F462240

General Info

Members Datasets Scaffolds Average Seq Length
548 278 518 496

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1008439|Ga0265319_10084393
Length 553
Sequence MYSPSLDEFLKLAAQGNLIPVTRRILADLETPLSAYRKISGQGESFLFESVEGGEHIGRYSFVGCNPRAVIKQTGSCIEVIENGKVMETFAVGSTGVPPVVSGVAPETVGNRTDALQSSIKQQSTSPDEIRRDAEFGQAGRLCSQQVRDGLEVVERVMKKYRAVSVPGLPRFTGGAIGFIGYEFIHDVEPVVPRPPHDELKTPVMYFLVADQLLVFDRVAQTITILVNAILDDAESPNDAYENATSEIERIISLLEQPSNHKSVGVQPEVMPPVPFESNQTKEKFSANVEAAKKYITAGDIIQVVGSQRFSAPVTASPLDIYRAARNINPSPYMFLLELDGFSLVGASPEIHVRCEDGKVEIRPIAGTRRRGKTEAEDSALEKELLADPKERAEHVMLVDLARNDIGRVCDFGSVQVKDLMFIERYSHVMHIVSQVEGKLSAGKTPYDLMRATFPAGTVSGAPKIRAMQIIAELEQTSRGPYAGCVGYFSFNGNLDTCITIRTALIKDGKAYVQAGGGWVNDSTPEGEFQETVNKSMAMRKAVAMAENFNGQK

