300046557 | Ga0495622_0131859 | Ga0495622_0131859_448_876 | 133 |
| 234 | 3300046559 | Ga0495667_0288240 | Ga0495667_0288240_22_462 | 133 |
| 235 | 3300046663 | Ga0495635_0125875 | Ga0495635_0125875_54_482 | 133 |
| 236 | 3300046663 | Ga0495635_0134835 | Ga0495635_0134835_436_885 | 133 |
| 237 | 3300046675 | Ga0495657_0298040 | Ga0495657_0298040_431_880 | 133 |
| 238 | 3300046679 | Ga0495623_0008411 | Ga0495623_0008411_5586_6035 | 133 |
| 239 | 3300046679 | Ga0495623_0023472 | Ga0495623_0023472_1677_2105 | 133 |
| 240 | 3300046680 | Ga0495646_0031461 | Ga0495646_0031461_978_1406 | 133 |
| 241 | 3300046681 | Ga0495647_0117742 | Ga0495647_0117742_63_491 | 133 |
| 242 | 3300046689 | Ga0495613_0315689 | Ga0495613_0315689_491_919 | 133 |
| 243 | 3300046809 | Ga0495600_0024267 | Ga0495600_0024267_1936_2364 | 133 |
| 244 | 3300047317 | Ga0495604_0054215 | Ga0495604_0054215_2278_2718 | 133 |
| 245 | 3300047317 | Ga0495604_0163604 | Ga0495604_0163604_14_442 | 133 |
| 246 | 3300047319 | Ga0495674_0060670 | Ga0495674_0060670_178_606 | 133 |
| 247 | 3300047319 | Ga0495674_0776331 | Ga0495674_0776331_195_635 | 133 |
| 248 | 3300047319 | Ga0495674_1006766 | Ga0495674_1006766_166_597 | 133 |
| 249 | 3300047322 | Ga0495680_0029148 | Ga0495680_0029148_2087_2515 | 133 |
| 250 | 3300047322 | Ga0495680_0221233 | Ga0495680_0221233_330_758 | 133 |
| 251 | 3300047322 | Ga0495680_0368071 | Ga0495680_0368071_89_517 | 133 |
| 252 | 3300047444 | Ga0495675_0092974 | Ga0495675_0092974_1052_1480 | 133 |
| 253 | 3300047471 | Ga0495684_0000965 | Ga0495684_0000965_8426_8875 | 133 |
| 254 | 3300047472 | Ga0495686_0477423 | Ga0495686_0477423_187_615 | 133 |
| 255 | 3300048088 | Ga0495602_0052199 | Ga0495602_0052199_733_1182 | 133 |
| 256 | 3300048088 | Ga0495602_0060547 | Ga0495602_0060547_1481_1909 | 133 |
| 257 | 3300048089 | Ga0495614_0397125 | Ga0495614_0397125_70_507 | 133 |
| 258 | 3300048903 | Ga0496100_0361963 | Ga0496100_0361963_43_474 | 133 |
| 259 | 3300048907 | Ga0496104_0004247 | Ga0496104_0004247_11048_11479 | 133 |
| 260 | 3300048908 | Ga0496105_0317164 | Ga0496105_0317164_59_490 | 133 |
| 261 | 3300048911 | Ga0496108_0607706 | Ga0496108_0607706_507_938 | 133 |
| 262 | 3300048911 | Ga0496108_1581274 | Ga0496108_1581274_62_490 | 133 |
| 263 | 3300048917 | Ga0496114_0002088 | Ga0496114_0002088_10597_11028 | 133 |
| 264 | 3300048918 | Ga0496115_0218513 | Ga0496115_0218513_837_1268 | 133 |
| 265 | 3300049568 | Ga0501031_0023510 | Ga0501031_0023510_3452_3880 | 133 |
| 266 | 3300049570 | Ga0501033_0033473 | Ga0501033_0033473_1935_2363 | 133 |
| 267 | 3300049571 | Ga0501034_0631203 | Ga0501034_0631203_277_705 | 133 |
| 268 | 3300049575 | Ga0501039_0009525 | Ga0501039_0009525_3224_3652 | 133 |
| 269 | 3300049580 | Ga0501046_0000258 | Ga0501046_0000258_53370_53798 | 133 |
| 270 | 3300049581 | Ga0501047_0000977 | Ga0501047_0000977_3280_3708 | 133 |
| 271 | 3300049585 | Ga0501069_0109389 | Ga0501069_0109389_780_1208 | 133 |
| 272 | 3300049589 | Ga0501073_0016701 | Ga0501073_0016701_3528_3956 | 133 |
| 273 | 3300049742 | Ga0501080_0014125 | Ga0501080_0014125_3381_3809 | 133 |
| 274 | 3300049822 | Ga0501035_0080665 | Ga0501035_0080665_93_521 | 133 |