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
5 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
6 2643221573 Lysobacter sp. Root604 Isolate Unclassified
7 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
8 2643221695 Lysobacter sp. Root494 Isolate Unclassified
9 2643221720 Lysobacter sp. Root916 Isolate Unclassified
10 2643221728 Lysobacter sp. Root983 Isolate Unclassified
11 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
12 2718217752 Candidatus Xiphinematobacter sp. Idaho Grape Isolate Unclassified
13 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
14 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
15 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
16 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
17 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
18 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
19 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
20 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
21 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
22 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
23 2919513703 Luteimonas sp. 3794 Isolate Unclassified
24 2919675420 Luteimonas terrae 4099 Isolate Unclassified
25 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
26 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
27 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
28 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
40 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
138 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
139 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
143 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
148 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
149 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
162 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
166 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
167 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
177 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
178 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
194 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
249 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
274 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
277 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
278 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 0.73
Isolates 5.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 7.12
Nodule 0
Rhizoplane 0.91
Rhizosphere 85.95
Stem 0
Stem Tuber 0
Unclassified 5.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000646 3300003187 Bacteria 29736
2 rootH2_10024038 3300003320 Bacteria 6825
3 Ga0055526_1000005 3300003771 Bacteria 344542
4 Ga0055526_1017344 3300003771 Bacteria 2754
5 Ga0055537_1000026 3300003773 Bacteria 105126
6 Ga0055537_1000048 3300003773 Bacteria 87588
7 Ga0055524_1000005 3300003775 Bacteria 344542
8 Ga0055536_1003420 3300003781 Bacteria 8531
9 Ga0055534_1000002 3300003784 Bacteria 390762
10 Ga0055528_1000002 3300003790 Bacteria 368879
11 Ga0055530_10001342 3300003791 Bacteria 18385
12 Ga0055531_10001941 3300003794 Bacteria 14444
13 Ga0055531_10011887 3300003794 Bacteria 4147
14 Ga0055531_10016904 3300003794 Bacteria 3115
15 Ga0058692_1000067 3300003856 Bacteria 88996
16 Ga0065703_1019703 3300005272 Bacteria 2524
17 Ga0070658_10023675 3300005327 Bacteria 4925
18 Ga0070683_100004788 3300005329 Bacteria 11201
19 Ga0068869_100006632 3300005334 Bacteria 7348
20 Ga0068869_100112942 3300005334 Bacteria 2069
21 Ga0070666_10058798 3300005335 Bacteria 2600
22 Ga0068868_100032686 3300005338 Bacteria 4005
23 Ga0070660_100002867 3300005339 Bacteria 11876
24 Ga0070689_100037556 3300005340 Bacteria 3703
25 Ga0070689_100067084 3300005340 Bacteria 2796
26 Ga0070689_100116300 3300005340 Bacteria 2132
27 Ga0070669_100001717 3300005353 Bacteria 15865
28 Ga0070669_100158349 3300005353 Bacteria 1758
29 Ga0070671_100003171 3300005355 Bacteria 12818
30 Ga0070673_100038189 3300005364 Bacteria 3665
31 Ga0070688_100032851 3300005365 Bacteria 3133
32 Ga0070688_100039213 3300005365 Bacteria 2898
33 Ga0070659_100000441 3300005366 Bacteria 31078
34 Ga0070667_100086867 3300005367 Bacteria 2684
35 Ga0070711_100007295 3300005439 Bacteria 6723
36 Ga0070711_100007799 3300005439 Bacteria 6522
37 Ga0070708_100245187 3300005445 Bacteria 1682
38 Ga0070663_100095531 3300005455 Bacteria 2209
39 Ga0070681_10058928 3300005458 Bacteria 3819
40 Ga0070698_100199954 3300005471 Bacteria 1934
41 Ga0070679_100027326 3300005530 Bacteria 5615
42 Ga0068853_100000021 3300005539 Bacteria 149283
43 Ga0070686_100008352 3300005544 Bacteria 5799
44 Ga0070686_100015502 3300005544 Bacteria 4417
45 Ga0070686_100100031 3300005544 Bacteria 1957
46 Ga0070665_100016974 3300005548 Bacteria 7298
47 Ga0070665_100115862 3300005548 Bacteria 2682
48 Ga0070704_100068260 3300005549 Bacteria 2571
49 Ga0068855_100030799 3300005563 Bacteria 6414
50 Ga0068855_100049074 3300005563 Bacteria 4979
51 Ga0068855_100138156 3300005563 Bacteria 2779
52 Ga0068855_100248754 3300005563 Bacteria 1983
53 Ga0068857_100018849 3300005577 Bacteria 6056
54 Ga0068854_100000075 3300005578 Bacteria 71042
55 Ga0068856_100000556 3300005614 Bacteria 41006
56 Ga0068856_100001065 3300005614 Bacteria 29026
57 Ga0068856_100160094 3300005614 Bacteria 2261
58 Ga0068859_100010813 3300005617 Bacteria 9186
59 Ga0068859_100135658 3300005617 Bacteria 2534
60 Ga0068860_100000624 3300005843 Bacteria 41843
61 Ga0070717_10000219 3300006028 Bacteria 39528
62 Ga0070717_10000840 3300006028 Bacteria 20326
63 Ga0097621_100054572 3300006237 Bacteria 3260
64 Ga0075431_100009275 3300006847 Bacteria 9875
65 Ga0068865_100005541 3300006881 Bacteria 7660
66 Ga0097620_100010813 3300006931 Bacteria 9186
67 Ga0097620_100135656 3300006931 Bacteria 2534
68 Ga0075435_100034508 3300007076 Bacteria 4009
69 Ga0105251_10061649 3300009011 Bacteria 1763
70 Ga0105244_10070768 3300009036 Bacteria 1740
71 Ga0105244_10079108 3300009036 Bacteria 1630
72 Ga0105244_10081471 3300009036 Bacteria 1601
73 Ga0105240_10004363 3300009093 Bacteria 21597
74 Ga0105240_10005743 3300009093 Bacteria 18404
75 Ga0105240_10012193 3300009093 Bacteria 11891
76 Ga0105240_10031649 3300009093 Bacteria 6855
77 Ga0105240_10112066 3300009093 Bacteria 3299
78 Ga0111539_10037268 3300009094 Bacteria 5874
79 Ga0105247_10003033 3300009101 Bacteria 11127
80 Ga0105243_10000691 3300009148 Bacteria 32826
81 Ga0105243_10001258 3300009148 Bacteria 22754
82 Ga0105248_10008706 3300009177 Bacteria 11148
83 Ga0105248_10125505 3300009177 Bacteria 2896
84 Ga0105238_10103461 3300009551 Bacteria 2829
85 Ga0105249_10008437 3300009553 Bacteria 8975
86 Ga0157371_10035675 3300013102 Bacteria 3564
87 Ga0157370_10121522 3300013104 Bacteria 2438
88 Ga0157370_10276499 3300013104 Bacteria 1552
89 Ga0157374_10009669 3300013296 Bacteria 8281
90 Ga0163162_10000056 3300013306 Bacteria 109321
91 Ga0157372_10042442 3300013307 Bacteria 5031
92 Ga0157375_10000040 3300013308 Bacteria 164344
93 Ga0157375_10001924 3300013308 Bacteria 17865
94 Ga0163163_10000014 3300014325 Bacteria 231615
95 Ga0157376_10018125 3300014969 Bacteria 5388
96 Ga0157376_10025775 3300014969 Bacteria 4635
97 Ga0183360_10001 3300015689 Bacteria 3943671
98 Ga0163161_10125616 3300017792 Bacteria 1931
99 Ga0213872_10009430 3300021361 Bacteria 4680
100 Ga0213872_10029591 3300021361 Bacteria 2511
101 Ga0213872_10031459 3300021361 Bacteria 2432
102 Ga0213872_10056987 3300021361 Bacteria 1769
103 Ga0213876_10000866 3300021384 Bacteria 20246
104 Ga0213876_10059376 3300021384 Bacteria 2019
105 Ga0209565_1000001 3300025263 Bacteria 2950419
106 Ga0209673_1000001 3300025273 Bacteria 3176258
107 Ga0209673_1005435 3300025273 Bacteria 6398
108 Ga0209675_1000001 3300025291 Bacteria 2950293
109 Ga0209676_1000902 3300025292 Bacteria 37485
110 Ga0209676_1001161 3300025292 Bacteria 28651
111 Ga0209676_1002423 3300025292 Bacteria 13291
112 Ga0209676_1006355 3300025292 Bacteria 5855
113 Ga0209025_1007298 3300025294 Bacteria 8291
114 Ga0209564_1000001 3300025295 Bacteria 3176258
115 Ga0209050_1001357 3300025298 Bacteria 26808
116 Ga0209050_1007174 3300025298 Bacteria 6342
117 Ga0209256_1000006 3300025299 Bacteria 1250310
118 Ga0209256_1005403 3300025299 Bacteria 7385
119 Ga0209256_1005945 3300025299 Bacteria 6717
120 Ga0209256_1009340 3300025299 Bacteria 4322
121 Ga0209257_1000210 3300025304 Bacteria 140822
122 Ga0209257_1003775 3300025304 Bacteria 12505
123 Ga0209257_1005068 3300025304 Bacteria 9564
124 Ga0209257_1005348 3300025304 Bacteria 9082
125 Ga0209257_1007462 3300025304 Bacteria 6595
126 Ga0207696_1016723 3300025711 Bacteria 2447
127 Ga0207655_1002341 3300025728 Bacteria 15512
128 Ga0207655_1007722 3300025728 Bacteria 6939
129 Ga0207655_1007730 3300025728 Bacteria 6934
130 Ga0207655_1011338 3300025728 Bacteria 5313
131 Ga0207655_1018267 3300025728 Bacteria 3733
132 Ga0207713_1012682 3300025735 Bacteria 4488
133 Ga0207713_1044270 3300025735 Bacteria 1830
134 Ga0207710_10000183 3300025900 Bacteria 61804
135 Ga0207705_10062439 3300025909 Bacteria 2691
136 Ga0207707_10047964 3300025912 Bacteria 3721
137 Ga0207695_10007769 3300025913 Bacteria 13577
138 Ga0207695_10065167 3300025913 Bacteria 3746
139 Ga0207695_10131933 3300025913 Bacteria 2455
140 Ga0207695_10133277 3300025913 Bacteria 2440
141 Ga0207663_10005210 3300025916 Bacteria 6542
142 Ga0207663_10005235 3300025916 Bacteria 6529
143 Ga0207657_10000382 3300025919 Bacteria 46682
144 Ga0207649_10010491 3300025920 Bacteria 5092
145 Ga0207681_10002292 3300025923 Bacteria 12161
146 Ga0207681_10146280 3300025923 Bacteria 1766
147 Ga0207709_10000158 3300025935 Bacteria 91810
148 Ga0207709_10001701 3300025935 Bacteria 14815
149 Ga0207670_10007497 3300025936 Bacteria 6092
150 Ga0207704_10020808 3300025938 Bacteria 3480
151 Ga0207711_10002794 3300025941 Bacteria 15353
152 Ga0207689_10002804 3300025942 Bacteria 16096
153 Ga0207661_10004098 3300025944 Bacteria 10188
154 Ga0207667_10029049 3300025949 Bacteria 6000
155 Ga0207667_10134131 3300025949 Bacteria 2550
156 Ga0207667_10140243 3300025949 Bacteria 2489