| 275 | 3300049823 | Ga0501044_0020441 | Ga0501044_0020441_93_521 | 133 |
| 276 | 3300050507 | nmdc:mga05p37_19171_c1 | nmdc:mga05p37_19171_c1_7287_7715 | 133 |
| 277 | 3300050510 | nmdc:mga06r32_240521_c1 | nmdc:mga06r32_240521_c1_1204_1632 | 133 |
| 278 | 3300050514 | nmdc:mga08x19_1124062_c1 | nmdc:mga08x19_1124062_c1_95_529 | 133 |
| 279 | 3300050515 | nmdc:mga0a205_1046866_c1 | nmdc:mga0a205_1046866_c1_84_614 | 133 |
| 280 | 3300053077 | Ga0495601_0051819 | Ga0495601_0051819_1726_2154 | 133 |
| 281 | 3300053077 | Ga0495601_0074277 | Ga0495601_0074277_559_999 | 133 |
| 282 | 3300053077 | Ga0495601_0265388 | Ga0495601_0265388_371_802 | 133 |
| 283 | 3300053077 | Ga0495601_0382164 | Ga0495601_0382164_49_618 | 133 |
| 284 | 3300053084 | Ga0495595_0064272 | Ga0495595_0064272_826_1257 | 133 |
| 285 | 3300053084 | Ga0495595_0215182 | Ga0495595_0215182_239_667 | 133 |
| 286 | 3300053084 | Ga0495595_0521376 | Ga0495595_0521376_163_591 | 133 |
| 287 | 3300053085 | Ga0495619_0004782 | Ga0495619_0004782_4733_5173 | 133 |
| 288 | 3300053085 | Ga0495619_0006716 | Ga0495619_0006716_4863_5294 | 133 |
| 289 | 3300053085 | Ga0495619_0138076 | Ga0495619_0138076_149_577 | 133 |
| 290 | 3300044765 | Ga0466970_0332934 | Ga0466970_0332934_302_739 | 134 |
| 291 | 3300046473 | Ga0495582_0100246 | Ga0495582_0100246_1080_1508 | 134 |
| 292 | 3300046499 | Ga0495594_0043164 | Ga0495594_0043164_47_475 | 134 |
| 293 | 3300046517 | Ga0495630_0118473 | Ga0495630_0118473_1252_1680 | 134 |
| 294 | 3300046535 | Ga0495586_0062284 | Ga0495586_0062284_1444_1872 | 134 |
| 295 | 3300046642 | Ga0495634_0373011 | Ga0495634_0373011_252_680 | 134 |
| 296 | 3300046681 | Ga0495647_0048000 | Ga0495647_0048000_1015_1443 | 134 |
| 297 | 3300046683 | Ga0495658_0034712 | Ga0495658_0034712_1325_1753 | 134 |
| 298 | 3300047322 | Ga0495680_0042118 | Ga0495680_0042118_2482_2910 | 134 |
| 299 | 3300005328 | Ga0070676_10011237 | Ga0070676_100112376 | 135 |
| 300 | 3300005338 | Ga0068868_100048308 | Ga0068868_1000483082 | 135 |
| 301 | 3300005339 | Ga0070660_100037692 | Ga0070660_1000376924 | 135 |
| 302 | 3300005340 | Ga0070689_100000001 | Ga0070689_100000001566 | 135 |
| 303 | 3300005344 | Ga0070661_100161254 | Ga0070661_1001612543 | 135 |
| 304 | 3300005355 | Ga0070671_100314082 | Ga0070671_1003140822 | 135 |
| 305 | 3300005366 | Ga0070659_100327778 | Ga0070659_1003277782 | 135 |
| 306 | 3300005455 | Ga0070663_100705151 | Ga0070663_1007051511 | 135 |
| 307 | 3300005458 | Ga0070681_10682973 | Ga0070681_106829732 | 135 |
| 308 | 3300005535 | Ga0070684_100645644 | Ga0070684_1006456442 | 135 |
| 309 | 3300005563 | Ga0068855_100393353 | Ga0068855_1003933532 | 135 |
| 310 | 3300005578 | Ga0068854_100075900 | Ga0068854_1000759001 | 135 |
| 311 | 3300005578 | Ga0068854_100228764 | Ga0068854_1002287642 | 135 |
| 312 | 3300005616 | Ga0068852_101061197 | Ga0068852_1010611971 | 135 |
| 313 | 3300005616 | Ga0068852_102188430 | Ga0068852_1021884301 | 135 |
| 314 | 3300005985 | Ga0081539_10002066 | Ga0081539_1000206623 | 135 |
| 315 | 3300009093 | Ga0105240_10059121 | Ga0105240_100591216 | 135 |
| 316 | 3300009147 | Ga0114129_10751851 | Ga0114129_107518513 | 135 |
| 317 | 3300009177 | Ga0105248_10219748 | Ga0105248_102197482 | 135 |
| 318 | 3300013100 | Ga0157373_10526973 | Ga0157373_105269732 | 135 |
| 319 | 3300013102 | Ga0157371_10255416 | Ga0157371_102554163 | 135 |
| 320 | 3300013104 | Ga0157370_10172784 | Ga0157370_101727842 | 135 |
| 321 | 3300013105 | Ga0157369_10294707 | Ga0157369_102947072 | 135 |
| 322 | 3300013307 | Ga0157372_10200042 | Ga0157372_102000423 | 135 |
| 323 | 3300013307 | Ga0157372_10350903 | Ga0157372_103509032 | 135 |
| 324 | 3300015265 | Ga0182005_1042836 | Ga0182005_10428363 | 135 |
| 325 | 3300025907 | Ga0207645_10016805 | Ga0207645_100168054 | 135 |
| 326 | 3300025909 | Ga0207705_10341692 | Ga0207705_103416922 | 135 |
| 327 | 3300025919 | Ga0207657_10046799 | Ga0207657_100467994 | 135 |
| 328 | 3300025921 | Ga0207652_10587638 | Ga0207652_105876382 | 135 |
| 329 | 3300025922 | Ga0207646_10521504 | Ga0207646_105215041 | 135 |
| 330 | 3300025931 | Ga0207644_10134521 | Ga0207644_101345212 | 135 |
| 331 | 3300025931 | Ga0207644_10227184 | Ga0207644_102271842 | 135 |
| 332 | 3300025936 | Ga0207670_10000002 | Ga0207670_10000002461 | 135 |
| 333 | 3300025940 | Ga0207691_10754003 | Ga0207691_107540031 | 135 |
| 334 | 3300025944 | Ga0207661_11015252 | Ga0207661_110152522 | 135 |
| 335 | 3300025945 | Ga0207679_11993590 | Ga0207679_119935901 | 135 |
| 336 | 3300025949 | Ga0207667_10049769 | Ga0207667_100497696 | 135 |
| 337 | 3300025960 | Ga0207651_10654016 | Ga0207651_106540162 | 135 |
| 338 | 3300026023 | Ga0207677_10145591 | Ga0207677_101455912 | 135 |
| 339 | 3300026041 | Ga0207639_10483036 | Ga0207639_104830362 | 135 |
| 340 | 3300026089 | Ga0207648_10374689 | Ga0207648_103746893 | 135 |
| 341 | 3300034816 | Ga0373930_0000190 | Ga0373930_0000190_687_1106 | 135 |
| 342 | 3300034819 | Ga0373958_0001725 | Ga0373958_0001725_1357_1776 | 135 |
| 343 | 3300034820 | Ga0373959_0002213 | Ga0373959_0002213_374_793 | 135 |
| 344 | 3300035084 | Ga0373928_0016570 | Ga0373928_0016570_999_1418 | 135 |
| 345 | 3300035085 | Ga0373929_0002028 | Ga0373929_0002028_2384_2803 | 135 |
| 346 | 3300035088 | Ga0373940_0002904 | Ga0373940_0002904_1619_2038 | 135 |
| 347 | 3300035090 | Ga0373949_0003873 | Ga0373949_0003873_774_1193 | 135 |
| 348 | 3300035091 | Ga0373951_0000928 | Ga0373951_0000928_1940_2359 | 135 |
| 349 | 3300035092 | Ga0373952_0000354 | Ga0373952_0000354_5966_6385 | 135 |
| 350 | 3300035112 | Ga0373932_0000157 | Ga0373932_0000157_8859_9278 | 135 |
| 351 | 3300035114 | Ga0373939_0000138 | Ga0373939_0000138_19770_20189 | 135 |
| 352 | 3300035115 | Ga0373941_0006216 | Ga0373941_0006216_1312_1731 | 135 |
| 353 | 3300035121 | Ga0373960_0001327 | Ga0373960_0001327_3807_4226 | 135 |
| 354 | 3300035207 | Ga0373942_0001220 | Ga0373942_0001220_3855_4274 | 135 |
| 355 | 3300035241 | Ga0373961_0031744 | Ga0373961_0031744_745_1164 | 135 |
| 356 | 3300035242 | Ga0373962_0000383 | Ga0373962_0000383_9032_9451 | 135 |
| 357 | 3300035691 | Ga0373931_0003364 | Ga0373931_0003364_800_1219 | 135 |
| 358 | 3300037312 | Ga0395899_0000019 | Ga0395899_0000019_374245_374652 | 135 |