157 Ga0207651_10026451 3300025960 Bacteria 3625
158 Ga0207712_10000715 3300025961 Bacteria 25589
159 Ga0207640_10000034 3300025981 Bacteria 112705
160 Ga0207658_10132471 3300025986 Bacteria 2005
161 Ga0207639_10000035 3300026041 Bacteria 149309
162 Ga0207639_10029920 3300026041 Bacteria 3991
163 Ga0207678_10019561 3300026067 Bacteria 5951
164 Ga0207678_10029209 3300026067 Bacteria 4811
165 Ga0207702_10002023 3300026078 Bacteria 19644
166 Ga0207702_10021893 3300026078 Bacteria 5294
167 Ga0207641_10007842 3300026088 Bacteria 8865
168 Ga0207641_10157468 3300026088 Bacteria 2062
169 Ga0207674_10029154 3300026116 Bacteria 5815
170 Ga0209371_1000196 3300027312 Bacteria 89093
171 Ga0210002_1006122 3300027617 Bacteria 1811
172 Ga0209971_1012770 3300027682 Bacteria 1990
173 Ga0209974_10008828 3300027876 Bacteria 3436
174 Ga0265337_1000251 3300028556 Bacteria 29120
175 Ga0265337_1000914 3300028556 Bacteria 15456
176 Ga0265337_1001114 3300028556 Bacteria 13754
177 Ga0265337_1013879 3300028556 Bacteria 2687
178 Ga0265337_1021077 3300028556 Bacteria 2036
179 Ga0265326_10005939 3300028558 Bacteria 3825
180 Ga0265319_1000003 3300028563 Bacteria 340561
181 Ga0265319_1000803 3300028563 Bacteria 20192
182 Ga0265319_1000823 3300028563 Bacteria 19789
183 Ga0265319_1005577 3300028563 Bacteria 5998
184 Ga0265319_1007534 3300028563 Bacteria 4880
185 Ga0265319_1008439 3300028563 Bacteria 4512
186 Ga0265319_1011554 3300028563 Bacteria 3607
187 Ga0265319_1015882 3300028563 Bacteria 2900
188 Ga0265319_1016168 3300028563 Bacteria 2866
189 Ga0265319_1029819 3300028563 Bacteria 1913
190 Ga0265319_1035904 3300028563 Bacteria 1698
191 Ga0265334_10002411 3300028573 Bacteria 8791
192 Ga0265318_10000002 3300028577 Bacteria 428208
193 Ga0265318_10000428 3300028577 Bacteria 32073
194 Ga0265318_10001018 3300028577 Bacteria 17915
195 Ga0265318_10009518 3300028577 Bacteria 4269
196 Ga0265318_10009819 3300028577 Bacteria 4196
197 Ga0265323_10000011 3300028653 Bacteria 109381
198 Ga0265323_10000277 3300028653 Bacteria 29606
199 Ga0265323_10001389 3300028653 Bacteria 11948
200 Ga0265323_10029283 3300028653 Bacteria 2061
201 Ga0265322_10000292 3300028654 Bacteria 21430
202 Ga0265322_10001257 3300028654 Bacteria 8573
203 Ga0265322_10011097 3300028654 Bacteria 2614
204 Ga0265336_10005052 3300028666 Bacteria 4911
205 Ga0265336_10005398 3300028666 Bacteria 4720
206 Ga0265336_10014279 3300028666 Bacteria 2635
207 Ga0265338_10000184 3300028800 Bacteria 116834
208 Ga0265338_10000200 3300028800 Bacteria 113123
209 Ga0265338_10000263 3300028800 Bacteria 95638
210 Ga0265338_10000320 3300028800 Bacteria 87120
211 Ga0265338_10000347 3300028800 Bacteria 84472
212 Ga0265338_10000513 3300028800 Bacteria 68145
213 Ga0265338_10000554 3300028800 Bacteria 65376
214 Ga0265338_10001238 3300028800 Bacteria 42063
215 Ga0265338_10002137 3300028800 Bacteria 30371
216 Ga0265338_10002172 3300028800 Bacteria 30147
217 Ga0265338_10002311 3300028800 Bacteria 28938
218 Ga0265338_10003386 3300028800 Bacteria 22497
219 Ga0265338_10008532 3300028800 Bacteria 12412
220 Ga0265338_10009147 3300028800 Bacteria 11889
221 Ga0265338_10010711 3300028800 Bacteria 10708
222 Ga0265338_10015850 3300028800 Bacteria 8250
223 Ga0265338_10017194 3300028800 Bacteria 7812
224 Ga0265338_10017259 3300028800 Bacteria 7792
225 Ga0265338_10022493 3300028800 Bacteria 6524
226 Ga0265338_10025126 3300028800 Bacteria 6059
227 Ga0265338_10027467 3300028800 Bacteria 5710
228 Ga0265338_10035090 3300028800 Bacteria 4829
229 Ga0265338_10044302 3300028800 Bacteria 4111
230 Ga0265338_10101274 3300028800 Bacteria 2346
231 Ga0265324_10000554 3300029957 Bacteria 25600
232 Ga0265324_10002939 3300029957 Bacteria 8344
233 Ga0265324_10010863 3300029957 Bacteria 3491
234 Ga0265324_10010965 3300029957 Bacteria 3473
235 Ga0265324_10030760 3300029957 Bacteria 1882
236 Ga0268256_1000158 3300030500 Bacteria 89061
237 Ga0316182_1288804 3300030745 Bacteria 2825
238 Ga0265330_10004335 3300031235 Bacteria 7215
239 Ga0265330_10008330 3300031235 Bacteria 4994
240 Ga0265320_10000110 3300031240 Bacteria 71074
241 Ga0265320_10000159 3300031240 Bacteria 56242
242 Ga0265320_10000259 3300031240 Bacteria 43696
243 Ga0265320_10000389 3300031240 Bacteria 35533
244 Ga0265320_10001095 3300031240 Bacteria 19995
245 Ga0265320_10001124 3300031240 Bacteria 19714
246 Ga0265320_10001682 3300031240 Bacteria 15726
247 Ga0265320_10004404 3300031240 Bacteria 9234
248 Ga0265320_10005686 3300031240 Bacteria 7956
249 Ga0265320_10007885 3300031240 Bacteria 6569
250 Ga0265320_10011677 3300031240 Bacteria 5157
251 Ga0265320_10021093 3300031240 Bacteria 3514
252 Ga0265320_10023960 3300031240 Bacteria 3238
253 Ga0265320_10031260 3300031240 Bacteria 2736
254 Ga0265320_10032905 3300031240 Bacteria 2650
255 Ga0265320_10050638 3300031240 Bacteria 2018
256 Ga0265325_10005256 3300031241 Bacteria 8034
257 Ga0265325_10032501 3300031241 Bacteria 2785
258 Ga0265329_10003236 3300031242 Bacteria 7137
259 Ga0265340_10000287 3300031247 Bacteria 26530
260 Ga0265340_10013745 3300031247 Bacteria 4246
261 Ga0265340_10014338 3300031247 Bacteria 4144
262 Ga0265339_10015075 3300031249 Bacteria 4644
263 Ga0265339_10031005 3300031249 Bacteria 3024
264 Ga0265339_10053093 3300031249 Bacteria 2205
265 Ga0265339_10083234 3300031249 Bacteria 1688
266 Ga0265331_10018469 3300031250 Bacteria 3615
267 Ga0265327_10000057 3300031251 Bacteria 242754
268 Ga0265327_10000379 3300031251 Bacteria 83712
269 Ga0265327_10004338 3300031251 Bacteria 12635
270 Ga0265327_10004736 3300031251 Bacteria 11873
271 Ga0265327_10019564 3300031251 Bacteria 4157
272 Ga0265316_10001121 3300031344 Bacteria 29042
273 Ga0265316_10004881 3300031344 Bacteria 13205
274 Ga0265316_10026731 3300031344 Bacteria 4794
275 Ga0265316_10047970 3300031344 Bacteria 3375
276 Ga0265316_10073943 3300031344 Bacteria 2624
277 Ga0265316_10094217 3300031344 Bacteria 2281
278 Ga0265316_10100062 3300031344 Bacteria 2204
279 Ga0265316_10176821 3300031344 Bacteria 1590
280 Ga0307408_100000007 3300031548 Bacteria 463086
281 Ga0307408_100040395 3300031548 Bacteria 3303
282 Ga0265313_10001890 3300031595 Bacteria 19029
283 Ga0265313_10002081 3300031595 Bacteria 17894
284 Ga0265313_10002194 3300031595 Bacteria 17277
285 Ga0265313_10003407 3300031595 Bacteria 12886
286 Ga0265313_10004315 3300031595 Bacteria 11007
287 Ga0265313_10021190 3300031595 Bacteria 3560
288 Ga0265313_10030412 3300031595 Bacteria 2780
289 Ga0307508_10000022 3300031616 Bacteria 180417
290 Ga0316575_10001135 3300031665 Bacteria 8330
291 Ga0316579_10010761 3300031691 Bacteria 3874
292 Ga0265314_10003608 3300031711 Bacteria 14888
293 Ga0265314_10006431 3300031711 Bacteria 10406
294 Ga0265314_10009078 3300031711 Bacteria 8446
295 Ga0265314_10015296 3300031711 Bacteria 6094
296 Ga0265314_10027097 3300031711 Bacteria 4295
297 Ga0265314_10086980 3300031711 Bacteria 2044
298 Ga0265342_10003796 3300031712 Bacteria 12167
299 Ga0265342_10004395 3300031712 Bacteria 11124
300 Ga0316576_10004838 3300031727 Bacteria 8138
301 Ga0316576_10006816 3300031727 Bacteria 7139
302 Ga0316576_10016214 3300031727 Bacteria 5024
303 Ga0316576_10126379 3300031727 Bacteria 1922
304 Ga0316578_10005703 3300031728 Bacteria 6066
305 Ga0316578_10009548 3300031728 Bacteria 4991
306 Ga0316578_10075724 3300031728 Bacteria 1997
307 Ga0316577_10002105 3300031733 Bacteria 9729
308 Ga0316577_10003803 3300031733 Bacteria 7693
309 Ga0316577_10011418 3300031733 Bacteria 4810
310 Ga0316577_10014855 3300031733 Bacteria 4280
311 Ga0316577_10024593 3300031733 Bacteria 3348
312 Ga0307413_10001038 3300031824 Bacteria 10048
313 Ga0307410_10000001 3300031852 Bacteria 162839
314 Ga0307406_10039435 3300031901 Bacteria 2930
315 Ga0307407_10018781 3300031903 Bacteria 3505
316 Ga0307409_100006776 3300031995 Bacteria 6774
317 Ga0307416_100000075 3300032002 Bacteria 77549
318 Ga0307416_100046719 3300032002 Bacteria 3420
319 Ga0307414_10013792 3300032004 Bacteria 4821
320 Ga0307414_10021368 3300032004 Bacteria 4059
321 Ga0307411_10024861 3300032005 Bacteria 3578
322 Ga0316583_10002756 3300032133 Bacteria 6147
323 Ga0316583_10004055 3300032133 Bacteria 5204
324 Ga0316583_10018663 3300032133 Bacteria 2490
325 Ga0316580_10001238 3300032139 Bacteria 6553
326 Ga0316580_10001509 3300032139 Bacteria 6105
327 Ga0316580_10033048 3300032139 Bacteria 1601
328 Ga0316593_10002985 3300032168 Bacteria 4119
329 Ga0316593_10005984 3300032168 Bacteria 3253
330 Ga0307510_10037192 3300033180 Bacteria 5405
331 Ga0316596_1000165 3300033541 Bacteria 9311
332 Ga0373944_0000352 3300035089 Bacteria 10398
333 Ga0373951_0009382 3300035091 Bacteria 2204
334 Ga0373932_0000001 3300035112 Bacteria 1459067
335 Ga0373945_0012228 3300035116 Bacteria 2847
336 Ga0373954_0009052 3300035118 Bacteria 4381
337 Ga0373954_0048328 3300035118 Bacteria 1993
338 Ga0373962_0000127 3300035242 Bacteria 15740
339 Ga0316574_0011473 3300035398 Bacteria 5035
340 Ga0316574_0032217 3300035398 Bacteria 3184
341 Ga0316574_0057647 3300035398 Unclassified 2432
342 Ga0316574_0066272 3300035398 Bacteria 2275
343 Ga0373931_0000004 3300035691 Bacteria 535140
344 Ga0373935_0049473 3300035692 Bacteria 2664
345 Ga0373927_0003699 3300035695 Bacteria 10879
346 Ga0373927_0056192 3300035695 Bacteria 2544
347 Ga0373947_0004199 3300035725 Bacteria 8451
348 Ga0373937_0012207 3300036401 Bacteria 7544
349 Ga0373937_0047265 3300036401 Bacteria 3937
350 Ga0373937_0325112 3300036401 Bacteria 1455
351 Ga0316582_0006295 3300036647 Bacteria 6217
352 Ga0316582_0008202 3300036647 Bacteria 5603
353 Ga0316582_0009688 3300036647 Bacteria 5239
354 Ga0316582_0015268 3300036647 Bacteria 4386
355 Ga0316582_0019521 3300036647 Bacteria 3969
356 Ga0316582_0021577 3300036647 Bacteria 3809
357 Ga0316582_0083455 3300036647 Bacteria 2091
358 Ga0316584_0012702 3300036712 Bacteria 5942
359 Ga0316584_0014282 3300036712 Bacteria 5648
360 Ga0316584_0018669 3300036712 Bacteria 5005
361 Ga0316584_0031793 3300036712 Bacteria 3902
362 Ga0373925_0000046 3300037068 Bacteria 131256
363 Ga0373925_0002903 3300037068 Bacteria 13525
364 Ga0373925_0003523 3300037068 Bacteria 12080