| 359 | 3300044684 | Ga0466966_0031693 | Ga0466966_0031693_345_767 | 135 |
| 360 | 3300045049 | Ga0466959_0005273 | Ga0466959_0005273_1833_2255 | 135 |
| 361 | 3300045051 | Ga0451576_0009094 | Ga0451576_0009094_1010_1429 | 135 |
| 362 | 3300046454 | Ga0495592_0010328 | Ga0495592_0010328_3223_3639 | 135 |
| 363 | 3300046463 | Ga0495653_0023865 | Ga0495653_0023865_1623_2042 | 135 |
| 364 | 3300046511 | Ga0495608_0336005 | Ga0495608_0336005_312_731 | 135 |
| 365 | 3300046516 | Ga0495628_0031961 | Ga0495628_0031961_3348_3764 | 135 |
| 366 | 3300046517 | Ga0495630_0433423 | Ga0495630_0433423_389_808 | 135 |
| 367 | 3300046529 | Ga0495652_0013888 | Ga0495652_0013888_4603_5019 | 135 |
| 368 | 3300046543 | Ga0495645_0012448 | Ga0495645_0012448_2085_2501 | 135 |
| 369 | 3300046559 | Ga0495667_0072161 | Ga0495667_0072161_636_1055 | 135 |
| 370 | 3300046678 | Ga0495599_0009115 | Ga0495599_0009115_1731_2147 | 135 |
| 371 | 3300046689 | Ga0495613_0392185 | Ga0495613_0392185_358_777 | 135 |
| 372 | 3300046809 | Ga0495600_0286281 | Ga0495600_0286281_585_1004 | 135 |
| 373 | 3300047322 | Ga0495680_0216762 | Ga0495680_0216762_121_540 | 135 |
| 374 | 3300047673 | Ga0495593_0443683 | Ga0495593_0443683_191_598 | 135 |
| 375 | 3300048905 | Ga0496102_1783886 | Ga0496102_1783886_89_508 | 135 |
| 376 | 3300048925 | Ga0496122_0044838 | Ga0496122_0044838_1823_2251 | 135 |
| 377 | 3300048926 | Ga0496123_0025405 | Ga0496123_0025405_3901_4329 | 135 |
| 378 | 3300048928 | Ga0496125_0061258 | Ga0496125_0061258_776_1204 | 135 |
| 379 | 3300049459 | Ga0495678_187849 | Ga0495678_187849_132_560 | 135 |
| 380 | 3300050507 | nmdc:mga05p37_118491_c1 | nmdc:mga05p37_118491_c1_584_991 | 135 |
| 381 | 3300050514 | nmdc:mga08x19_490821_c1 | nmdc:mga08x19_490821_c1_295_714 | 135 |
| 382 | 3300053085 | Ga0495619_0006938 | Ga0495619_0006938_476_895 | 135 |
| 383 | 3300053092 | Ga0500583_0433699 | Ga0500583_0433699_69_509 | 135 |
| 384 | 3300059645 | Ga0587076_018069 | Ga0587076_018069_96_578 | 135 |
| 385 | 3300059647 | Ga0587079_159391 | Ga0587079_159391_65_547 | 135 |
| 386 | 3300005293 | Ga0065715_10291854 | Ga0065715_102918542 | 136 |
| 387 | 3300061734 | Ga0530510_0395037 | Ga0530510_0395037_53_466 | 137 |
| 388 | 3300005331 | Ga0070670_100272122 | Ga0070670_1002721223 | 138 |
| 389 | 3300005338 | Ga0068868_100552163 | Ga0068868_1005521632 | 138 |
| 390 | 3300005437 | Ga0070710_10385507 | Ga0070710_103855072 | 138 |
| 391 | 3300005535 | Ga0070684_100587576 | Ga0070684_1005875762 | 138 |
| 392 | 3300005548 | Ga0070665_100226350 | Ga0070665_1002263501 | 138 |
| 393 | 3300005577 | Ga0068857_100093482 | Ga0068857_1000934824 | 138 |
| 394 | 3300005843 | Ga0068860_101341727 | Ga0068860_1013417272 | 138 |
| 395 | 3300006237 | Ga0097621_100004225 | Ga0097621_1000042256 | 138 |
| 396 | 3300006358 | Ga0068871_100079058 | Ga0068871_1000790582 | 138 |
| 397 | 3300009174 | Ga0105241_10004901 | Ga0105241_100049017 | 138 |
| 398 | 3300009177 | Ga0105248_10994150 | Ga0105248_109941501 | 138 |
| 399 | 3300009545 | Ga0105237_10265903 | Ga0105237_102659032 | 138 |
| 400 | 3300009551 | Ga0105238_10023968 | Ga0105238_100239682 | 138 |
| 401 | 3300010375 | Ga0105239_10830208 | Ga0105239_108302081 | 138 |