365 Ga0395905_0000036 3300037471 Bacteria 271733
366 Ga0316581_0005119 3300037588 Bacteria 3393
367 Ga0316581_0020092 3300037588 Bacteria 1953
368 Ga0436364_0340892 3300037853 Bacteria 4706
369 Ga0436365_0952319 3300039437 Bacteria 3592
370 Ga0436365_1606334 3300039437 Bacteria 14480
371 Ga0436361_0762967 3300039447 Bacteria 7504
372 Ga0436361_0822273 3300039447 Bacteria 5614
373 Ga0439447_005890 3300041407 Bacteria 4029
374 Ga0439465_0012572 3300041413 Bacteria 2646
375 Ga0451837_0212869 3300041494 Bacteria 2291
376 Ga0451577_0004486 3300042876 Bacteria 14723
377 Ga0451577_0004858 3300042876 Bacteria 14009
378 Ga0451577_0007055 3300042876 Bacteria 11080
379 Ga0451577_0032552 3300042876 Bacteria 4697
380 Ga0451577_0051276 3300042876 Bacteria 3684
381 Ga0451577_0124000 3300042876 Bacteria 2315
382 Ga0453683_0000910 3300044673 Bacteria 28249
383 Ga0453684_0000027 3300044712 Bacteria 778857
384 Ga0453684_0000045 3300044712 Bacteria 582917
385 Ga0453684_0002261 3300044712 Bacteria 47581
386 Ga0453684_0005542 3300044712 Bacteria 24913
387 Ga0453684_0034358 3300044712 Bacteria 7039
388 Ga0453684_0045609 3300044712 Bacteria 5844
389 Ga0453684_0066529 3300044712 Bacteria 4588
390 Ga0453684_0087231 3300044712 Bacteria 3868
391 Ga0453684_0103294 3300044712 Bacteria 3483
392 Ga0453684_0141403 3300044712 Bacteria 2873
393 Ga0453684_0205439 3300044712 Bacteria 2293
394 Ga0453684_0238912 3300044712 Bacteria 2093
395 Ga0466957_0014027 3300044842 Bacteria 4661
396 Ga0451576_0000042 3300045051 Bacteria 342102
397 Ga0451576_0000087 3300045051 Bacteria 234554
398 Ga0451576_0004518 3300045051 Bacteria 18002
399 Ga0451576_0012547 3300045051 Bacteria 9509
400 Ga0451576_0013113 3300045051 Bacteria 9280
401 Ga0451576_0063212 3300045051 Bacteria 3859
402 Ga0451576_0111647 3300045051 Bacteria 2845
403 Ga0451576_0129060 3300045051 Bacteria 2635
404 Ga0466958_0000225 3300045836 Bacteria 21373
405 Ga0495592_0000071 3300046454 Bacteria 92699
406 Ga0495629_0037998 3300046459 Bacteria 3393
407 Ga0495650_0000022 3300046471 Bacteria 530747
408 Ga0495582_0003703 3300046473 Bacteria 8614
409 Ga0495664_0002475 3300046477 Bacteria 9941
410 Ga0495664_0012580 3300046477 Bacteria 4796
411 Ga0495585_0020300 3300046492 Bacteria 3822
412 Ga0495594_0000293 3300046499 Bacteria 24453
413 Ga0495594_0005914 3300046499 Bacteria 6286
414 Ga0495606_0041643 3300046507 Bacteria 3079
415 Ga0495618_0011308 3300046514 Bacteria 5409
416 Ga0495628_0000197 3300046516 Bacteria 52941
417 Ga0495628_0041772 3300046516 Bacteria 3660
418 Ga0495630_0000259 3300046517 Bacteria 42857
419 Ga0495630_0009424 3300046517 Bacteria 7019
420 Ga0495630_0029032 3300046517 Bacteria 4111
421 Ga0495630_0029622 3300046517 Bacteria 4069
422 Ga0495630_0029760 3300046517 Bacteria 4060
423 Ga0495630_0045943 3300046517 Bacteria 3264
424 Ga0495630_0145794 3300046517 Bacteria 1800
425 Ga0495631_0014684 3300046518 Bacteria 3774
426 Ga0495644_0000029 3300046523 Bacteria 66705
427 Ga0495666_0013128 3300046526 Bacteria 4127
428 Ga0495652_0011503 3300046529 Bacteria 8001
429 Ga0495652_0093896 3300046529 Bacteria 2448
430 Ga0495640_0003745 3300046533 Bacteria 12212
431 Ga0495640_0028378 3300046533 Bacteria 4031
432 Ga0495586_0000354 3300046535 Bacteria 28760
433 Ga0495586_0000831 3300046535 Bacteria 17728
434 Ga0495586_0002193 3300046535 Bacteria 10602
435 Ga0495586_0003764 3300046535 Bacteria 8128
436 Ga0495609_0017978 3300046538 Bacteria 3280
437 Ga0495645_0010263 3300046543 Bacteria 6565
438 Ga0495645_0031867 3300046543 Bacteria 3843
439 Ga0495645_0042856 3300046543 Bacteria 3300
440 Ga0495656_0015108 3300046615 Bacteria 2908
441 Ga0495634_0005470 3300046642 Bacteria 9767
442 Ga0495634_0011017 3300046642 Eukaryota 6598
443 Ga0495634_0017272 3300046642 Bacteria 5152
444 Ga0495634_0064143 3300046642 Bacteria 2436
445 Ga0495625_0106196 3300046660 Bacteria 1923
446 Ga0495658_0018703 3300046683 Bacteria 3606
447 Ga0495658_0021521 3300046683 Bacteria 3400
448 Ga0495658_0036059 3300046683 Bacteria 2726
449 Ga0495658_0094316 3300046683 Bacteria 1777
450 Ga0495669_0002144 3300046684 Bacteria 8101
451 Ga0495613_0010010 3300046689 Bacteria 7042
452 Ga0495613_0074810 3300046689 Bacteria 2466
453 Ga0495613_0096816 3300046689 Bacteria 2134
454 Ga0495581_0004384 3300047315 Bacteria 8155
455 Ga0495636_0005137 3300047318 Bacteria 5138
456 Ga0495674_0001707 3300047319 Bacteria 21598
457 Ga0495674_0003275 3300047319 Bacteria 15733
458 Ga0495674_0004874 3300047319 Bacteria 12907
459 Ga0495672_0004387 3300047320 Bacteria 11573
460 Ga0495677_0034428 3300047445 Bacteria 1848
461 Ga0495684_0104814 3300047471 Bacteria 2137
462 Ga0496107_0157595 3300048910 Bacteria 1682
463 Ga0496112_0228139 3300048915 Bacteria 1817
464 Ga0496114_0033404 3300048917 Bacteria 4239
465 Ga0496115_0061108 3300048918 Bacteria 3037
466 Ga0496115_0120232 3300048918 Bacteria 2161
467 Ga0496120_0048932 3300048923 Bacteria 2430
468 Ga0496121_0064406 3300048924 Bacteria 2989
469 Ga0496126_0000010 3300048929 Bacteria 744888
470 Ga0496126_0000130 3300048929 Bacteria 173900
471 Ga0501290_000859 3300049513 Bacteria 4447
472 Ga0501312_004717 3300049528 Bacteria 1622
473 Ga0501031_0000048 3300049568 Bacteria 65739
474 Ga0501031_0045655 3300049568 Bacteria 2858
475 Ga0501032_0000729 3300049569 Bacteria 26674
476 Ga0501032_0029723 3300049569 Bacteria 3748
477 Ga0501032_0042081 3300049569 Bacteria 3100
478 Ga0501033_0011115 3300049570 Bacteria 6896
479 Ga0501033_0061070 3300049570 Bacteria 2778
480 Ga0501034_0000535 3300049571 Bacteria 60322
481 Ga0501034_0006635 3300049571 Bacteria 12424
482 Ga0501034_0009829 3300049571 Bacteria 10002
483 Ga0501036_0021189 3300049572 Bacteria 5460
484 Ga0501038_0004043 3300049574 Bacteria 13631
485 Ga0501039_0102176 3300049575 Bacteria 2237
486 Ga0501040_0000006 3300049576 Bacteria 97170
487 Ga0501042_0000196 3300049578 Bacteria 28694
488 Ga0501042_0003131 3300049578 Bacteria 10307
489 Ga0501043_0003354 3300049579 Bacteria 13194
490 Ga0501046_0000709 3300049580 Bacteria 32155
491 Ga0501046_0047462 3300049580 Bacteria 3404
492 Ga0501047_0011227 3300049581 Bacteria 8477
493 Ga0501047_0012584 3300049581 Bacteria 8016
494 Ga0501047_0022569 3300049581 Bacteria 6042
495 Ga0501047_0223837 3300049581 Bacteria 1737
496 Ga0501048_0045636 3300049582 Bacteria 3129
497 Ga0501070_0019673 3300049586 Bacteria 5661
498 Ga0501077_0031563 3300049593 Bacteria 3372
499 Ga0501080_0246070 3300049742 Bacteria 1631
500 Ga0501083_0013265 3300049744 Bacteria 5762
501 Ga0501083_0028152 3300049744 Bacteria 3875
502 Ga0501275_000768 3300049772 Bacteria 3513
503 Ga0501035_0002195 3300049822 Bacteria 19366
504 Ga0501035_0065567 3300049822 Bacteria 3224
505 Ga0501044_0000202 3300049823 Bacteria 75472
506 Ga0501044_0000593 3300049823 Bacteria 43923
507 Ga0501044_0001178 3300049823 Bacteria 30993
508 Ga0501044_0007964 3300049823 Bacteria 11643
509 Ga0501044_0026532 3300049823 Bacteria 6131
510 Ga0501044_0031771 3300049823 Bacteria 5553
511 Ga0501044_0045030 3300049823 Bacteria 4575
512 nmdc:mga00v17_95797_c1 3300050491 Bacteria 1869
513 nmdc:mga09592_66056_c1 3300050508 Bacteria 3065
514 nmdc:mga08y16_19805_c1 3300050511 Bacteria 5874
515 Ga0500651_0000003 3300053093 Bacteria 422045
516 Ga0500595_000005 3300053119 Bacteria 340896
517 Ga0500568_0001737 3300053139 Bacteria 13499
518 Ga0500622_0007500 3300053156 Bacteria 6192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0325112 Ga0373937_0325112_58_1383 399
2 3300044712 Ga0453684_0141403 Ga0453684_0141403_40_1305 405
3 3300046543 Ga0495645_0042856 Ga0495645_0042856_280_1671 406
4 3300046615 Ga0495656_0015108 Ga0495656_0015108_11_1249 407
5 3300005471 Ga0070698_100199954 Ga0070698_1001999541 442
6 3300028654 Ga0265322_10000292 Ga0265322_1000029215 443
7 3300026088 Ga0207641_10007842 Ga0207641_100078425 444
8 3300028800 Ga0265338_10000200 Ga0265338_1000020071 444
9 3300005548 Ga0070665_100115862 Ga0070665_1001158622 445
10 3300049579 Ga0501043_0003354 Ga0501043_0003354_28_1458 446
11 3300045051 Ga0451576_0129060 Ga0451576_0129060_85_1605 447
12 3300028800 Ga0265338_10009147 Ga0265338_1000914710 450
13 3300036401 Ga0373937_0047265 Ga0373937_0047265_1886_3409 450
14 3300049581 Ga0501047_0223837 Ga0501047_0223837_305_1708 450
15 3300049742 Ga0501080_0246070 Ga0501080_0246070_106_1515 450
16 3300028800 Ga0265338_10015850 Ga0265338_100158506 451
17 3300046543 Ga0495645_0031867 Ga0495645_0031867_1048_2571 451
18 3300028653 Ga0265323_10000277 Ga0265323_1000027726 452
19 3300028654 Ga0265322_10011097 Ga0265322_100110973 452
20 3300031344 Ga0265316_10094217 Ga0265316_100942171 452
21 3300005563 Ga0068855_100030799 Ga0068855_1000307993 453
22 3300025949 Ga0207667_10029049 Ga0207667_100290497 453
23 3300046517 Ga0495630_0029622 Ga0495630_0029622_1225_2799 453
24 3300046642 Ga0495634_0064143 Ga0495634_0064143_57_1631 453
25 3300047471 Ga0495684_0104814 Ga0495684_0104814_30_1604 453
26 3300048918 Ga0496115_0061108 Ga0496115_0061108_451_1986 453
27 3300005329 Ga0070683_100004788 Ga0070683_1000047883 454
28 3300025944 Ga0207661_10004098 Ga0207661_100040987 454
29 3300028800 Ga0265338_10101274 Ga0265338_101012742 454
30 3300031240 Ga0265320_10000389 Ga0265320_1000038911 454
31 3300031344 Ga0265316_10073943 Ga0265316_100739432 454
32 3300035118 Ga0373954_0048328 Ga0373954_0048328_34_1605 454
33 3300035692 Ga0373935_0049473 Ga0373935_0049473_437_1972 454
34 3300035695 Ga0373927_0003699 Ga0373927_0003699_386_1921 454
35 3300035725 Ga0373947_0004199 Ga0373947_0004199_4492_6027 454
36 3300037068 Ga0373925_0003523 Ga0373925_0003523_8344_9879 454
37 3300046517 Ga0495630_0029032 Ga0495630_0029032_1155_2690 454
38 3300005445 Ga0070708_100245187 Ga0070708_1002451871 455
39 3300028558 Ga0265326_10005939 Ga0265326_100059392 455
40 3300028800 Ga0265338_10000263 Ga0265338_1000026362 455
41 3300028800 Ga0265338_10000347 Ga0265338_1000034728 455
42 3300028800 Ga0265338_10000554 Ga0265338_1000055448 455
43 3300028800 Ga0265338_10002137 Ga0265338_100021374 455
44 3300029957 Ga0265324_10000554 Ga0265324_1000055422 455
45 3300031240 Ga0265320_10000259 Ga0265320_1000025915 455