| 402 | 3300011119 | Ga0105246_10157177 | Ga0105246_101571772 | 138 |
| 403 | 3300013296 | Ga0157374_10070419 | Ga0157374_100704192 | 138 |
| 404 | 3300013297 | Ga0157378_10017861 | Ga0157378_100178616 | 138 |
| 405 | 3300014968 | Ga0157379_10118300 | Ga0157379_101183003 | 138 |
| 406 | 3300025911 | Ga0207654_10014094 | Ga0207654_100140943 | 138 |
| 407 | 3300025914 | Ga0207671_10949359 | Ga0207671_109493591 | 138 |
| 408 | 3300025924 | Ga0207694_10014336 | Ga0207694_100143362 | 138 |
| 409 | 3300025925 | Ga0207650_10228810 | Ga0207650_102288104 | 138 |
| 410 | 3300025945 | Ga0207679_10030460 | Ga0207679_100304605 | 138 |
| 411 | 3300026078 | Ga0207702_10041493 | Ga0207702_100414934 | 138 |
| 412 | 3300026116 | Ga0207674_10016506 | Ga0207674_100165068 | 138 |
| 413 | 3300028379 | Ga0268266_10004587 | Ga0268266_100045874 | 138 |
| 414 | 3300028381 | Ga0268264_10918900 | Ga0268264_109189001 | 138 |
| 415 | 3300035692 | Ga0373935_0374018 | Ga0373935_0374018_116_601 | 138 |
| 416 | 3300036401 | Ga0373937_0666696 | Ga0373937_0666696_409_894 | 138 |
| 417 | 3300046476 | Ga0495662_0234314 | Ga0495662_0234314_11_496 | 138 |
| 418 | 3300046809 | Ga0495600_0519598 | Ga0495600_0519598_18_503 | 138 |
| 419 | 3300048903 | Ga0496100_0056589 | Ga0496100_0056589_34_519 | 138 |
| 420 | 3300048904 | Ga0496101_0017382 | Ga0496101_0017382_2279_2764 | 138 |
| 421 | 3300048905 | Ga0496102_0041163 | Ga0496102_0041163_1367_1852 | 138 |
| 422 | 3300048907 | Ga0496104_0036250 | Ga0496104_0036250_3080_3565 | 138 |
| 423 | 3300048910 | Ga0496107_0021957 | Ga0496107_0021957_2037_2522 | 138 |
| 424 | 3300048912 | Ga0496109_0290550 | Ga0496109_0290550_656_1141 | 138 |
| 425 | 3300048917 | Ga0496114_0022030 | Ga0496114_0022030_4627_5112 | 138 |
| 426 | 3300048918 | Ga0496115_0047999 | Ga0496115_0047999_2294_2779 | 138 |
| 427 | 3300005937 | Ga0081455_10001198 | Ga0081455_1000119828 | 139 |
| 428 | 3300001989 | JGI24739J22299_10194032 | JGI24739J22299_101940321 | 140 |
| 429 | 3300001991 | JGI24743J22301_10008365 | JGI24743J22301_100083652 | 140 |
| 430 | 3300005290 | Ga0065712_10076784 | Ga0065712_100767842 | 140 |
| 431 | 3300005293 | Ga0065715_10107365 | Ga0065715_101073655 | 140 |
| 432 | 3300005293 | Ga0065715_10268803 | Ga0065715_102688032 | 140 |
| 433 | 3300005295 | Ga0065707_10027610 | Ga0065707_100276102 | 140 |
| 434 | 3300005329 | Ga0070683_100128551 | Ga0070683_1001285512 | 140 |
| 435 | 3300005331 | Ga0070670_100243971 | Ga0070670_1002439712 | 140 |
| 436 | 3300005338 | Ga0068868_100131338 | Ga0068868_1001313382 | 140 |
| 437 | 3300005354 | Ga0070675_100042568 | Ga0070675_1000425682 | 140 |
| 438 | 3300005364 | Ga0070673_101523971 | Ga0070673_1015239711 | 140 |
| 439 | 3300005365 | Ga0070688_100067590 | Ga0070688_1000675903 | 140 |
| 440 | 3300005440 | Ga0070705_100000257 | Ga0070705_10000025734 | 140 |
| 441 | 3300005455 | Ga0070663_100173922 | Ga0070663_1001739221 | 140 |
| 442 | 3300005456 | Ga0070678_100065502 | Ga0070678_1000655025 | 140 |
| 443 | 3300005456 | Ga0070678_100834834 | Ga0070678_1008348341 | 140 |
| 444 | 3300005467 | Ga0070706_100182330 | Ga0070706_1001823301 | 140 |
| 445 | 3300005468 | Ga0070707_100164279 | Ga0070707_1001642794 | 140 |
| 446 | 3300005468 | Ga0070707_100557892 | Ga0070707_1005578922 | 140 |
| 447 | 3300005471 | Ga0070698_100003314 | Ga0070698_1000033143 | 140 |
| 448 | 3300005471 | Ga0070698_100696887 | Ga0070698_1006968872 | 140 |
| 449 | 3300005518 | Ga0070699_100086457 | Ga0070699_1000864575 | 140 |
| 450 | 3300005518 | Ga0070699_100329802 | Ga0070699_1003298022 | 140 |
| 451 | 3300005539 | Ga0068853_100057925 | Ga0068853_1000579253 | 140 |
| 452 | 3300005544 | Ga0070686_100743803 | Ga0070686_1007438032 | 140 |
| 453 | 3300005545 | Ga0070695_100185335 | Ga0070695_1001853352 | 140 |
| 454 | 3300005546 | Ga0070696_100092279 | Ga0070696_1000922794 | 140 |
| 455 | 3300005546 | Ga0070696_100560238 | Ga0070696_1005602382 | 140 |
| 456 | 3300005548 | Ga0070665_100557095 | Ga0070665_1005570952 | 140 |
| 457 | 3300005564 | Ga0070664_100035559 | Ga0070664_1000355592 | 140 |
| 458 | 3300005615 | Ga0070702_100522686 | Ga0070702_1005226861 | 140 |
| 459 | 3300005842 | Ga0068858_100010011 | Ga0068858_10001001110 | 140 |
| 460 | 3300005843 | Ga0068860_101369707 | Ga0068860_1013697071 | 140 |
| 461 | 3300006358 | Ga0068871_100304635 | Ga0068871_1003046352 | 140 |
| 462 | 3300006844 | Ga0075428_100179306 | Ga0075428_1001793064 | 140 |
| 463 | 3300006871 | Ga0075434_101321057 | Ga0075434_1013210571 | 140 |
| 464 | 3300006881 | Ga0068865_100172987 | Ga0068865_1001729873 | 140 |
| 465 | 3300009094 | Ga0111539_10244451 | Ga0111539_102444515 | 140 |
| 466 | 3300009098 | Ga0105245_11402222 | Ga0105245_114022221 | 140 |
| 467 | 3300009101 | Ga0105247_10093456 | Ga0105247_100934564 | 140 |
| 468 | 3300009147 | Ga0114129_10014611 | Ga0114129_100146115 | 140 |
| 469 | 3300009147 | Ga0114129_10747813 | Ga0114129_107478132 | 140 |
| 470 | 3300009147 | Ga0114129_11314397 | Ga0114129_113143971 | 140 |
| 471 | 3300009148 | Ga0105243_10863941 | Ga0105243_108639413 | 140 |
| 472 | 3300009176 | Ga0105242_10095366 | Ga0105242_100953665 | 140 |
| 473 | 3300009176 | Ga0105242_12595662 | Ga0105242_125956621 | 140 |
| 474 | 3300011119 | Ga0105246_10164490 | Ga0105246_101644904 | 140 |
| 475 | 3300013308 | Ga0157375_10271346 | Ga0157375_102713463 | 140 |
| 476 | 3300014325 | Ga0163163_10361854 | Ga0163163_103618543 | 140 |
| 477 | 3300014969 | Ga0157376_10063664 | Ga0157376_100636645 | 140 |
| 478 | 3300025271 | Ga0207666_1010380 | Ga0207666_10103802 | 140 |
| 479 | 3300025315 | Ga0207697_10000173 | Ga0207697_100001735 | 140 |
| 480 | 3300025315 | Ga0207697_10195467 | Ga0207697_101954671 | 140 |
| 481 | 3300025901 | Ga0207688_10007915 | Ga0207688_100079155 | 140 |
| 482 | 3300025922 | Ga0207646_10153518 | Ga0207646_101535182 | 140 |
| 483 | 3300025922 | Ga0207646_10207476 | Ga0207646_102074763 | 140 |
| 484 | 3300025925 | Ga0207650_10098636 | Ga0207650_100986365 | 140 |
| 485 | 3300025926 | Ga0207659_10026197 | Ga0207659_100261974 | 140 |
| 486 | 3300025932 | Ga0207690_10103710 | Ga0207690_101037102 | 140 |
| 487 | 3300025937 | Ga0207669_10042111 | Ga0207669_100421112 | 140 |
| 488 | 3300025938 | Ga0207704_10174511 | Ga0207704_101745112 | 140 |