46 3300031249 Ga0265339_10015075 Ga0265339_100150752 455
47 3300028800 Ga0265338_10000184 Ga0265338_1000018425 456
48 3300028800 Ga0265338_10025126 Ga0265338_100251263 456
49 3300031240 Ga0265320_10050638 Ga0265320_100506382 456
50 3300046473 Ga0495582_0003703 Ga0495582_0003703_2795_4324 456
51 3300046517 Ga0495630_0000259 Ga0495630_0000259_13076_14605 456
52 3300046526 Ga0495666_0013128 Ga0495666_0013128_2275_3804 456
53 3300046535 Ga0495586_0000354 Ga0495586_0000354_2112_3641 456
54 3300046642 Ga0495634_0017272 Ga0495634_0017272_2430_3959 456
55 3300046683 Ga0495658_0018703 Ga0495658_0018703_1781_3310 456
56 3300046689 Ga0495613_0096816 Ga0495613_0096816_481_2010 456
57 3300047319 Ga0495674_0004874 Ga0495674_0004874_1510_3039 456
58 3300031251 Ga0265327_10004736 Ga0265327_100047364 457
59 3300032002 Ga0307416_100046719 Ga0307416_1000467192 457
60 3300005353 Ga0070669_100158349 Ga0070669_1001583492 458
61 3300009036 Ga0105244_10079108 Ga0105244_100791081 458
62 3300009036 Ga0105244_10081471 Ga0105244_100814711 458
63 3300009553 Ga0105249_10008437 Ga0105249_100084376 458
64 3300013102 Ga0157371_10035675 Ga0157371_100356753 458
65 3300025728 Ga0207655_1002341 Ga0207655_10023411 458
66 3300025728 Ga0207655_1018267 Ga0207655_10182671 458
67 3300025923 Ga0207681_10146280 Ga0207681_101462802 458
68 3300025961 Ga0207712_10000715 Ga0207712_1000071519 458
69 3300028563 Ga0265319_1035904 Ga0265319_10359041 458
70 3300028573 Ga0265334_10002411 Ga0265334_100024112 458
71 3300028577 Ga0265318_10000002 Ga0265318_10000002278 458
72 3300028800 Ga0265338_10027467 Ga0265338_100274673 458
73 3300031249 Ga0265339_10053093 Ga0265339_100530931 458
74 3300031250 Ga0265331_10018469 Ga0265331_100184692 458
75 3300031251 Ga0265327_10000057 Ga0265327_1000005787 458
76 3300031595 Ga0265313_10001890 Ga0265313_1000189011 458
77 3300031711 Ga0265314_10003608 Ga0265314_100036082 458
78 3300049586 Ga0501070_0019673 Ga0501070_0019673_1111_2670 458
79 3300005327 Ga0070658_10023675 Ga0070658_100236752 459
80 3300013308 Ga0157375_10000040 Ga0157375_1000004058 459
81 3300028800 Ga0265338_10002311 Ga0265338_1000231119 459
82 3300031251 Ga0265327_10004338 Ga0265327_100043387 459
83 3300031616 Ga0307508_10000022 Ga0307508_10000022123 459
84 3300042876 Ga0451577_0124000 Ga0451577_0124000_429_1883 459
85 3300044712 Ga0453684_0005542 Ga0453684_0005542_6169_7623 459
86 3300044712 Ga0453684_0087231 Ga0453684_0087231_2038_3477 459
87 3300044712 Ga0453684_0103294 Ga0453684_0103294_1009_2445 459
88 3300049569 Ga0501032_0000729 Ga0501032_0000729_1964_3403 459
89 3300049581 Ga0501047_0022569 Ga0501047_0022569_4446_5885 459
90 3300049823 Ga0501044_0000593 Ga0501044_0000593_19186_20625 459
91 3300053139 Ga0500568_0001737 Ga0500568_0001737_9226_10662 459
92 3300053156 Ga0500622_0007500 Ga0500622_0007500_3523_4959 459
93 3300028577 Ga0265318_10000428 Ga0265318_100004282 461
94 3300031240 Ga0265320_10004404 Ga0265320_100044043 461
95 3300031711 Ga0265314_10086980 Ga0265314_100869801 461
96 3300049513 Ga0501290_000859 Ga0501290_000859_1660_3150 462
97 3300049772 Ga0501275_000768 Ga0501275_000768_1606_3096 462
98 3300031691 Ga0316579_10010761 Ga0316579_100107612 463
99 3300031727 Ga0316576_10004838 Ga0316576_100048384 463
100 3300031727 Ga0316576_10006816 Ga0316576_100068164 463
101 3300031727 Ga0316576_10016214 Ga0316576_100162142 463
102 3300031727 Ga0316576_10126379 Ga0316576_101263792 463
103 3300031728 Ga0316578_10005703 Ga0316578_100057033 463
104 3300031733 Ga0316577_10002105 Ga0316577_100021054 463
105 3300031733 Ga0316577_10003803 Ga0316577_100038036 463
106 3300032133 Ga0316583_10018663 Ga0316583_100186631 463
107 3300032139 Ga0316580_10001238 Ga0316580_100012383 463
108 3300032139 Ga0316580_10001509 Ga0316580_100015094 463
109 3300032139 Ga0316580_10033048 Ga0316580_100330481 463
110 3300032168 Ga0316593_10002985 Ga0316593_100029852 463
111 3300033541 Ga0316596_1000165 Ga0316596_10001652 463
112 3300035398 Ga0316574_0032217 Ga0316574_0032217_1562_3100 463
113 3300035398 Ga0316574_0057647 Ga0316574_0057647_44_1582 463
114 3300036647 Ga0316582_0006295 Ga0316582_0006295_3253_4755 463
115 3300036647 Ga0316582_0009688 Ga0316582_0009688_1417_2925 463
116 3300036647 Ga0316582_0019521 Ga0316582_0019521_1015_2499 463
117 3300036647 Ga0316582_0083455 Ga0316582_0083455_221_1759 463
118 3300036712 Ga0316584_0012702 Ga0316584_0012702_2187_3695 463
119 3300036712 Ga0316584_0014282 Ga0316584_0014282_497_1999 463
120 3300036712 Ga0316584_0031793 Ga0316584_0031793_368_1852 463
121 3300003781 Ga0055536_1003420 Ga0055536_10034204 465
122 3300003794 Ga0055531_10001941 Ga0055531_1000194111 465
123 3300025292 Ga0209676_1001161 Ga0209676_100116118 465
124 3300025298 Ga0209050_1007174 Ga0209050_10071745 465
125 3300025304 Ga0209257_1000210 Ga0209257_100021091 465
126 3300025920 Ga0207649_10010491 Ga0207649_100104912 465
127 3300044712 Ga0453684_0000027 Ga0453684_0000027_512137_513654 465
128 3300048917 Ga0496114_0033404 Ga0496114_0033404_1893_3419 466
129 3300049593 Ga0501077_0031563 Ga0501077_0031563_332_1813 466
130 3300021384 Ga0213876_10000866 Ga0213876_1000086612 467
131 3300039437 Ga0436365_1606334 Ga0436365_1606334_12126_13622 467
132 3300041494 Ga0451837_0212869 Ga0451837_0212869_224_1774 467
133 3300049744 Ga0501083_0028152 Ga0501083_0028152_322_1803 467
134 iso_pu_bacteria 2740891818 2740991761 467
135 3300003771 Ga0055526_1017344 Ga0055526_10173442 468
136 3300003791 Ga0055530_10001342 Ga0055530_1000134215 468
137 3300003794 Ga0055531_10011887 Ga0055531_100118874 468
138 3300003794 Ga0055531_10016904 Ga0055531_100169041 468
139 3300005335 Ga0070666_10058798 Ga0070666_100587982 468
140 3300005355 Ga0070671_100003171 Ga0070671_1000031714 468
141 3300005530 Ga0070679_100027326 Ga0070679_1000273262 468
142 3300009177 Ga0105248_10008706 Ga0105248_100087063 468
143 3300025273 Ga0209673_1005435 Ga0209673_10054352 468
144 3300025292 Ga0209676_1000902 Ga0209676_100090228 468
145 3300025292 Ga0209676_1006355 Ga0209676_10063552 468
146 3300025294 Ga0209025_1007298 Ga0209025_10072985 468
147 3300025298 Ga0209050_1001357 Ga0209050_100135713 468
148 3300025299 Ga0209256_1005403 Ga0209256_10054034 468
149 3300025299 Ga0209256_1009340 Ga0209256_10093402 468
150 3300025304 Ga0209257_1003775 Ga0209257_10037756 468
151 3300025304 Ga0209257_1005068 Ga0209257_10050687 468
152 3300025304 Ga0209257_1007462 Ga0209257_10074625 468
153 3300028563 Ga0265319_1005577 Ga0265319_10055775 468
154 3300028577 Ga0265318_10009518 Ga0265318_100095182 468
155 3300031595 Ga0265313_10021190 Ga0265313_100211902 468
156 3300037068 Ga0373925_0002903 Ga0373925_0002903_821_2329 468
157 3300048915 Ga0496112_0228139 Ga0496112_0228139_46_1572 468
158 3300021361 Ga0213872_10056987 Ga0213872_100569871 469
159 3300028563 Ga0265319_1011554 Ga0265319_10115542 469
160 3300041413 Ga0439465_0012572 Ga0439465_0012572_978_2480 469
161 3300045051 Ga0451576_0000087 Ga0451576_0000087_82079_83560 469
162 3300049823 Ga0501044_0031771 Ga0501044_0031771_3353_4828 469
163 3300028653 Ga0265323_10029283 Ga0265323_100292831 471
164 3300028666 Ga0265336_10014279 Ga0265336_100142792 471
165 3300031711 Ga0265314_10009078 Ga0265314_100090785 471
166 3300031733 Ga0316577_10011418 Ga0316577_100114184 471
167 3300032133 Ga0316583_10004055 Ga0316583_100040553 471
168 3300035398 Ga0316574_0011473 Ga0316574_0011473_1081_2559 471
169 3300036647 Ga0316582_0015268 Ga0316582_0015268_2077_3555 471
170 3300046477 Ga0495664_0002475 Ga0495664_0002475_251_1783 471
171 3300046499 Ga0495594_0005914 Ga0495594_0005914_4067_5599 471
172 3300046516 Ga0495628_0041772 Ga0495628_0041772_1870_3402 471
173 3300046529 Ga0495652_0011503 Ga0495652_0011503_5575_7107 471
174 3300046533 Ga0495640_0003745 Ga0495640_0003745_4507_6039 471
175 3300046642 Ga0495634_0005470 Ga0495634_0005470_1339_2871 471
176 3300046689 Ga0495613_0074810 Ga0495613_0074810_666_2198 471
177 3300047315 Ga0495581_0004384 Ga0495581_0004384_5918_7450 471
178 3300047319 Ga0495674_0003275 Ga0495674_0003275_10787_12319 471
179 3300049580 Ga0501046_0047462 Ga0501046_0047462_880_2364 471
180 3300049581 Ga0501047_0011227 Ga0501047_0011227_4334_5818 471
181 iso_pu_bacteria 2718217752 2718716204 471
182 iso_pu_bacteria 2786546940 2788434341 471
183 3300005544 Ga0070686_100008352 Ga0070686_1000083525 472
184 3300005549 Ga0070704_100068260 Ga0070704_1000682602 472
185 3300005563 Ga0068855_100049074 Ga0068855_1000490745 472
186 3300009551 Ga0105238_10103461 Ga0105238_101034612 472
187 3300013307 Ga0157372_10042442 Ga0157372_100424425 472
188 3300025292 Ga0209676_1002423 Ga0209676_100242313 472
189 3300025909 Ga0207705_10062439 Ga0207705_100624392 472
190 3300026041 Ga0207639_10029920 Ga0207639_100299202 472
191 3300028556 Ga0265337_1000914 Ga0265337_100091411 472
192 3300028556 Ga0265337_1021077 Ga0265337_10210772 472
193 3300028563 Ga0265319_1007534 Ga0265319_10075343 472
194 3300028563 Ga0265319_1029819 Ga0265319_10298191 472
195 3300028577 Ga0265318_10001018 Ga0265318_1000101812 472
196 3300028800 Ga0265338_10000320 Ga0265338_1000032039 472
197 3300028800 Ga0265338_10002172 Ga0265338_1000217221 472
198 3300029957 Ga0265324_10010965 Ga0265324_100109652 472
199 3300031240 Ga0265320_10001124 Ga0265320_1000112413 472
200 3300031240 Ga0265320_10021093 Ga0265320_100210932 472
201 3300031241 Ga0265325_10005256 Ga0265325_100052563 472
202 3300031247 Ga0265340_10014338 Ga0265340_100143383 472
203 3300031344 Ga0265316_10176821 Ga0265316_101768211 472
204 3300031595 Ga0265313_10002194 Ga0265313_1000219412 472
205 3300046492 Ga0495585_0020300 Ga0495585_0020300_1028_2551 472
206 3300046499 Ga0495594_0000293 Ga0495594_0000293_13258_14781 472
207 3300046518 Ga0495631_0014684 Ga0495631_0014684_1908_3431 472
208 3300046523 Ga0495644_0000029 Ga0495644_0000029_60511_62034 472
209 3300046684 Ga0495669_0002144 Ga0495669_0002144_3506_5029 472
210 3300049571 Ga0501034_0000535 Ga0501034_0000535_44219_45658 472
211 3300003320 rootH2_10024038 rootH2_100240382 473
212 3300005334 Ga0068869_100006632 Ga0068869_1000066324 473
213 3300005338 Ga0068868_100032686 Ga0068868_1000326863 473
214 3300005340 Ga0070689_100037556 Ga0070689_1000375564 473
215 3300005340 Ga0070689_100067084 Ga0070689_1000670842 473
216 3300005340 Ga0070689_100116300 Ga0070689_1001163002 473
217 3300005365 Ga0070688_100032851 Ga0070688_1000328512 473
218 3300005365 Ga0070688_100039213 Ga0070688_1000392133 473
219 3300005439 Ga0070711_100007295 Ga0070711_1000072953 473
220 3300005439 Ga0070711_100007799 Ga0070711_1000077994 473
221 3300005458 Ga0070681_10058928 Ga0070681_100589281 473
222 3300005544 Ga0070686_100015502 Ga0070686_1000155023 473
223 3300005544 Ga0070686_100100031 Ga0070686_1001000311 473
224 3300005563 Ga0068855_100138156 Ga0068855_1001381563 473
225 3300005563 Ga0068855_100248754 Ga0068855_1002487541 473
226 3300005577 Ga0068857_100018849 Ga0068857_1000188493 473
227 3300005614 Ga0068856_100000556 Ga0068856_10000055625 473
228 3300005614 Ga0068856_100001065 Ga0068856_1000010652 473
229 3300005617 Ga0068859_100010813 Ga0068859_1000108134 473
230 3300005617 Ga0068859_100135658 Ga0068859_1001356582 473
231 3300006028 Ga0070717_10000840 Ga0070717_1000084010 473
232 3300006237 Ga0097621_100054572 Ga0097621_1000545721 473
233 3300006847 Ga0075431_100009275 Ga0075431_1000092754 473
234 3300006881 Ga0068865_100005541 Ga0068865_1000055412 473
235 3300006931 Ga0097620_100010813 Ga0097620_1000108134 473
236 3300006931 Ga0097620_100135656 Ga0097620_1001356562 473
237 3300007076 Ga0075435_100034508 Ga0075435_1000345084 473
238 3300009093 Ga0105240_10031649 Ga0105240_100316496 473
239 3300009094 Ga0111539_10037268 Ga0111539_100372682 473
240 3300009148 Ga0105243_10001258 Ga0105243_1000125810 473
241 3300013296 Ga0157374_10009669 Ga0157374_100096693 473
242 3300014325 Ga0163163_10000014 Ga0163163_1000001414 473
243 3300021361 Ga0213872_10009430 Ga0213872_100094303 473
244 3300021361 Ga0213872_10029591 Ga0213872_100295912 473
245 3300021361 Ga0213872_10031459 Ga0213872_100314592 473
246 3300025912 Ga0207707_10047964 Ga0207707_100479641 473
247 3300025916 Ga0207663_10005210 Ga0207663_100052105 473
248 3300025916 Ga0207663_10005235 Ga0207663_100052354 473
249 3300025935 Ga0207709_10001701 Ga0207709_100017014 473
250 3300025936 Ga0207670_10007497 Ga0207670_100074976 473
251 3300025938 Ga0207704_10020808 Ga0207704_100208082 473
252 3300025942 Ga0207689_10002804 Ga0207689_1000280413 473
253 3300025949 Ga0207667_10140243 Ga0207667_101402433 473
254 3300026078 Ga0207702_10002023 Ga0207702_100020232 473
255 3300026078 Ga0207702_10021893 Ga0207702_100218932 473
256 3300026088 Ga0207641_10157468 Ga0207641_101574682 473
257 3300026116 Ga0207674_10029154 Ga0207674_100291547 473
258 3300028556 Ga0265337_1000251 Ga0265337_100025118 473
259 3300028556 Ga0265337_1001114 Ga0265337_10011143 473
260 3300028556 Ga0265337_1013879 Ga0265337_10138792 473
261 3300028563 Ga0265319_1000003 Ga0265319_1000003283 473
262 3300028563 Ga0265319_1000803 Ga0265319_10008036 473
263 3300028563 Ga0265319_1000823 Ga0265319_10008232 473
264 3300028563 Ga0265319_1015882 Ga0265319_10158822 473
265 3300028653 Ga0265323_10000011 Ga0265323_1000001173 473
266 3300028653 Ga0265323_10001389 Ga0265323_100013896 473
267 3300028654 Ga0265322_10001257 Ga0265322_100012574 473
268 3300028666 Ga0265336_10005052 Ga0265336_100050524 473
269 3300028666 Ga0265336_10005398 Ga0265336_100053982 473
270 3300028800 Ga0265338_10000513 Ga0265338_1000051321 473
271 3300028800 Ga0265338_10001238 Ga0265338_100012382 473
272 3300028800 Ga0265338_10003386 Ga0265338_100033865 473
273 3300028800 Ga0265338_10008532 Ga0265338_100085322 473
274 3300028800 Ga0265338_10017194 Ga0265338_100171944 473
275 3300028800 Ga0265338_10017259 Ga0265338_100172593 473
276 3300028800 Ga0265338_10022493 Ga0265338_100224932 473
277 3300028800 Ga0265338_10035090 Ga0265338_100350903 473
278 3300028800 Ga0265338_10044302 Ga0265338_100443021 473
279 3300029957 Ga0265324_10002939 Ga0265324_100029392 473
280 3300029957 Ga0265324_10010863 Ga0265324_100108632 473
281 3300029957 Ga0265324_10030760 Ga0265324_100307601 473
282 3300031235 Ga0265330_10004335 Ga0265330_100043352 473
283 3300031235 Ga0265330_10008330 Ga0265330_100083302 473
284 3300031240 Ga0265320_10001095 Ga0265320_1000109510 473
285 3300031240 Ga0265320_10001682 Ga0265320_1000168210 473
286 3300031240 Ga0265320_10005686 Ga0265320_100056862 473
287 3300031240 Ga0265320_10007885 Ga0265320_100078854 473
288 3300031240 Ga0265320_10011677 Ga0265320_100116774 473
289 3300031240 Ga0265320_10031260 Ga0265320_100312602 473
290 3300031240 Ga0265320_10032905 Ga0265320_100329051 473
291 3300031241 Ga0265325_10032501 Ga0265325_100325012 473
292 3300031242 Ga0265329_10003236 Ga0265329_100032364 473
293 3300031247 Ga0265340_10000287 Ga0265340_1000028728 473
294 3300031247 Ga0265340_10013745 Ga0265340_100137452 473
295 3300031249 Ga0265339_10031005 Ga0265339_100310053 473
296 3300031249 Ga0265339_10083234 Ga0265339_100832341 473
297 3300031251 Ga0265327_10000379 Ga0265327_1000037931 473
298 3300031251 Ga0265327_10019564 Ga0265327_100195641 473
299 3300031344 Ga0265316_10001121 Ga0265316_100011212 473
300 3300031344 Ga0265316_10004881 Ga0265316_1000488111 473
301 3300031344 Ga0265316_10026731 Ga0265316_100267312 473
302 3300031344 Ga0265316_10047970 Ga0265316_100479702 473
303 3300031344 Ga0265316_10100062 Ga0265316_101000622 473
304 3300031548 Ga0307408_100000007 Ga0307408_10000000798 473
305 3300031595 Ga0265313_10002081 Ga0265313_100020814 473
306 3300031595 Ga0265313_10003407 Ga0265313_100034077 473
307 3300031595 Ga0265313_10004315 Ga0265313_1000431511 473
308 3300031595 Ga0265313_10030412 Ga0265313_100304122 473
309 3300031711 Ga0265314_10006431 Ga0265314_100064316 473
310 3300031711 Ga0265314_10015296 Ga0265314_100152966 473
311 3300031711 Ga0265314_10027097 Ga0265314_100270971 473
312 3300031712 Ga0265342_10003796 Ga0265342_100037964 473
313 3300031712 Ga0265342_10004395 Ga0265342_100043953 473
314 3300031852 Ga0307410_10000001 Ga0307410_10000001103 473
315 3300031903 Ga0307407_10018781 Ga0307407_100187812 473
316 3300031995 Ga0307409_100006776 Ga0307409_1000067764 473
317 3300032002 Ga0307416_100000075 Ga0307416_10000007558 473
318 3300032004 Ga0307414_10013792 Ga0307414_100137923 473
319 3300032005 Ga0307411_10024861 Ga0307411_100248614 473
320 3300035089 Ga0373944_0000352 Ga0373944_0000352_221_1723 473
321 3300035091 Ga0373951_0009382 Ga0373951_0009382_439_1923 473
322 3300035112 Ga0373932_0000001 Ga0373932_0000001_389410_390912 473
323 3300035116 Ga0373945_0012228 Ga0373945_0012228_270_1772 473
324 3300035118 Ga0373954_0009052 Ga0373954_0009052_1752_3296 473
325 3300035242 Ga0373962_0000127 Ga0373962_0000127_13130_14632 473
326 3300035691 Ga0373931_0000004 Ga0373931_0000004_389419_390921 473
327 3300035695 Ga0373927_0056192 Ga0373927_0056192_1018_2517 473
328 3300036401 Ga0373937_0012207 Ga0373937_0012207_3079_4623 473
329 3300037068 Ga0373925_0000046 Ga0373925_0000046_44974_46476 473
330 3300037471 Ga0395905_0000036 Ga0395905_0000036_138138_139622 473
331 3300039447 Ga0436361_0762967 Ga0436361_0762967_5782_7305 473
332 3300039447 Ga0436361_0822273 Ga0436361_0822273_465_1988 473
333 3300042876 Ga0451577_0004486 Ga0451577_0004486_991_2520 473
334 3300042876 Ga0451577_0007055 Ga0451577_0007055_6073_7599 473
335 3300042876 Ga0451577_0032552 Ga0451577_0032552_1653_3182 473
336 3300042876 Ga0451577_0051276 Ga0451577_0051276_1288_2787 473
337 3300044673 Ga0453683_0000910 Ga0453683_0000910_16016_17575 473
338 3300044712 Ga0453684_0000045 Ga0453684_0000045_75168_76667 473
339 3300044712 Ga0453684_0002261 Ga0453684_0002261_1681_3210 473
340 3300044712 Ga0453684_0034358 Ga0453684_0034358_2016_3497 473
341 3300044712 Ga0453684_0066529 Ga0453684_0066529_2766_4295 473
342 3300044712 Ga0453684_0205439 Ga0453684_0205439_468_1970 473
343 3300044842 Ga0466957_0014027 Ga0466957_0014027_1204_2727 473
344 3300045051 Ga0451576_0004518 Ga0451576_0004518_6184_7725 473
345 3300045051 Ga0451576_0012547 Ga0451576_0012547_5404_6948 473
346 3300045051 Ga0451576_0013113 Ga0451576_0013113_6170_7711 473
347 3300045051 Ga0451576_0063212 Ga0451576_0063212_1214_2788 473
348 3300045051 Ga0451576_0111647 Ga0451576_0111647_459_1940 473
349 3300045836 Ga0466958_0000225 Ga0466958_0000225_15976_17499 473
350 3300046454 Ga0495592_0000071 Ga0495592_0000071_70042_71676 473
351 3300046459 Ga0495629_0037998 Ga0495629_0037998_835_2379 473
352 3300046514 Ga0495618_0011308 Ga0495618_0011308_3129_4763 473
353 3300046516 Ga0495628_0000197 Ga0495628_0000197_4553_6187 473
354 3300046517 Ga0495630_0009424 Ga0495630_0009424_3258_4892 473
355 3300046517 Ga0495630_0029760 Ga0495630_0029760_2159_3703 473
356 3300046517 Ga0495630_0045943 Ga0495630_0045943_70_1572 473
357 3300046517 Ga0495630_0145794 Ga0495630_0145794_23_1531 473
358 3300046533 Ga0495640_0028378 Ga0495640_0028378_411_2045 473
359 3300046535 Ga0495586_0000831 Ga0495586_0000831_5525_7069 473
360 3300046535 Ga0495586_0002193 Ga0495586_0002193_5506_7020 473
361 3300046535 Ga0495586_0003764 Ga0495586_0003764_3887_5521 473
362 3300046543 Ga0495645_0010263 Ga0495645_0010263_2756_4282 473
363 3300046642 Ga0495634_0011017 Ga0495634_0011017_4512_6056 473
364 3300046683 Ga0495658_0021521 Ga0495658_0021521_1387_2901 473
365 3300046683 Ga0495658_0036059 Ga0495658_0036059_395_1927 473
366 3300046683 Ga0495658_0094316 Ga0495658_0094316_104_1738 473
367 3300046689 Ga0495613_0010010 Ga0495613_0010010_3974_5488 473
368 3300049528 Ga0501312_004717 Ga0501312_004717_11_1498 473
369 3300049568 Ga0501031_0000048 Ga0501031_0000048_24292_25794 473
370 3300049568 Ga0501031_0045655 Ga0501031_0045655_1224_2705 473
371 3300049569 Ga0501032_0029723 Ga0501032_0029723_1519_3000 473
372 3300049569 Ga0501032_0042081 Ga0501032_0042081_583_2085 473
373 3300049570 Ga0501033_0011115 Ga0501033_0011115_4092_5573 473
374 3300049570 Ga0501033_0061070 Ga0501033_0061070_956_2458 473
375 3300049571 Ga0501034_0009829 Ga0501034_0009829_934_2415 473
376 3300049572 Ga0501036_0021189 Ga0501036_0021189_1556_3037 473
377 3300049574 Ga0501038_0004043 Ga0501038_0004043_10536_12017 473
378 3300049575 Ga0501039_0102176 Ga0501039_0102176_256_1737 473
379 3300049580 Ga0501046_0000709 Ga0501046_0000709_12655_14136 473
380 3300049581 Ga0501047_0012584 Ga0501047_0012584_3001_4506 473
381 3300049582 Ga0501048_0045636 Ga0501048_0045636_1587_3068 473
382 3300049744 Ga0501083_0013265 Ga0501083_0013265_2521_4002 473
383 3300049822 Ga0501035_0002195 Ga0501035_0002195_16752_18254 473
384 3300049822 Ga0501035_0065567 Ga0501035_0065567_1615_3096 473
385 3300049823 Ga0501044_0000202 Ga0501044_0000202_15801_17303 473
386 3300049823 Ga0501044_0001178 Ga0501044_0001178_11859_13361 473
387 3300049823 Ga0501044_0007964 Ga0501044_0007964_4892_6373 473
388 3300049823 Ga0501044_0026532 Ga0501044_0026532_3327_4808 473
389 3300049823 Ga0501044_0045030 Ga0501044_0045030_2677_4182 473
390 3300050508 nmdc:mga09592_66056_c1 nmdc:mga09592_66056_c1_1075_2616 473
391 3300050511 nmdc:mga08y16_19805_c1 nmdc:mga08y16_19805_c1_3823_5352 473
392 3300003856 Ga0058692_1000067 Ga0058692_10000675 474
393 3300005272 Ga0065703_1019703 Ga0065703_10197032 474
394 3300005353 Ga0070669_100001717 Ga0070669_1000017172 474
395 3300005364 Ga0070673_100038189 Ga0070673_1000381893 474
396 3300005548 Ga0070665_100016974 Ga0070665_1000169746 474
397 3300005843 Ga0068860_100000624 Ga0068860_10000062415 474
398 3300006028 Ga0070717_10000219 Ga0070717_100002194 474
399 3300009011 Ga0105251_10061649 Ga0105251_100616492 474
400 3300009036 Ga0105244_10070768 Ga0105244_100707681 474
401 3300009093 Ga0105240_10012193 Ga0105240_1001219312 474
402 3300009101 Ga0105247_10003033 Ga0105247_1000303311 474
403 3300013104 Ga0157370_10276499 Ga0157370_102764991 474
404 3300017792 Ga0163161_10125616 Ga0163161_101256163 474
405 3300025711 Ga0207696_1016723 Ga0207696_10167232 474
406 3300025728 Ga0207655_1007722 Ga0207655_10077226 474
407 3300025728 Ga0207655_1007730 Ga0207655_10077306 474
408 3300025728 Ga0207655_1011338 Ga0207655_10113384 474
409 3300025735 Ga0207713_1012682 Ga0207713_10126826 474
410 3300025735 Ga0207713_1044270 Ga0207713_10442702 474
411 3300025900 Ga0207710_10000183 Ga0207710_100001836 474
412 3300025913 Ga0207695_10065167 Ga0207695_100651675 474
413 3300025923 Ga0207681_10002292 Ga0207681_1000229212 474
414 3300025935 Ga0207709_10000158 Ga0207709_100001586 474
415 3300025960 Ga0207651_10026451 Ga0207651_100264515 474
416 3300027312 Ga0209371_1000196 Ga0209371_10001966 474
417 3300028563 Ga0265319_1008439 Ga0265319_10084393 474
418 3300028800 Ga0265338_10010711 Ga0265338_1001071112 474
419 3300030500 Ga0268256_1000158 Ga0268256_100015887 474
420 3300042876 Ga0451577_0004858 Ga0451577_0004858_1812_3302 474
421 3300044712 Ga0453684_0238912 Ga0453684_0238912_25_1515 474
422 3300045051 Ga0451576_0000042 Ga0451576_0000042_293850_295490 474
423 3300005614 Ga0068856_100160094 Ga0068856_1001600942 475
424 3300009148 Ga0105243_10000691 Ga0105243_1000069133 475
425 3300013306 Ga0163162_10000056 Ga0163162_1000005660 475
426 3300014969 Ga0157376_10018125 Ga0157376_100181255 475
427 3300014969 Ga0157376_10025775 Ga0157376_100257756 475
428 3300033180 Ga0307510_10037192 Ga0307510_100371922 475
429 3300037853 Ga0436364_0340892 Ga0436364_0340892_2865_4361 475
430 3300046471 Ga0495650_0000022 Ga0495650_0000022_418234_419760 475
431 3300046477 Ga0495664_0012580 Ga0495664_0012580_1280_2836 475
432 3300046507 Ga0495606_0041643 Ga0495606_0041643_473_1999 475
433 3300046529 Ga0495652_0093896 Ga0495652_0093896_326_1882 475
434 3300046538 Ga0495609_0017978 Ga0495609_0017978_394_1941 475
435 3300046660 Ga0495625_0106196 Ga0495625_0106196_230_1783 475
436 3300047319 Ga0495674_0001707 Ga0495674_0001707_13218_14774 475
437 3300047445 Ga0495677_0034428 Ga0495677_0034428_122_1669 475
438 3300048918 Ga0496115_0120232 Ga0496115_0120232_538_2094 475
439 3300048923 Ga0496120_0048932 Ga0496120_0048932_483_1994 475
440 3300048929 Ga0496126_0000130 Ga0496126_0000130_54451_55962 475
441 3300053093 Ga0500651_0000003 Ga0500651_0000003_200227_201753 475
442 3300053119 Ga0500595_000005 Ga0500595_000005_145786_147297 475
443 3300005339 Ga0070660_100002867 Ga0070660_10000286711 476
444 3300005366 Ga0070659_100000441 Ga0070659_10000044118 476
445 3300005455 Ga0070663_100095531 Ga0070663_1000955313 476
446 3300005539 Ga0068853_100000021 Ga0068853_10000002187 476
447 3300005578 Ga0068854_100000075 Ga0068854_10000007551 476
448 3300009093 Ga0105240_10004363 Ga0105240_1000436313 476
449 3300009093 Ga0105240_10112066 Ga0105240_101120664 476
450 3300013104 Ga0157370_10121522 Ga0157370_101215222 476
451 3300025913 Ga0207695_10131933 Ga0207695_101319331 476
452 3300025913 Ga0207695_10133277 Ga0207695_101332772 476
453 3300025919 Ga0207657_10000382 Ga0207657_1000038211 476
454 3300025949 Ga0207667_10134131 Ga0207667_101341312 476
455 3300025981 Ga0207640_10000034 Ga0207640_1000003490 476
456 3300026041 Ga0207639_10000035 Ga0207639_1000003585 476
457 3300026067 Ga0207678_10019561 Ga0207678_100195614 476
458 3300026067 Ga0207678_10029209 Ga0207678_100292093 476
459 3300028563 Ga0265319_1016168 Ga0265319_10161683 476
460 3300028577 Ga0265318_10009819 Ga0265318_100098193 476
461 3300031240 Ga0265320_10000110 Ga0265320_1000011035 476
462 3300031240 Ga0265320_10000159 Ga0265320_1000015920 476
463 3300031240 Ga0265320_10023960 Ga0265320_100239603 476
464 3300047320 Ga0495672_0004387 Ga0495672_0004387_2004_3536 476
465 3300048910 Ga0496107_0157595 Ga0496107_0157595_92_1573 476
466 3300048929 Ga0496126_0000010 Ga0496126_0000010_338173_339714 476
467 3300021384 Ga0213876_10059376 Ga0213876_100593762 477
468 3300039437 Ga0436365_0952319 Ga0436365_0952319_879_2381 477
469 iso_pu_bacteria 2551306352 2552746500 478
470 iso_pu_bacteria 2639762793 2640736524 478
471 iso_pu_bacteria 2643221665 2644364737 478
472 iso_pu_bacteria 2675903507 2678229743 478
473 iso_pu_bacteria 2744054655 2745160379 478
474 iso_pu_bacteria 2773857761 2774391437 478
475 iso_pu_bacteria 2773857770 2774436172 478
476 iso_pu_bacteria 2916699645 2916700367 478
477 iso_pu_bacteria 2919182534 2919185157 478
478 iso_pu_bacteria 2919506607 2919509152 478
479 iso_pu_bacteria 2928515477 2928517156 478
480 iso_pu_bacteria 2984568884 2984571125 478
481 iso_pu_bacteria 8033232454 8033233287 478
482 3300035398 Ga0316574_0066272 Ga0316574_0066272_670_2157 480
483 iso_pu_bacteria 2747842501 2748017384 486
484 iso_pu_bacteria 2894414249 2894417067 486
485 iso_pu_bacteria 2919513703 2919515642 486
486 iso_pu_bacteria 2919675420 2919678360 486
487 iso_pu_bacteria 2941489479 2941492527 487
488 iso_pu_bacteria 2995948881 2995949811 487
489 3300031728 Ga0316578_10009548 Ga0316578_100095483 488
490 3300031728 Ga0316578_10075724 Ga0316578_100757241 488
491 3300031733 Ga0316577_10014855 Ga0316577_100148553 488
492 3300031733 Ga0316577_10024593 Ga0316577_100245932 488
493 3300032004 Ga0307414_10021368 Ga0307414_100213683 488
494 3300032168 Ga0316593_10005984 Ga0316593_100059842 488
495 3300036647 Ga0316582_0008202 Ga0316582_0008202_494_1981 488
496 3300036647 Ga0316582_0021577 Ga0316582_0021577_1392_2879 488
497 3300036712 Ga0316584_0018669 Ga0316584_0018669_2501_3988 488
498 3300037588 Ga0316581_0005119 Ga0316581_0005119_1734_3221 488
499 3300037588 Ga0316581_0020092 Ga0316581_0020092_267_1754 488
500 3300049576 Ga0501040_0000006 Ga0501040_0000006_14935_16422 488
501 3300049578 Ga0501042_0000196 Ga0501042_0000196_4194_5681 488
502 iso_pu_bacteria 8003014200 8003015320 488
503 3300025299 Ga0209256_1005945 Ga0209256_10059455 489
504 3300025304 Ga0209257_1005348 Ga0209257_10053487 489
505 3300031824 Ga0307413_10001038 Ga0307413_100010384 489
506 3300032133 Ga0316583_10002756 Ga0316583_100027565 489
507 3300044712 Ga0453684_0045609 Ga0453684_0045609_272_1762 489
508 3300049578 Ga0501042_0003131 Ga0501042_0003131_6779_8272 489
509 3300027682 Ga0209971_1012770 Ga0209971_10127701 490
510 3300027876 Ga0209974_10008828 Ga0209974_100088283 490
511 3300031665 Ga0316575_10001135 Ga0316575_100011352 490
512 3300049571 Ga0501034_0006635 Ga0501034_0006635_7627_9102 490
513 3300050491 nmdc:mga00v17_95797_c1 nmdc:mga00v17_95797_c1_227_1711 490
514 iso_pu_bacteria 2524614729 2525558224 490
515 iso_pu_bacteria 2627854209 2630650212 490
516 3300003771 Ga0055526_1000005 Ga0055526_1000005147 491
517 3300003773 Ga0055537_1000026 Ga0055537_100002661 491
518 3300003773 Ga0055537_1000048 Ga0055537_100004819 491
519 3300003775 Ga0055524_1000005 Ga0055524_1000005148 491
520 3300003784 Ga0055534_1000002 Ga0055534_1000002181 491
521 3300003790 Ga0055528_1000002 Ga0055528_1000002181 491
522 3300005334 Ga0068869_100112942 Ga0068869_1001129421 491
523 3300005367 Ga0070667_100086867 Ga0070667_1000868672 491
524 3300009093 Ga0105240_10005743 Ga0105240_1000574310 491
525 3300009177 Ga0105248_10125505 Ga0105248_101255052 491
526 3300013308 Ga0157375_10001924 Ga0157375_100019246 491
527 3300015689 Ga0183360_10001 Ga0183360_100013224 491
528 3300025263 Ga0209565_1000001 Ga0209565_1000001632 491
529 3300025273 Ga0209673_1000001 Ga0209673_1000001632 491
530 3300025291 Ga0209675_1000001 Ga0209675_10000011900 491
531 3300025295 Ga0209564_1000001 Ga0209564_10000012062 491
532 3300025299 Ga0209256_1000006 Ga0209256_1000006498 491
533 3300025913 Ga0207695_10007769 Ga0207695_100077695 491
534 3300025941 Ga0207711_10002794 Ga0207711_100027942 491
535 3300025986 Ga0207658_10132471 Ga0207658_101324712 491
536 3300031901 Ga0307406_10039435 Ga0307406_100394351 491
537 3300048924 Ga0496121_0064406 Ga0496121_0064406_144_1619 491
538 iso_pu_bacteria 2643221573 2643880662 492
539 iso_pu_bacteria 2643221720 2644661233 492
540 iso_pu_bacteria 2643221728 2644699310 492
541 iso_pu_bacteria 2571042365 2572254926 493
542 iso_pu_bacteria 2643221695 2644530646 493
543 3300027617 Ga0210002_1006122 Ga0210002_10061221 495
544 3300003187 JGI25151J46595_10000646 JGI25151J46595_1000064624 496
545 3300030745 Ga0316182_1288804 Ga0316182_12888042 496
546 3300031548 Ga0307408_100040395 Ga0307408_1000403951 496
547 3300041407 Ga0439447_005890 Ga0439447_005890_739_2229 496
548 3300047318 Ga0495636_0005137 Ga0495636_0005137_2399_3892 496

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00425

Chorismate_bind

chorismate binding enzyme

281

535

0.99

PF04715

Anth_synt_I_N

Anthranilate synthase component I, N terminal region

28

225

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qu9-assembly2.cif.gz_B structure of aminodeoxychorismate synthase component 1 (pabb) from bacillus subtilis spizizenii. 0.9402 17 492
7qu9-assembly2.cif.gz_B structure of aminodeoxychorismate synthase component 1 (pabb) from bacillus subtilis spizizenii. 0.9321 17 492
7qu9-assembly1.cif.gz_A structure of aminodeoxychorismate synthase component 1 (pabb) from bacillus subtilis spizizenii. 0.9298 17 492
7qu9-assembly1.cif.gz_A structure of aminodeoxychorismate synthase component 1 (pabb) from bacillus subtilis spizizenii. 0.9239 17 492
1qdl-assembly1.cif.gz_A-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9226 20 489
ID Description Score Start End Superfamily
af_O94582_1_484_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.9519 3 493 3.60.120.10
af_O94582_1_484_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.9289 3 493 3.60.120.10
1qdlA00 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.9204 20 489 3.60.120.10
af_A0A1D6LA98_50_603_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.913 4 494 3.60.120.10
1qdlA00 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.9118 20 489 3.60.120.10
ID Description Score Start End GO Terms
AF-D2XTK3-F1-model_v4 Anthranilate synthase component I (EC 4.1.3.27) 0.9966 291 409 GO:0000162
GO:0004049
GO:0046872
AF-A0A699Q9B5-F1-model_v4 Anthranilate synthase component 0.9953 294 402 GO:0000162
GO:0016829
GO:0046872
AF-A0A536KTT7-F1-model_v4 Anthranilate synthase component I family protein 0.9919 262 493 GO:0000162
AF-A0A5K1HRI4-F1-model_v4 Chorismate-utilising enzyme C-terminal domain-containing protein 0.9894 315 492 GO:0000162
GO:0016829
GO:0046872
AF-A0A1R0WMP0-F1-model_v4 deleted 0.988 260 493

Feature Viewer

pLDDT pTM Quality
92 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map