| 489 | 3300025944 | Ga0207661_10078568 | Ga0207661_100785682 | 140 |
| 490 | 3300025945 | Ga0207679_10034339 | Ga0207679_100343394 | 140 |
| 491 | 3300025960 | Ga0207651_12005726 | Ga0207651_120057261 | 140 |
| 492 | 3300025981 | Ga0207640_11739770 | Ga0207640_117397702 | 140 |
| 493 | 3300026023 | Ga0207677_10008313 | Ga0207677_100083133 | 140 |
| 494 | 3300026035 | Ga0207703_10037266 | Ga0207703_100372665 | 140 |
| 495 | 3300026035 | Ga0207703_10998975 | Ga0207703_109989752 | 140 |
| 496 | 3300026041 | Ga0207639_10036972 | Ga0207639_100369724 | 140 |
| 497 | 3300026067 | Ga0207678_10189061 | Ga0207678_101890612 | 140 |
| 498 | 3300026121 | Ga0207683_10086652 | Ga0207683_100866525 | 140 |
| 499 | 3300027907 | Ga0207428_10602153 | Ga0207428_106021532 | 140 |
| 500 | 3300028379 | Ga0268266_10458147 | Ga0268266_104581472 | 140 |
| 501 | 3300031731 | Ga0307405_10264235 | Ga0307405_102642352 | 140 |
| 502 | 3300031824 | Ga0307413_10292404 | Ga0307413_102924041 | 140 |
| 503 | 3300031901 | Ga0307406_10335624 | Ga0307406_103356242 | 140 |
| 504 | 3300031903 | Ga0307407_10117357 | Ga0307407_101173572 | 140 |
| 505 | 3300031995 | Ga0307409_100350603 | Ga0307409_1003506031 | 140 |
| 506 | 3300032002 | Ga0307416_100138336 | Ga0307416_1001383363 | 140 |
| 507 | 3300035724 | Ga0373933_0106380 | Ga0373933_0106380_1049_1504 | 140 |
| 508 | 3300036401 | Ga0373937_0488243 | Ga0373937_0488243_269_697 | 140 |
| 509 | 3300036401 | Ga0373937_0983606 | Ga0373937_0983606_39_494 | 140 |
| 510 | 3300037068 | Ga0373925_1768906 | Ga0373925_1768906_12_434 | 140 |
| 511 | 3300042532 | Ga0450893_0123964 | Ga0450893_0123964_89_511 | 140 |
| 512 | 3300045051 | Ga0451576_0062809 | Ga0451576_0062809_569_1003 | 140 |
| 513 | 3300046459 | Ga0495629_0625001 | Ga0495629_0625001_68_493 | 140 |
| 514 | 3300046462 | Ga0495651_0305973 | Ga0495651_0305973_192_617 | 140 |
| 515 | 3300046511 | Ga0495608_0100893 | Ga0495608_0100893_1276_1704 | 140 |
| 516 | 3300046516 | Ga0495628_0383723 | Ga0495628_0383723_531_959 | 140 |
| 517 | 3300046517 | Ga0495630_0001715 | Ga0495630_0001715_11341_11769 | 140 |
| 518 | 3300046528 | Ga0495642_0037283 | Ga0495642_0037283_210_650 | 140 |
| 519 | 3300046531 | Ga0495665_0131718 | Ga0495665_0131718_733_1164 | 140 |
| 520 | 3300046535 | Ga0495586_0050873 | Ga0495586_0050873_499_933 | 140 |
| 521 | 3300046543 | Ga0495645_0045675 | Ga0495645_0045675_534_962 | 140 |
| 522 | 3300046642 | Ga0495634_0079517 | Ga0495634_0079517_543_971 | 140 |
| 523 | 3300046642 | Ga0495634_0623057 | Ga0495634_0623057_19_453 | 140 |
| 524 | 3300046664 | Ga0495659_0005932 | Ga0495659_0005932_2685_3107 | 140 |
| 525 | 3300046683 | Ga0495658_0007509 | Ga0495658_0007509_4088_4516 | 140 |
| 526 | 3300046684 | Ga0495669_0040346 | Ga0495669_0040346_1502_1924 | 140 |
| 527 | 3300046689 | Ga0495613_0000501 | Ga0495613_0000501_14482_14910 | 140 |
| 528 | 3300047319 | Ga0495674_0026206 | Ga0495674_0026206_1354_1782 | 140 |
| 529 | 3300047321 | Ga0495676_0408297 | Ga0495676_0408297_334_768 | 140 |
| 530 | 3300047447 | Ga0495685_144491 | Ga0495685_144491_135_575 | 140 |
| 531 | 3300047471 | Ga0495684_0000985 | Ga0495684_0000985_11087_11515 | 140 |
| 532 | 3300048910 | Ga0496107_0523554 | Ga0496107_0523554_93_515 | 140 |
| 533 | 3300048912 | Ga0496109_0105997 | Ga0496109_0105997_473_895 | 140 |
| 534 | 3300048913 | Ga0496110_0142980 | Ga0496110_0142980_1229_1651 | 140 |
| 535 | 3300048916 | Ga0496113_0835433 | Ga0496113_0835433_61_495 | 140 |
| 536 | 3300049580 | Ga0501046_0396966 | Ga0501046_0396966_492_923 | 140 |
| 537 | 3300049589 | Ga0501073_1081196 | Ga0501073_1081196_93_524 | 140 |
| 538 | 3300049590 | Ga0501074_0874693 | Ga0501074_0874693_156_587 | 140 |
| 539 | 3300049591 | Ga0501075_0293412 | Ga0501075_0293412_486_917 | 140 |
| 540 | 3300049592 | Ga0501076_0912039 | Ga0501076_0912039_78_509 | 140 |
| 541 | 3300049824 | Ga0501045_0538802 | Ga0501045_0538802_395_826 | 140 |
| 542 | 3300050507 | nmdc:mga05p37_110882_c2 | nmdc:mga05p37_110882_c2_150_572 | 140 |
| 543 | 3300050507 | nmdc:mga05p37_1163168_c1 | nmdc:mga05p37_1163168_c1_225_647 | 140 |
| 544 | 3300050507 | nmdc:mga05p37_366953_c1 | nmdc:mga05p37_366953_c1_1224_1673 | 140 |
| 545 | 3300050511 | nmdc:mga08y16_102464_c1 | nmdc:mga08y16_102464_c1_2226_2654 | 140 |
| 546 | 3300050511 | nmdc:mga08y16_433823_c1 | nmdc:mga08y16_433823_c1_222_656 | 140 |
| 547 | 3300050513 | nmdc:mga0rr50_46356_c1 | nmdc:mga0rr50_46356_c1_2120_2542 | 140 |
| 548 | 3300050515 | nmdc:mga0a205_595710_c1 | nmdc:mga0a205_595710_c1_147_569 | 140 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2oc6-assembly2.cif.gz_B | crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution | 0.7506 | 14 | 132 |
| 2oc6-assembly2.cif.gz_B | crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution | 0.6925 | 14 | 132 |
| 3nk4-assembly1.cif.gz_A | crystal structure of full-length sperm receptor zp3 at 2.0 a resolution | 0.6021 | 68 | 113 |
| 3fdd-assembly1.cif.gz_A | the crystal structure of the pseudomonas dacunhae aspartate-beta-decarboxylase reveals a novel oligomeric assembly for a pyridoxal-5-phosphate dependent enzyme | 0.5756 | 83 | 140 |
| 6xi8-assembly1.cif.gz_A | yeast tfiik (kin28/ccl1/tfb3) complex | 0.5413 | 63 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVG5_6_119_3.90.1150.200 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.7405 | 14 | 132 | 3.90.1150.200 |
| af_Q2FVG5_6_119_3.90.1150.200 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.7193 | 14 | 132 | 3.90.1150.200 |
| 2oc6B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.7049 | 14 | 135 | 3.90.1150.200 |
| 2oc6B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.6893 | 14 | 135 | 3.90.1150.200 |
| af_P0AF50_1_117_3.90.1150.30 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.6329 | 32 | 133 | 3.90.1150.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7X7N0-F1-model_v4 | YdhG-like domain-containing protein | 0.9942 | 12 | 85 |
|
| AF-A0A349L252-F1-model_v4 | YdhG-like domain-containing protein | 0.9902 | 12 | 138 |
|
| AF-A0A7V9TMV2-F1-model_v4 | DUF1801 domain-containing protein | 0.99 | 7 | 139 |
|
| AF-A0A1Q3J442-F1-model_v4 | deleted | 0.9896 | 11 | 138 |
|
| AF-A0A427CGT7-F1-model_v4 | DUF1801 domain-containing protein | 0.988 | 15 | 132 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar