F462245

General Info

Members Datasets Scaffolds Average Seq Length
548 225 548 102

Family's Representative Sequence

Representative Sequence 3300035085|Ga0373929_0000348|Ga0373929_0000348_7077_7427
Length 116
Sequence VNPDLFLQLDRVIHEKGRLAIMSMLAASPELSFTELRDALAMTDGNLTTHIRALQEEGFVAVAKSYQNKRPLTTCSLTAGGRKAFAEYIALLEQIVRQNKPPAVFYFVVQSINDKS

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
112 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
113 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
116 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
133 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
134 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
135 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
136 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
137 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
138 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 0.73
Rhizosphere 98.36
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10251543 3300003320 Bacteria 1530
2 Ga0070658_10211947 3300005327 Unclassified 1637
3 Ga0070658_10768592 3300005327 Unclassified 837
4 Ga0070690_100002129 3300005330 Bacteria 10577
5 Ga0068869_100568915 3300005334 Unclassified 954
6 Ga0070680_101444077 3300005336 Bacteria 596
7 Ga0068868_100497576 3300005338 Unclassified 1067
8 Ga0070689_100099838 3300005340 Unclassified 2296
9 Ga0070691_10849526 3300005341 Bacteria 559
10 Ga0070687_100014296 3300005343 Bacteria 3564
11 Ga0070687_101255270 3300005343 Unclassified 548
12 Ga0070688_100719582 3300005365 Bacteria 775
13 Ga0070714_100001033 3300005435 Bacteria 19833
14 Ga0070714_100310679 3300005435 Unclassified 1472
15 Ga0070713_100022832 3300005436 Bacteria 4842
16 Ga0070713_100918936 3300005436 Unclassified 842
17 Ga0070713_101204219 3300005436 Unclassified 733
18 Ga0070710_10877641 3300005437 Unclassified 646
19 Ga0070711_100001133 3300005439 Bacteria 14260
20 Ga0070711_100944116 3300005439 Bacteria 738
21 Ga0070711_101078968 3300005439 Unclassified 691
22 Ga0070700_101353651 3300005441 Unclassified 600
23 Ga0070708_100168828 3300005445 Unclassified 2041
24 Ga0070681_10054505 3300005458 Unclassified 3985
25 Ga0070681_10098707 3300005458 Bacteria 2867
26 Ga0070685_11022475 3300005466 Unclassified 621
27 Ga0070706_101393449 3300005467 Unclassified 642
28 Ga0070679_100111731 3300005530 Bacteria 2719
29 Ga0070679_100384124 3300005530 Unclassified 1351
30 Ga0070684_101023586 3300005535 Bacteria 775
31 Ga0068853_101588407 3300005539 Bacteria 634
32 Ga0070686_101160828 3300005544 Unclassified 640
33 Ga0070693_100340851 3300005547 Unclassified 1023
34 Ga0068855_100030384 3300005563 Bacteria 6463
35 Ga0068855_100081250 3300005563 Unclassified 3757
36 Ga0068855_100095627 3300005563 Unclassified 3424
37 Ga0068855_100688857 3300005563 Bacteria 1095
38 Ga0068855_100721559 3300005563 Unclassified 1065
39 Ga0068855_100886038 3300005563 Bacteria 943
40 Ga0068857_100051795 3300005577 Unclassified 3643
41 Ga0068857_101596636 3300005577 Unclassified 637
42 Ga0068854_101421372 3300005578 Bacteria 628
43 Ga0068856_100000017 3300005614 Bacteria 154589
44 Ga0068856_100017053 3300005614 Bacteria 7040
45 Ga0068856_100978463 3300005614 Bacteria 865
46 Ga0068856_101573793 3300005614 Unclassified 671
47 Ga0068856_101968084 3300005614 Bacteria 595
48 Ga0068856_102651687 3300005614 Unclassified 507
49 Ga0070702_100047054 3300005615 Unclassified 2448
50 Ga0068859_100133363 3300005617 Bacteria 2556
51 Ga0068859_100705960 3300005617 Bacteria 1099
52 Ga0068859_100736603 3300005617 Bacteria 1075
53 Ga0068859_101426724 3300005617 Bacteria 764
54 Ga0068859_101621239 3300005617 Unclassified 715
55 Ga0068859_102867031 3300005617 Unclassified 528
56 Ga0068864_100635560 3300005618 Unclassified 1038
57 Ga0068866_10035949 3300005718 Unclassified 2423
58 Ga0068851_10125965 3300005834 Bacteria 1381
59 Ga0068863_100220329 3300005841 Bacteria 1828
60 Ga0068863_100334151 3300005841 Bacteria 1473
61 Ga0068863_100771218 3300005841 Unclassified 958
62 Ga0068858_100466842 3300005842 Bacteria 1217
63 Ga0068858_100572382 3300005842 Unclassified 1094
64 Ga0068858_101740071 3300005842 Bacteria 616
65 Ga0070715_10180916 3300006163 Bacteria 1057
66 Ga0070712_100729529 3300006175 Unclassified 847
67 Ga0097621_100053105 3300006237 Bacteria 3303
68 Ga0097621_100534904 3300006237 Unclassified 1065
69 Ga0097621_100535535 3300006237 Bacteria 1065
70 Ga0097621_100687658 3300006237 Bacteria 941
71 Ga0097621_101064026 3300006237 Unclassified 758
72 Ga0068871_100049844 3300006358 Bacteria 3386
73 Ga0068871_100234696 3300006358 Unclassified 1593
74 Ga0068871_100272728 3300006358 Bacteria 1478
75 Ga0068871_100615568 3300006358 Bacteria 989
76 Ga0075428_100904884 3300006844 Archaea 936
77 Ga0075431_100070025 3300006847 Archaea 3619
78 Ga0075434_100447965 3300006871 Bacteria 1312
79 Ga0075429_100337453 3300006880 Archaea 1319
80 Ga0068865_100274295 3300006881 Unclassified 1340
81 Ga0075436_100648059 3300006914 Unclassified 780
82 Ga0097620_100133369 3300006931 Bacteria 2556
83 Ga0097620_100705935 3300006931 Bacteria 1099
84 Ga0097620_100736655 3300006931 Bacteria 1075
85 Ga0097620_101426800 3300006931 Bacteria 764
86 Ga0097620_101621172 3300006931 Unclassified 715
87 Ga0097620_102867029 3300006931 Unclassified 528
88 Ga0075435_100568981 3300007076 Unclassified 982
89 Ga0075435_101511504 3300007076 Bacteria 589
90 Ga0105240_10048613 3300009093 Bacteria 5360
91 Ga0105240_10147342 3300009093 Bacteria 2807
92 Ga0105240_10247869 3300009093 Bacteria 2062
93 Ga0105240_10324523 3300009093 Bacteria 1754
94 Ga0105240_10501278 3300009093 Bacteria 1350
95 Ga0105240_10784319 3300009093 Unclassified 1033
96 Ga0105240_10887825 3300009093 Bacteria 960
97 Ga0111539_10112968 3300009094 Unclassified 3186
98 Ga0111539_10823064 3300009094 Unclassified 1080
99 Ga0105245_10132000 3300009098 Unclassified 2344
100 Ga0105245_10952583 3300009098 Unclassified 901
101 Ga0114129_12940037 3300009147 Unclassified 562
102 Ga0105241_10861740 3300009174 Bacteria 839
103 Ga0105242_10121585 3300009176 Unclassified 2242
104 Ga0105248_10546754 3300009177 Bacteria 1306
105 Ga0105248_10821664 3300009177 Bacteria 1049
106 Ga0105248_10889663 3300009177 Bacteria 1005
107 Ga0105248_11021961 3300009177 Bacteria 934
108 Ga0105248_12539012 3300009177 Unclassified 584
109 Ga0105248_13220435 3300009177 Unclassified 519
110 Ga0105237_10935361 3300009545 Unclassified 874
111 Ga0105237_12053638 3300009545 Unclassified 580
112 Ga0105238_10017171 3300009551 Bacteria 7349
113 Ga0105238_10039954 3300009551 Bacteria 4755
114 Ga0105238_10054936 3300009551 Bacteria 3999
115 Ga0105238_10158439 3300009551 Unclassified 2239
116 Ga0105238_11178361 3300009551 Unclassified 790
117 Ga0105238_11349338 3300009551 Bacteria 740
118 Ga0105249_11947881 3300009553 Unclassified 660
119 Ga0105239_12652995 3300010375 Unclassified 584
120 Ga0105246_10253222 3300011119 Unclassified 1399
121 Ga0105246_12232882 3300011119 Unclassified 533
122 Ga0157370_10291479 3300013104 Unclassified 1507
123 Ga0157369_10814740 3300013105 Bacteria 959
124 Ga0157374_10101521 3300013296 Bacteria 2758
125 Ga0157374_10574304 3300013296 Unclassified 1136
126 Ga0157374_10649577 3300013296 Bacteria 1067
127 Ga0157374_10794599 3300013296 Bacteria 962
128 Ga0157374_11537911 3300013296 Bacteria 689
129 Ga0157374_11628977 3300013296 Unclassified 670
130 Ga0157378_11162158 3300013297 Bacteria 810
131 Ga0163162_11039653 3300013306 Unclassified 927
132 Ga0163162_12747317 3300013306 Unclassified 567
133 Ga0163162_12826550 3300013306 Bacteria 559
134 Ga0163162_13006015 3300013306 Bacteria 542
135 Ga0157372_10409459 3300013307 Bacteria 1580
136 Ga0157372_11107833 3300013307 Unclassified 916
137 Ga0157372_11604449 3300013307 Bacteria 749
138 Ga0157375_10042780 3300013308 Bacteria 4387
139 Ga0157375_10420412 3300013308 Bacteria 1503
140 Ga0157375_10610364 3300013308 Unclassified 1249
141 Ga0163163_10000010 3300014325 Bacteria 264773
142 Ga0163163_10133090 3300014325 Unclassified 2527
143 Ga0163163_10822775 3300014325 Bacteria 992
144 Ga0157380_11743477 3300014326 Bacteria 681
145 Ga0157377_10652579 3300014745 Bacteria 758
146 Ga0157379_10702592 3300014968 Bacteria 949
147 Ga0157376_10363863 3300014969 Bacteria 1388
148 Ga0157376_11588487 3300014969 Unclassified 688
149 Ga0207656_10349333 3300025321 Bacteria 738
150 Ga0207692_10461127 3300025898 Unclassified 801
151 Ga0207699_11143049 3300025906 Bacteria 577
152 Ga0207699_11414192 3300025906 Unclassified 515
153 Ga0207705_10504898 3300025909 Bacteria 939
154 Ga0207707_10245369 3300025912 Bacteria 1556
155 Ga0207707_10281890 3300025912 Unclassified 1439
156 Ga0207695_10059235 3300025913 Bacteria 3972
157 Ga0207695_10083854 3300025913 Bacteria 3219
158 Ga0207695_10096397 3300025913 Unclassified 2960
159 Ga0207671_11572106 3300025914 Unclassified 506
160 Ga0207693_10255937 3300025915 Unclassified 1373
161 Ga0207693_10617418 3300025915 Unclassified 843
162 Ga0207663_10009822 3300025916 Bacteria 5064
163 Ga0207662_10054301 3300025918 Unclassified 2389
164 Ga0207662_10785284 3300025918 Unclassified 671
165 Ga0207652_10592950 3300025921 Unclassified 994
166 Ga0207646_11411551 3300025922 Unclassified 605
167 Ga0207694_10003771 3300025924 Bacteria 12004
168 Ga0207694_10009450 3300025924 Bacteria 7349
169 Ga0207694_10058365 3300025924 Bacteria 3001
170 Ga0207694_10105331 3300025924 Unclassified 2239
171 Ga0207659_10658745 3300025926 Unclassified 895
172 Ga0207700_11742558 3300025928 Bacteria 549
173 Ga0207700_11775799 3300025928 Unclassified 543
174 Ga0207664_10000746 3300025929 Bacteria 22125
175 Ga0207706_10729885 3300025933 Bacteria 845
176 Ga0207686_10398525 3300025934 Unclassified 1048
177 Ga0207670_10047403 3300025936 Unclassified 2862
178 Ga0207704_10549061 3300025938 Unclassified 939
179 Ga0207711_11427100 3300025941 Unclassified 635
180 Ga0207689_10497059 3300025942 Unclassified 1022
181 Ga0207667_10044512 3300025949 Unclassified 4703
182 Ga0207667_10431843 3300025949 Unclassified 1339
183 Ga0207667_10475744 3300025949 Bacteria 1268
184 Ga0207667_10602266 3300025949 Bacteria 1108
185 Ga0207667_10641948 3300025949 Unclassified 1068
186 Ga0207651_12035064 3300025960 Unclassified 516
187 Ga0207712_10449765 3300025961 Bacteria 1092
188 Ga0207703_10257118 3300026035 Unclassified 1577
189 Ga0207703_10431479 3300026035 Bacteria 1228
190 Ga0207708_10203692 3300026075 Bacteria 1579
191 Ga0207702_10000630 3300026078 Bacteria 38742
192 Ga0207702_10011100 3300026078 Bacteria 7519
193 Ga0207702_10196051 3300026078 Bacteria 1869
194 Ga0207702_10388237 3300026078 Unclassified 1344
195 Ga0207641_11305506 3300026088 Bacteria 726
196 Ga0207648_10147735 3300026089 Unclassified 2074
197 Ga0207676_10498592 3300026095 Bacteria 1156
198 Ga0207674_10065691 3300026116 Unclassified 3656
199 Ga0207428_10735596 3300027907 Unclassified 704
200 Ga0268265_10851376 3300028380 Unclassified 892
201 Ga0265337_1000210 3300028556 Bacteria 31339
202 Ga0265337_1001805 3300028556 Bacteria 10278
203 Ga0265337_1004707 3300028556 Bacteria 5607
204 Ga0265337_1004917 3300028556 Bacteria 5440
205 Ga0265337_1006396 3300028556 Bacteria 4551
206 Ga0265337_1008070 3300028556 Unclassified 3868
207 Ga0265337_1053246 3300028556 Bacteria 1135
208 Ga0265326_10000722 3300028558 Bacteria 12193
209 Ga0265326_10009025 3300028558 Unclassified 2987
210 Ga0265326_10023695 3300028558 Unclassified 1754
211 Ga0265326_10037819 3300028558 Bacteria 1372
212 Ga0265326_10041600 3300028558 Bacteria 1305
213 Ga0265319_1031529 3300028563 Unclassified 1845
214 Ga0265319_1066093 3300028563 Bacteria 1165
215 Ga0265334_10013593 3300028573 Unclassified 3406
216 Ga0265334_10019726 3300028573 Unclassified 2769
217 Ga0265334_10154527 3300028573 Unclassified 808
218 Ga0265334_10311898 3300028573 Unclassified 538
219 Ga0265318_10009290 3300028577 Unclassified 4331
220 Ga0265318_10031152 3300028577 Bacteria 2070
221 Ga0265318_10084650 3300028577 Bacteria 1169
222 Ga0265323_10000312 3300028653 Bacteria 28043
223 Ga0265323_10016950 3300028653 Unclassified 2837
224 Ga0265323_10028204 3300028653 Bacteria 2106
225 Ga0265323_10054921 3300028653 Bacteria 1402
226 Ga0265323_10090757 3300028653 Bacteria 1021
227 Ga0265323_10131820 3300028653 Bacteria 809
228 Ga0265322_10032669 3300028654 Unclassified 1484
229 Ga0265322_10033400 3300028654 Bacteria 1467
230 Ga0265322_10055438 3300028654 Bacteria 1124
231 Ga0265322_10062552 3300028654 Unclassified 1056
232 Ga0265322_10068535 3300028654 Bacteria 1006
233 Ga0265336_10002219 3300028666 Bacteria 8163
234 Ga0265336_10004034 3300028666 Bacteria 5595
235 Ga0265336_10013027 3300028666 Bacteria 2782
236 Ga0265336_10023395 3300028666 Bacteria 1959
237 Ga0265336_10091841 3300028666 Unclassified 905
238 Ga0265338_10000160 3300028800 Bacteria 122713
239 Ga0265338_10000310 3300028800 Bacteria 88170
240 Ga0265338_10000433 3300028800 Bacteria 75181
241 Ga0265338_10000626 3300028800 Bacteria 61483
242 Ga0265338_10000988 3300028800 Bacteria 47929
243 Ga0265338_10001793 3300028800 Bacteria 33791
244 Ga0265338_10002328 3300028800 Bacteria 28735
245 Ga0265338_10009937 3300028800 Bacteria 11248
246 Ga0265338_10014917 3300028800 Bacteria 8592
247 Ga0265338_10015696 3300028800 Bacteria 8300
248 Ga0265338_10020032 3300028800 Bacteria 7056
249 Ga0265338_10020503 3300028800 Bacteria 6949
250 Ga0265338_10030959 3300028800 Bacteria 5256
251 Ga0265338_10040841 3300028800 Unclassified 4350
252 Ga0265338_10052738 3300028800 Bacteria 3646
253 Ga0265338_10056915 3300028800 Bacteria 3463
254 Ga0265338_10065623 3300028800 Bacteria 3147
255 Ga0265338_10090678 3300028800 Unclassified 2529
256 Ga0265338_10160436 3300028800 Unclassified 1737
257 Ga0265338_10161091 3300028800 Bacteria 1733
258 Ga0265338_10164231 3300028800 Bacteria 1711
259 Ga0265338_10246153 3300028800 Unclassified 1321
260 Ga0265338_10319209 3300028800 Unclassified 1125
261 Ga0265338_10367945 3300028800 Bacteria 1030
262 Ga0265338_10403627 3300028800 Unclassified 974
263 Ga0265338_10520859 3300028800 Unclassified 835
264 Ga0265338_10603714 3300028800 Unclassified 764
265 Ga0265324_10000170 3300029957 Bacteria 50529
266 Ga0265324_10000403 3300029957 Bacteria 31109
267 Ga0265324_10022337 3300029957 Unclassified 2262
268 Ga0265324_10032028 3300029957 Unclassified 1839
269 Ga0265324_10039022 3300029957 Bacteria 1647
270 Ga0265324_10039117 3300029957 Bacteria 1644
271 Ga0265324_10119079 3300029957 Bacteria 897
272 Ga0265324_10145797 3300029957 Bacteria 804
273 Ga0307511_10152622 3300030521 Bacteria 1321
274 Ga0265330_10187486 3300031235 Unclassified 876
275 Ga0265332_10018121 3300031238 Unclassified 3105
276 Ga0265320_10000886 3300031240 Bacteria 22561
277 Ga0265320_10001914 3300031240 Bacteria 14713
278 Ga0265320_10007127 3300031240 Bacteria 6970
279 Ga0265320_10014563 3300031240 Bacteria 4471
280 Ga0265320_10018983 3300031240 Bacteria 3770
281 Ga0265320_10061198 3300031240 Unclassified 1795
282 Ga0265320_10207035 3300031240 Bacteria 875
283 Ga0265320_10279899 3300031240 Unclassified 739
284 Ga0265320_10315754 3300031240 Bacteria 691
285 Ga0265320_10487271 3300031240 Unclassified 544
286 Ga0265325_10017329 3300031241 Bacteria 4006
287 Ga0265325_10019440 3300031241 Bacteria 3754
288 Ga0265325_10048881 3300031241 Bacteria 2184
289 Ga0265325_10053350 3300031241 Unclassified 2073
290 Ga0265325_10220027 3300031241 Bacteria 869
291 Ga0265340_10000209 3300031247 Bacteria 29637
292 Ga0265340_10018649 3300031247 Unclassified 3578
293 Ga0265340_10131792 3300031247 Bacteria 1146
294 Ga0265340_10303458 3300031247 Bacteria 708
295 Ga0265339_10032070 3300031249 Bacteria 2965
296 Ga0265339_10038991 3300031249 Bacteria 2647
297 Ga0265339_10448231 3300031249 Unclassified 599
298 Ga0265339_10458740 3300031249 Bacteria 591
299 Ga0265339_10588681 3300031249 Bacteria 510
300 Ga0265331_10399138 3300031250 Bacteria 617
301 Ga0265327_10010372 3300031251 Bacteria 6561
302 Ga0265327_10038719 3300031251 Bacteria 2598
303 Ga0265327_10070581 3300031251 Bacteria 1750
304 Ga0265316_10023093 3300031344 Bacteria 5229
305 Ga0265316_10049083 3300031344 Bacteria 3326
306 Ga0265316_10073158 3300031344 Unclassified 2640
307 Ga0265316_10116873 3300031344 Bacteria 2016
308 Ga0265316_10178126 3300031344 Bacteria 1583
309 Ga0265316_10245663 3300031344 Unclassified 1315
310 Ga0265316_10335651 3300031344 Bacteria 1096
311 Ga0265316_10414104 3300031344 Bacteria 969
312 Ga0265316_10845954 3300031344 Bacteria 640
313 Ga0265316_10851179 3300031344 Unclassified 638
314 Ga0265316_10997165 3300031344 Unclassified 583
315 Ga0265313_10003416 3300031595 Bacteria 12863
316 Ga0265313_10439808 3300031595 Bacteria 508
317 Ga0265314_10007829 3300031711 Bacteria 9232
318 Ga0265314_10018966 3300031711 Bacteria 5338
319 Ga0265314_10031202 3300031711 Unclassified 3937
320 Ga0265314_10098494 3300031711 Bacteria 1886
321 Ga0265314_10296348 3300031711 Bacteria 909
322 Ga0265314_10330187 3300031711 Unclassified 846
323 Ga0265314_10331276 3300031711 Unclassified 844
324 Ga0265314_10503947 3300031711 Unclassified 637
325 Ga0265342_10020872 3300031712 Unclassified 4191
326 Ga0265342_10133485 3300031712 Unclassified 1389
327 Ga0265342_10174611 3300031712 Bacteria 1180
328 Ga0265342_10399182 3300031712 Bacteria 710
329 Ga0316576_10727874 3300031727 Bacteria 718
330 Ga0316578_10080391 3300031728 Bacteria 1939
331 Ga0307516_10608913 3300031730 Bacteria 747
332 Ga0373930_0001337 3300034816 Bacteria 3634
333 Ga0373950_0016686 3300034818 Bacteria 1258
334 Ga0373938_0026708 3300034957 Bacteria 1210
335 Ga0373926_0256861 3300035083 Unclassified 678
336 Ga0373926_0336500 3300035083 Unclassified 592
337 Ga0373928_0000009 3300035084 Bacteria 32800
338 Ga0373929_0000348 3300035085 Bacteria 8656
339 Ga0373929_0209622 3300035085 Unclassified 550
340 Ga0373944_0000137 3300035089 Bacteria 14088
341 Ga0373944_0255063 3300035089 Bacteria 648
342 Ga0373949_0003669 3300035090 Bacteria 3604
343 Ga0373951_0062769 3300035091 Unclassified 933
344 Ga0373952_0258297 3300035092 Unclassified 530
345 Ga0373932_0000001 3300035112 Bacteria 1459067
346 Ga0373941_0129099 3300035115 Unclassified 909
347 Ga0373945_0015480 3300035116 Bacteria 2567
348 Ga0373953_0158812 3300035117 Unclassified 971
349 Ga0373953_0161213 3300035117 Unclassified 964
350 Ga0373954_0072278 3300035118 Bacteria 1640
351 Ga0373954_0163539 3300035118 Bacteria 1089
352 Ga0373954_0631578 3300035118 Unclassified 531
353 Ga0373956_0003802 3300035119 Bacteria 6067
354 Ga0373956_0135670 3300035119 Bacteria 1154
355 Ga0373956_0522807 3300035119 Unclassified 566
356 Ga0373943_0194441 3300035170 Bacteria 1120
357 Ga0373943_0688763 3300035170 Unclassified 605
358 Ga0373955_0223979 3300035172 Bacteria 1124
359 Ga0373962_0000056 3300035242 Bacteria 24939
360 Ga0373924_0133121 3300035410 Bacteria 1082
361 Ga0373931_0000002 3300035691 Bacteria 599830
362 Ga0373931_0328930 3300035691 Bacteria 951
363 Ga0373931_0432954 3300035691 Bacteria 838
364 Ga0373935_0011690 3300035692 Bacteria 5272
365 Ga0373935_0050915 3300035692 Bacteria 2629
366 Ga0373935_0701539 3300035692 Unclassified 744
367 Ga0373935_0910877 3300035692 Unclassified 651
368 Ga0373927_0004818 3300035695 Bacteria 9381
369 Ga0373927_0056614 3300035695 Bacteria 2535
370 Ga0373933_0105459 3300035724 Unclassified 1753
371 Ga0373933_0667897 3300035724 Bacteria 683
372 Ga0373933_0681547 3300035724 Bacteria 676
373 Ga0373947_0009161 3300035725 Bacteria 5691
374 Ga0373947_0123677 3300035725 Bacteria 1645
375 Ga0373947_0298002 3300035725 Bacteria 1075
376 Ga0373947_0448265 3300035725 Unclassified 874
377 Ga0373947_0872150 3300035725 Unclassified 614
378 Ga0373937_0000659 3300036401 Bacteria 30219
379 Ga0373937_0326662 3300036401 Bacteria 1452
380 Ga0373937_0808742 3300036401 Bacteria 885
381 Ga0373937_1013910 3300036401 Bacteria 779
382 Ga0373937_1250376 3300036401 Unclassified 691
383 Ga0373937_1458015 3300036401 Bacteria 632
384 Ga0316582_0563628 3300036647 Bacteria 785
385 Ga0316584_1155434 3300036712 Unclassified 512
386 Ga0373925_0000121 3300037068 Bacteria 84624
387 Ga0373925_0001575 3300037068 Bacteria 19287
388 Ga0373925_0003106 3300037068 Bacteria 13030
389 Ga0373925_1214742 3300037068 Unclassified 619
390 Ga0395900_0089607 3300037418 Unclassified 3162
391 Ga0395905_0012307 3300037471 Bacteria 8236
392 Ga0451804_0589685 3300041463 Unclassified 680
393 Ga0451577_0001517 3300042876 Bacteria 30610
394 Ga0451577_0008776 3300042876 Bacteria 9798
395 Ga0451577_0015292 3300042876 Bacteria 7141
396 Ga0451577_0098140 3300042876 Bacteria 2617
397 Ga0451577_1393957 3300042876 Unclassified 622
398 Ga0453683_0148599 3300044673 Unclassified 1480
399 Ga0453683_0287262 3300044673 Unclassified 1051
400 Ga0466966_0105170 3300044684 Bacteria 1743
401 Ga0453684_0010898 3300044712 Bacteria 15393
402 Ga0453684_0049879 3300044712 Bacteria 5511
403 Ga0453684_0113559 3300044712 Bacteria 3285
404 Ga0453684_0269000 3300044712 Bacteria 1949
405 Ga0453684_0303559 3300044712 Bacteria 1814
406 Ga0453684_0670742 3300044712 Bacteria 1129
407 Ga0453684_0887320 3300044712 Bacteria 956
408 Ga0451576_0065865 3300045051 Unclassified 3772
409 Ga0451576_0074318 3300045051 Bacteria 3537
410 Ga0451576_0076812 3300045051 Unclassified 3476
411 Ga0451576_0198541 3300045051 Unclassified 2095
412 Ga0451576_0398633 3300045051 Unclassified 1443
413 Ga0451576_0415804 3300045051 Unclassified 1411
414 Ga0451576_0455047 3300045051 Unclassified 1344
415 Ga0451576_0704040 3300045051 Bacteria 1061
416 Ga0451576_0721477 3300045051 Bacteria 1047
417 Ga0451576_0851743 3300045051 Unclassified 957
418 Ga0451576_1081953 3300045051 Bacteria 839
419 Ga0451576_1471604 3300045051 Bacteria 708
420 Ga0451576_2051095 3300045051 Unclassified 589
421 Ga0451576_2575901 3300045051 Unclassified 519
422 Ga0495592_0000087 3300046454 Bacteria 81851
423 Ga0495592_0069909 3300046454 Bacteria 2559
424 Ga0495592_0247569 3300046454 Unclassified 1180
425 Ga0495629_0166802 3300046459 Unclassified 1529
426 Ga0495653_0561959 3300046463 Bacteria 705
427 Ga0495582_0015399 3300046473 Unclassified 4201
428 Ga0495639_0413466 3300046475 Unclassified 682
429 Ga0495639_0475857 3300046475 Unclassified 636
430 Ga0495662_0109798 3300046476 Bacteria 1351
431 Ga0495662_0249652 3300046476 Unclassified 874
432 Ga0495662_0287043 3300046476 Unclassified 810
433 Ga0495664_0290587 3300046477 Unclassified 987
434 Ga0495664_0641137 3300046477 Bacteria 630
435 Ga0495594_0806493 3300046499 Unclassified 529
436 Ga0495608_0223523 3300046511 Unclassified 1180
437 Ga0495608_0549137 3300046511 Bacteria 696
438 Ga0495618_0000575 3300046514 Bacteria 26127
439 Ga0495618_0001019 3300046514 Bacteria 19204
440 Ga0495618_0778831 3300046514 Unclassified 558
441 Ga0495628_0000056 3300046516 Bacteria 89432
442 Ga0495628_0330479 3300046516 Unclassified 1123
443 Ga0495628_0448802 3300046516 Bacteria 937
444 Ga0495628_0855126 3300046516 Bacteria 634
445 Ga0495630_0000226 3300046517 Bacteria 44816
446 Ga0495630_0016036 3300046517 Bacteria 5476
447 Ga0495630_0033929 3300046517 Bacteria 3807
448 Ga0495630_0481629 3300046517 Unclassified 951
449 Ga0495630_0498982 3300046517 Bacteria 933
450 Ga0495630_1205283 3300046517 Unclassified 572
451 Ga0495630_1217769 3300046517 Unclassified 569
452 Ga0495630_1431256 3300046517 Unclassified 519
453 Ga0495666_0026314 3300046526 Bacteria 2869
454 Ga0495666_0049944 3300046526 Bacteria 2011
455 Ga0495652_0245292 3300046529 Unclassified 1330
456 Ga0495652_0590090 3300046529 Bacteria 759
457 Ga0495640_0004603 3300046533 Bacteria 11001
458 Ga0495640_0144500 3300046533 Bacteria 1531
459 Ga0495640_0246607 3300046533 Bacteria 1120
460 Ga0495640_0377210 3300046533 Unclassified 873
461 Ga0495640_0555944 3300046533 Bacteria 695
462 Ga0495586_0000114 3300046535 Bacteria 48074
463 Ga0495586_0000553 3300046535 Bacteria 21702
464 Ga0495586_0003122 3300046535 Bacteria 8914
465 Ga0495586_0005284 3300046535 Bacteria 6911
466 Ga0495586_0033543 3300046535 Unclassified 2755
467 Ga0495586_0051744 3300046535 Bacteria 2223
468 Ga0495586_0360066 3300046535 Bacteria 836
469 Ga0495586_0620675 3300046535 Unclassified 625
470 Ga0495586_0722087 3300046535 Unclassified 575
471 Ga0495587_0623296 3300046536 Bacteria 593
472 Ga0495645_0029766 3300046543 Unclassified 3974
473 Ga0495645_0119282 3300046543 Bacteria 1859
474 Ga0495645_0288340 3300046543 Bacteria 1077
475 Ga0495645_0521206 3300046543 Unclassified 740
476 Ga0495645_0530826 3300046543 Unclassified 732
477 Ga0495645_0788882 3300046543 Bacteria 571
478 Ga0495667_0022084 3300046559 Bacteria 4289
479 Ga0495667_0104607 3300046559 Unclassified 1830
480 Ga0495668_0314033 3300046616 Bacteria 859
481 Ga0495634_0002448 3300046642 Bacteria 15426
482 Ga0495634_0027656 3300046642 Unclassified 3945
483 Ga0495635_0292640 3300046663 Bacteria 1092
484 Ga0495635_0325099 3300046663 Bacteria 1029
485 Ga0495635_0610374 3300046663 Bacteria 712
486 Ga0495599_0106958 3300046678 Unclassified 1743
487 Ga0495599_0126535 3300046678 Bacteria 1588
488 Ga0495599_0167575 3300046678 Bacteria 1356
489 Ga0495599_0402560 3300046678 Unclassified 815
490 Ga0495599_0780504 3300046678 Bacteria 547
491 Ga0495647_0081453 3300046681 Bacteria 1313
492 Ga0495658_0019066 3300046683 Unclassified 3576
493 Ga0495658_0099958 3300046683 Bacteria 1730
494 Ga0495658_0147455 3300046683 Unclassified 1443
495 Ga0495658_0940724 3300046683 Bacteria 552
496 Ga0495669_0039944 3300046684 Bacteria 2079
497 Ga0495669_0233942 3300046684 Unclassified 882
498 Ga0495613_0000632 3300046689 Bacteria 28018
499 Ga0495613_0023520 3300046689 Bacteria 4591
500 Ga0495613_0115584 3300046689 Unclassified 1930
501 Ga0495613_0266984 3300046689 Unclassified 1191
502 Ga0495613_0850974 3300046689 Bacteria 593
503 Ga0495624_0072750 3300046690 Unclassified 2138
504 Ga0495624_0076641 3300046690 Bacteria 2075
505 Ga0495581_0031118 3300047315 Unclassified 3092
506 Ga0495581_0292270 3300047315 Bacteria 953
507 Ga0495604_0352841 3300047317 Bacteria 977
508 Ga0495604_0887513 3300047317 Unclassified 558
509 Ga0495674_0010420 3300047319 Bacteria 8801
510 Ga0495674_0273840 3300047319 Bacteria 1384
511 Ga0495674_0466067 3300047319 Unclassified 1014
512 Ga0495676_0021470 3300047321 Bacteria 5637
513 Ga0495680_0001937 3300047322 Bacteria 21766
514 Ga0495680_0812124 3300047322 Unclassified 610
515 Ga0495680_0964399 3300047322 Unclassified 547
516 Ga0495684_0326605 3300047471 Bacteria 1095
517 Ga0495684_0574419 3300047471 Unclassified 764
518 Ga0495614_0050004 3300048089 Bacteria 1792
519 Ga0495614_0313367 3300048089 Unclassified 727
520 Ga0496112_0887547 3300048915 Unclassified 814
521 Ga0496115_0046825 3300048918 Bacteria 3458
522 Ga0496115_0235014 3300048918 Bacteria 1511
523 Ga0501031_0042912 3300049568 Bacteria 2953
524 Ga0501032_0995904 3300049569 Bacteria 526
525 Ga0501033_0020698 3300049570 Unclassified 4971
526 Ga0501034_0141318 3300049571 Unclassified 2387
527 Ga0501036_0900262 3300049572 Unclassified 726
528 Ga0501036_1104244 3300049572 Bacteria 648
529 Ga0501043_0051513 3300049579 Unclassified 3235
530 Ga0501047_0378712 3300049581 Bacteria 1250
531 Ga0501080_0650112 3300049742 Bacteria 933
532 Ga0501035_0213927 3300049822 Bacteria 1648
533 Ga0501035_1065029 3300049822 Unclassified 633
534 Ga0501044_0020029 3300049823 Bacteria 7143
535 Ga0501044_0976545 3300049823 Unclassified 719
536 nmdc:mga09592_257340_c1 3300050508 Archaea 1513
537 nmdc:mga0qj67_371853_c1 3300050509 Archaea 1154
538 nmdc:mga06r32_39429_c1 3300050510 Unclassified 4481
539 nmdc:mga08y16_1187903_c1 3300050511 Unclassified 734
540 nmdc:mga08y16_1393772_c1 3300050511 Unclassified 664
541 nmdc:mga08y16_609313_c1 3300050511 Unclassified 1100
542 nmdc:mga0rr50_1412458_c1 3300050513 Bacteria 589
543 nmdc:mga08x19_568400_c1 3300050514 Unclassified 803
544 Ga0495601_0746581 3300053077 Unclassified 623
545 Ga0495612_0441493 3300053078 Unclassified 594
546 Ga0500650_0115469 3300053098 Bacteria 1253
547 Ga0500650_0238235 3300053098 Bacteria 819
548 Ga0466962_0417796 3300061719 Unclassified 673

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025934 Ga0207686_10398525 Ga0207686_103985252 100
2 3300005327 Ga0070658_10768592 Ga0070658_107685921 101
3 3300005330 Ga0070690_100002129 Ga0070690_1000021297 101
4 3300005341 Ga0070691_10849526 Ga0070691_108495261 101
5 3300005539 Ga0068853_101588407 Ga0068853_1015884072 101
6 3300005563 Ga0068855_100030384 Ga0068855_1000303848 101
7 3300005563 Ga0068855_100688857 Ga0068855_1006888572 101
8 3300005614 Ga0068856_100000017 Ga0068856_10000001767 101
9 3300005614 Ga0068856_100978463 Ga0068856_1009784632 101
10 3300005614 Ga0068856_101968084 Ga0068856_1019680842 101
11 3300005718 Ga0068866_10035949 Ga0068866_100359494 101
12 3300006358 Ga0068871_100049844 Ga0068871_1000498444 101
13 3300009093 Ga0105240_10247869 Ga0105240_102478692 101
14 3300009551 Ga0105238_10017171 Ga0105238_100171717 101
15 3300009551 Ga0105238_10054936 Ga0105238_100549364 101
16 3300013296 Ga0157374_10649577 Ga0157374_106495772 101
17 3300013296 Ga0157374_10794599 Ga0157374_107945992 101
18 3300025913 Ga0207695_10083854 Ga0207695_100838543 101
19 3300025924 Ga0207694_10009450 Ga0207694_100094507 101
20 3300025924 Ga0207694_10058365 Ga0207694_100583653 101
21 3300025949 Ga0207667_10044512 Ga0207667_100445122 101
22 3300025949 Ga0207667_10431843 Ga0207667_104318432 101
23 3300025949 Ga0207667_10641948 Ga0207667_106419482 101
24 3300026078 Ga0207702_10000630 Ga0207702_1000063013 101
25 3300026078 Ga0207702_10388237 Ga0207702_103882372 101
26 3300028556 Ga0265337_1001805 Ga0265337_10018059 101
27 3300028558 Ga0265326_10000722 Ga0265326_100007227 101
28 3300028653 Ga0265323_10090757 Ga0265323_100907572 101
29 3300028666 Ga0265336_10002219 Ga0265336_100022196 101
30 3300028800 Ga0265338_10000160 Ga0265338_1000016067 101
31 3300028800 Ga0265338_10000310 Ga0265338_1000031048 101
32 3300028800 Ga0265338_10000626 Ga0265338_1000062650 101
33 3300029957 Ga0265324_10000403 Ga0265324_1000040320 101
34 3300029957 Ga0265324_10039117 Ga0265324_100391172 101
35 3300029957 Ga0265324_10145797 Ga0265324_101457972 101
36 3300031235 Ga0265330_10187486 Ga0265330_101874862 101
37 3300031240 Ga0265320_10014563 Ga0265320_100145632 101
38 3300031240 Ga0265320_10487271 Ga0265320_104872711 101
39 3300031249 Ga0265339_10038991 Ga0265339_100389913 101
40 3300031344 Ga0265316_10178126 Ga0265316_101781263 101
41 3300031711 Ga0265314_10007829 Ga0265314_100078296 101
42 3300031711 Ga0265314_10098494 Ga0265314_100984942 101
43 3300031711 Ga0265314_10330187 Ga0265314_103301872 101
44 3300037418 Ga0395900_0089607 Ga0395900_0089607_727_1038 101
45 3300037471 Ga0395905_0012307 Ga0395905_0012307_2107_2418 101
46 3300042876 Ga0451577_0098140 Ga0451577_0098140_1458_1763 101
47 3300044712 Ga0453684_0303559 Ga0453684_0303559_1249_1554 101
48 3300046543 Ga0495645_0530826 Ga0495645_0530826_329_634 101
49 3300050511 nmdc:mga08y16_1393772_c1 nmdc:mga08y16_1393772_c1_226_531 101
50 3300005334 Ga0068869_100568915 Ga0068869_1005689152 102
51 3300005340 Ga0070689_100099838 Ga0070689_1000998382 102
52 3300005343 Ga0070687_100014296 Ga0070687_1000142962 102
53 3300005343 Ga0070687_101255270 Ga0070687_1012552701 102
54 3300005365 Ga0070688_100719582 Ga0070688_1007195821 102
55 3300005436 Ga0070713_100022832 Ga0070713_1000228323 102
56 3300005436 Ga0070713_100918936 Ga0070713_1009189362 102
57 3300005436 Ga0070713_101204219 Ga0070713_1012042192 102
58 3300005437 Ga0070710_10877641 Ga0070710_108776411 102
59 3300005439 Ga0070711_100001133 Ga0070711_10000113311 102
60 3300005439 Ga0070711_100944116 Ga0070711_1009441162 102
61 3300005439 Ga0070711_101078968 Ga0070711_1010789682 102
62 3300005441 Ga0070700_101353651 Ga0070700_1013536512 102
63 3300005458 Ga0070681_10098707 Ga0070681_100987072 102
64 3300005466 Ga0070685_11022475 Ga0070685_110224751 102
65 3300005535 Ga0070684_101023586 Ga0070684_1010235862 102
66 3300005544 Ga0070686_101160828 Ga0070686_1011608282 102
67 3300005547 Ga0070693_100340851 Ga0070693_1003408511 102
68 3300005563 Ga0068855_100721559 Ga0068855_1007215592 102
69 3300005577 Ga0068857_100051795 Ga0068857_1000517953 102
70 3300005614 Ga0068856_100017053 Ga0068856_1000170537 102
71 3300005615 Ga0070702_100047054 Ga0070702_1000470542 102
72 3300005617 Ga0068859_100133363 Ga0068859_1001333633 102
73 3300005617 Ga0068859_100705960 Ga0068859_1007059602 102
74 3300005617 Ga0068859_100736603 Ga0068859_1007366031 102
75 3300005617 Ga0068859_101426724 Ga0068859_1014267242 102
76 3300005617 Ga0068859_101621239 Ga0068859_1016212391 102
77 3300005617 Ga0068859_102867031 Ga0068859_1028670312 102
78 3300005618 Ga0068864_100635560 Ga0068864_1006355602 102
79 3300005841 Ga0068863_100220329 Ga0068863_1002203292 102
80 3300005841 Ga0068863_100334151 Ga0068863_1003341513 102
81 3300005841 Ga0068863_100771218 Ga0068863_1007712182 102
82 3300005842 Ga0068858_100466842 Ga0068858_1004668422 102
83 3300005842 Ga0068858_100572382 Ga0068858_1005723822 102
84 3300005842 Ga0068858_101740071 Ga0068858_1017400712 102
85 3300006163 Ga0070715_10180916 Ga0070715_101809162 102
86 3300006175 Ga0070712_100729529 Ga0070712_1007295292 102
87 3300006237 Ga0097621_100053105 Ga0097621_1000531054 102
88 3300006237 Ga0097621_100534904 Ga0097621_1005349042 102
89 3300006237 Ga0097621_100687658 Ga0097621_1006876582 102
90 3300006237 Ga0097621_101064026 Ga0097621_1010640262 102
91 3300006358 Ga0068871_100234696 Ga0068871_1002346962 102
92 3300006358 Ga0068871_100615568 Ga0068871_1006155682 102
93 3300006844 Ga0075428_100904884 Ga0075428_1009048842 102
94 3300006847 Ga0075431_100070025 Ga0075431_1000700253 102
95 3300006871 Ga0075434_100447965 Ga0075434_1004479652 102
96 3300006880 Ga0075429_100337453 Ga0075429_1003374532 102
97 3300006881 Ga0068865_100274295 Ga0068865_1002742952 102
98 3300006914 Ga0075436_100648059 Ga0075436_1006480591 102
99 3300006931 Ga0097620_100133369 Ga0097620_1001333693 102
100 3300006931 Ga0097620_100705935 Ga0097620_1007059352 102
101 3300006931 Ga0097620_100736655 Ga0097620_1007366551 102
102 3300006931 Ga0097620_101426800 Ga0097620_1014268002 102
103 3300006931 Ga0097620_101621172 Ga0097620_1016211721 102
104 3300006931 Ga0097620_102867029 Ga0097620_1028670292 102
105 3300007076 Ga0075435_100568981 Ga0075435_1005689811 102
106 3300007076 Ga0075435_101511504 Ga0075435_1015115042 102
107 3300009093 Ga0105240_10048613 Ga0105240_100486134 102
108 3300009093 Ga0105240_10147342 Ga0105240_101473423 102
109 3300009093 Ga0105240_10887825 Ga0105240_108878252 102
110 3300009094 Ga0111539_10112968 Ga0111539_101129684 102
111 3300009094 Ga0111539_10823064 Ga0111539_108230642 102
112 3300009098 Ga0105245_10132000 Ga0105245_101320003 102
113 3300009098 Ga0105245_10952583 Ga0105245_109525831 102
114 3300009176 Ga0105242_10121585 Ga0105242_101215854 102
115 3300009177 Ga0105248_10546754 Ga0105248_105467541 102
116 3300009177 Ga0105248_10821664 Ga0105248_108216642 102
117 3300009177 Ga0105248_10889663 Ga0105248_108896632 102
118 3300009177 Ga0105248_11021961 Ga0105248_110219612 102
119 3300009177 Ga0105248_12539012 Ga0105248_125390121 102
120 3300009177 Ga0105248_13220435 Ga0105248_132204351 102
121 3300009545 Ga0105237_10935361 Ga0105237_109353612 102
122 3300009545 Ga0105237_12053638 Ga0105237_120536382 102
123 3300009551 Ga0105238_10158439 Ga0105238_101584392 102
124 3300009551 Ga0105238_11178361 Ga0105238_111783611 102
125 3300009553 Ga0105249_11947881 Ga0105249_119478812 102
126 3300011119 Ga0105246_10253222 Ga0105246_102532222 102
127 3300013296 Ga0157374_10101521 Ga0157374_101015212 102
128 3300013296 Ga0157374_10574304 Ga0157374_105743042 102
129 3300013296 Ga0157374_11628977 Ga0157374_116289772 102
130 3300013297 Ga0157378_11162158 Ga0157378_111621582 102
131 3300013306 Ga0163162_11039653 Ga0163162_110396532 102
132 3300013306 Ga0163162_12747317 Ga0163162_127473171 102
133 3300013306 Ga0163162_12826550 Ga0163162_128265501 102
134 3300013306 Ga0163162_13006015 Ga0163162_130060152 102
135 3300013307 Ga0157372_11107833 Ga0157372_111078332 102
136 3300013308 Ga0157375_10042780 Ga0157375_100427805 102
137 3300013308 Ga0157375_10420412 Ga0157375_104204122 102
138 3300013308 Ga0157375_10610364 Ga0157375_106103642 102
139 3300014325 Ga0163163_10000010 Ga0163163_1000001079 102
140 3300014325 Ga0163163_10133090 Ga0163163_101330903 102
141 3300014325 Ga0163163_10822775 Ga0163163_108227752 102
142 3300014326 Ga0157380_11743477 Ga0157380_117434772 102
143 3300014968 Ga0157379_10702592 Ga0157379_107025922 102
144 3300014969 Ga0157376_10363863 Ga0157376_103638632 102
145 3300025898 Ga0207692_10461127 Ga0207692_104611272 102
146 3300025906 Ga0207699_11143049 Ga0207699_111430492 102
147 3300025906 Ga0207699_11414192 Ga0207699_114141922 102
148 3300025912 Ga0207707_10245369 Ga0207707_102453693 102
149 3300025913 Ga0207695_10059235 Ga0207695_100592353 102
150 3300025913 Ga0207695_10096397 Ga0207695_100963973 102
151 3300025914 Ga0207671_11572106 Ga0207671_115721062 102
152 3300025915 Ga0207693_10255937 Ga0207693_102559372 102
153 3300025916 Ga0207663_10009822 Ga0207663_100098224 102
154 3300025918 Ga0207662_10054301 Ga0207662_100543012 102
155 3300025918 Ga0207662_10785284 Ga0207662_107852841 102
156 3300025924 Ga0207694_10105331 Ga0207694_101053314 102
157 3300025926 Ga0207659_10658745 Ga0207659_106587452 102
158 3300025928 Ga0207700_11775799 Ga0207700_117757992 102
159 3300025933 Ga0207706_10729885 Ga0207706_107298852 102
160 3300025936 Ga0207670_10047403 Ga0207670_100474031 102
161 3300025938 Ga0207704_10549061 Ga0207704_105490612 102
162 3300025941 Ga0207711_11427100 Ga0207711_114271001 102
163 3300025942 Ga0207689_10497059 Ga0207689_104970592 102
164 3300025960 Ga0207651_12035064 Ga0207651_120350642 102
165 3300025961 Ga0207712_10449765 Ga0207712_104497652 102
166 3300026035 Ga0207703_10257118 Ga0207703_102571183 102
167 3300026035 Ga0207703_10431479 Ga0207703_104314792 102
168 3300026078 Ga0207702_10011100 Ga0207702_100111009 102
169 3300026088 Ga0207641_11305506 Ga0207641_113055061 102
170 3300026089 Ga0207648_10147735 Ga0207648_101477353 102
171 3300026095 Ga0207676_10498592 Ga0207676_104985922 102
172 3300026116 Ga0207674_10065691 Ga0207674_100656914 102
173 3300027907 Ga0207428_10735596 Ga0207428_107355962 102
174 3300028380 Ga0268265_10851376 Ga0268265_108513762 102
175 3300028556 Ga0265337_1000210 Ga0265337_100021020 102
176 3300028556 Ga0265337_1004707 Ga0265337_10047074 102
177 3300028556 Ga0265337_1004917 Ga0265337_10049172 102
178 3300028556 Ga0265337_1006396 Ga0265337_10063965 102
179 3300028556 Ga0265337_1008070 Ga0265337_10080704 102
180 3300028556 Ga0265337_1053246 Ga0265337_10532462 102
181 3300028558 Ga0265326_10009025 Ga0265326_100090254 102
182 3300028558 Ga0265326_10023695 Ga0265326_100236953 102
183 3300028558 Ga0265326_10037819 Ga0265326_100378193 102
184 3300028558 Ga0265326_10041600 Ga0265326_100416002 102
185 3300028563 Ga0265319_1031529 Ga0265319_10315292 102
186 3300028563 Ga0265319_1066093 Ga0265319_10660933 102
187 3300028573 Ga0265334_10013593 Ga0265334_100135934 102
188 3300028573 Ga0265334_10019726 Ga0265334_100197262 102
189 3300028573 Ga0265334_10154527 Ga0265334_101545271 102
190 3300028573 Ga0265334_10311898 Ga0265334_103118981 102
191 3300028577 Ga0265318_10009290 Ga0265318_100092905 102
192 3300028577 Ga0265318_10031152 Ga0265318_100311523 102
193 3300028577 Ga0265318_10084650 Ga0265318_100846502 102
194 3300028653 Ga0265323_10000312 Ga0265323_1000031214 102
195 3300028653 Ga0265323_10016950 Ga0265323_100169503 102
196 3300028653 Ga0265323_10028204 Ga0265323_100282042 102
197 3300028653 Ga0265323_10054921 Ga0265323_100549212 102
198 3300028653 Ga0265323_10131820 Ga0265323_101318202 102
199 3300028654 Ga0265322_10032669 Ga0265322_100326693 102
200 3300028654 Ga0265322_10033400 Ga0265322_100334003 102
201 3300028654 Ga0265322_10055438 Ga0265322_100554382 102
202 3300028654 Ga0265322_10062552 Ga0265322_100625522 102
203 3300028654 Ga0265322_10068535 Ga0265322_100685352 102
204 3300028666 Ga0265336_10004034 Ga0265336_100040343 102
205 3300028666 Ga0265336_10013027 Ga0265336_100130274 102
206 3300028666 Ga0265336_10023395 Ga0265336_100233953 102
207 3300028666 Ga0265336_10091841 Ga0265336_100918412 102
208 3300028800 Ga0265338_10000433 Ga0265338_1000043356 102
209 3300028800 Ga0265338_10000988 Ga0265338_1000098812 102
210 3300028800 Ga0265338_10001793 Ga0265338_1000179331 102
211 3300028800 Ga0265338_10002328 Ga0265338_1000232812 102
212 3300028800 Ga0265338_10009937 Ga0265338_100099379 102
213 3300028800 Ga0265338_10015696 Ga0265338_100156969 102
214 3300028800 Ga0265338_10020032 Ga0265338_100200323 102
215 3300028800 Ga0265338_10020503 Ga0265338_100205036 102
216 3300028800 Ga0265338_10030959 Ga0265338_100309595 102
217 3300028800 Ga0265338_10040841 Ga0265338_100408414 102
218 3300028800 Ga0265338_10065623 Ga0265338_100656234 102
219 3300028800 Ga0265338_10090678 Ga0265338_100906784 102
220 3300028800 Ga0265338_10160436 Ga0265338_101604362 102
221 3300028800 Ga0265338_10246153 Ga0265338_102461532 102
222 3300028800 Ga0265338_10319209 Ga0265338_103192092 102
223 3300028800 Ga0265338_10367945 Ga0265338_103679452 102
224 3300028800 Ga0265338_10403627 Ga0265338_104036272 102
225 3300028800 Ga0265338_10520859 Ga0265338_105208591 102
226 3300028800 Ga0265338_10603714 Ga0265338_106037142 102
227 3300029957 Ga0265324_10000170 Ga0265324_1000017014 102
228 3300029957 Ga0265324_10022337 Ga0265324_100223373 102
229 3300029957 Ga0265324_10032028 Ga0265324_100320282 102
230 3300029957 Ga0265324_10039022 Ga0265324_100390221 102
231 3300029957 Ga0265324_10119079 Ga0265324_101190792 102
232 3300031238 Ga0265332_10018121 Ga0265332_100181215 102
233 3300031240 Ga0265320_10000886 Ga0265320_1000088612 102
234 3300031240 Ga0265320_10007127 Ga0265320_100071274 102
235 3300031240 Ga0265320_10018983 Ga0265320_100189835 102
236 3300031240 Ga0265320_10061198 Ga0265320_100611984 102
237 3300031240 Ga0265320_10207035 Ga0265320_102070352 102
238 3300031240 Ga0265320_10279899 Ga0265320_102798992 102
239 3300031240 Ga0265320_10315754 Ga0265320_103157542 102
240 3300031241 Ga0265325_10017329 Ga0265325_100173295 102
241 3300031241 Ga0265325_10019440 Ga0265325_100194404 102
242 3300031241 Ga0265325_10048881 Ga0265325_100488813 102
243 3300031247 Ga0265340_10000209 Ga0265340_1000020917 102
244 3300031247 Ga0265340_10018649 Ga0265340_100186494 102
245 3300031247 Ga0265340_10131792 Ga0265340_101317922 102
246 3300031247 Ga0265340_10303458 Ga0265340_103034582 102
247 3300031249 Ga0265339_10032070 Ga0265339_100320705 102
248 3300031249 Ga0265339_10448231 Ga0265339_104482311 102
249 3300031249 Ga0265339_10588681 Ga0265339_105886811 102
250 3300031250 Ga0265331_10399138 Ga0265331_103991382 102
251 3300031251 Ga0265327_10010372 Ga0265327_100103727 102
252 3300031251 Ga0265327_10038719 Ga0265327_100387191 102
253 3300031251 Ga0265327_10070581 Ga0265327_100705812 102
254 3300031344 Ga0265316_10023093 Ga0265316_100230936 102
255 3300031344 Ga0265316_10049083 Ga0265316_100490835 102
256 3300031344 Ga0265316_10073158 Ga0265316_100731582 102
257 3300031344 Ga0265316_10116873 Ga0265316_101168732 102
258 3300031344 Ga0265316_10245663 Ga0265316_102456632 102
259 3300031344 Ga0265316_10335651 Ga0265316_103356513 102
260 3300031344 Ga0265316_10414104 Ga0265316_104141042 102
261 3300031344 Ga0265316_10845954 Ga0265316_108459541 102
262 3300031344 Ga0265316_10851179 Ga0265316_108511792 102
263 3300031344 Ga0265316_10997165 Ga0265316_109971651 102
264 3300031595 Ga0265313_10003416 Ga0265313_100034168 102
265 3300031711 Ga0265314_10018966 Ga0265314_100189665 102
266 3300031711 Ga0265314_10031202 Ga0265314_100312024 102
267 3300031711 Ga0265314_10296348 Ga0265314_102963482 102
268 3300031711 Ga0265314_10503947 Ga0265314_105039472 102
269 3300031712 Ga0265342_10020872 Ga0265342_100208725 102
270 3300031712 Ga0265342_10133485 Ga0265342_101334852 102
271 3300031712 Ga0265342_10399182 Ga0265342_103991822 102
272 3300031727 Ga0316576_10727874 Ga0316576_107278742 102
273 3300031728 Ga0316578_10080391 Ga0316578_100803912 102
274 3300034816 Ga0373930_0001337 Ga0373930_0001337_1482_1790 102
275 3300034818 Ga0373950_0016686 Ga0373950_0016686_236_544 102
276 3300034957 Ga0373938_0026708 Ga0373938_0026708_326_634 102
277 3300035083 Ga0373926_0256861 Ga0373926_0256861_101_409 102
278 3300035083 Ga0373926_0336500 Ga0373926_0336500_234_542 102
279 3300035084 Ga0373928_0000009 Ga0373928_0000009_13432_13740 102
280 3300035085 Ga0373929_0209622 Ga0373929_0209622_52_360 102
281 3300035089 Ga0373944_0000137 Ga0373944_0000137_11523_11831 102
282 3300035089 Ga0373944_0255063 Ga0373944_0255063_113_421 102
283 3300035090 Ga0373949_0003669 Ga0373949_0003669_1301_1609 102
284 3300035091 Ga0373951_0062769 Ga0373951_0062769_404_712 102
285 3300035092 Ga0373952_0258297 Ga0373952_0258297_157_465 102
286 3300035112 Ga0373932_0000001 Ga0373932_0000001_1403078_1403386 102
287 3300035115 Ga0373941_0129099 Ga0373941_0129099_23_331 102
288 3300035116 Ga0373945_0015480 Ga0373945_0015480_1142_1450 102
289 3300035117 Ga0373953_0158812 Ga0373953_0158812_522_830 102
290 3300035118 Ga0373954_0072278 Ga0373954_0072278_1252_1560 102
291 3300035119 Ga0373956_0003802 Ga0373956_0003802_2237_2545 102
292 3300035170 Ga0373943_0194441 Ga0373943_0194441_799_1107 102
293 3300035170 Ga0373943_0688763 Ga0373943_0688763_235_543 102
294 3300035242 Ga0373962_0000056 Ga0373962_0000056_4444_4752 102
295 3300035691 Ga0373931_0000002 Ga0373931_0000002_92012_92320 102
296 3300035691 Ga0373931_0328930 Ga0373931_0328930_28_336 102
297 3300035691 Ga0373931_0432954 Ga0373931_0432954_50_358 102
298 3300035692 Ga0373935_0011690 Ga0373935_0011690_214_522 102
299 3300035692 Ga0373935_0050915 Ga0373935_0050915_353_661 102
300 3300035692 Ga0373935_0701539 Ga0373935_0701539_97_405 102
301 3300035692 Ga0373935_0910877 Ga0373935_0910877_262_570 102
302 3300035695 Ga0373927_0004818 Ga0373927_0004818_8269_8577 102
303 3300035695 Ga0373927_0056614 Ga0373927_0056614_473_781 102
304 3300035724 Ga0373933_0105459 Ga0373933_0105459_1421_1729 102
305 3300035724 Ga0373933_0667897 Ga0373933_0667897_53_361 102
306 3300035725 Ga0373947_0009161 Ga0373947_0009161_2312_2620 102
307 3300035725 Ga0373947_0123677 Ga0373947_0123677_163_471 102
308 3300035725 Ga0373947_0298002 Ga0373947_0298002_282_590 102
309 3300035725 Ga0373947_0448265 Ga0373947_0448265_404_712 102
310 3300035725 Ga0373947_0872150 Ga0373947_0872150_260_568 102
311 3300036401 Ga0373937_0000659 Ga0373937_0000659_12843_13151 102
312 3300036401 Ga0373937_0326662 Ga0373937_0326662_553_861 102
313 3300036401 Ga0373937_1013910 Ga0373937_1013910_241_549 102
314 3300036401 Ga0373937_1250376 Ga0373937_1250376_70_378 102
315 3300036401 Ga0373937_1458015 Ga0373937_1458015_38_346 102
316 3300036647 Ga0316582_0563628 Ga0316582_0563628_294_602 102
317 3300036712 Ga0316584_1155434 Ga0316584_1155434_21_329 102
318 3300037068 Ga0373925_0000121 Ga0373925_0000121_25773_26081 102
319 3300037068 Ga0373925_0001575 Ga0373925_0001575_18553_18861 102
320 3300037068 Ga0373925_0003106 Ga0373925_0003106_7961_8269 102
321 3300037068 Ga0373925_1214742 Ga0373925_1214742_219_527 102
322 3300042876 Ga0451577_0001517 Ga0451577_0001517_28316_28624 102
323 3300042876 Ga0451577_0008776 Ga0451577_0008776_125_433 102
324 3300042876 Ga0451577_1393957 Ga0451577_1393957_203_511 102
325 3300044673 Ga0453683_0148599 Ga0453683_0148599_820_1128 102
326 3300044673 Ga0453683_0287262 Ga0453683_0287262_405_713 102
327 3300044712 Ga0453684_0049879 Ga0453684_0049879_169_477 102
328 3300044712 Ga0453684_0887320 Ga0453684_0887320_519_827 102
329 3300045051 Ga0451576_0065865 Ga0451576_0065865_759_1067 102
330 3300045051 Ga0451576_0074318 Ga0451576_0074318_911_1219 102
331 3300045051 Ga0451576_0076812 Ga0451576_0076812_335_643 102
332 3300045051 Ga0451576_0198541 Ga0451576_0198541_338_646 102
333 3300045051 Ga0451576_0398633 Ga0451576_0398633_482_790 102
334 3300045051 Ga0451576_0415804 Ga0451576_0415804_893_1201 102
335 3300045051 Ga0451576_0455047 Ga0451576_0455047_717_1025 102
336 3300045051 Ga0451576_0721477 Ga0451576_0721477_19_327 102
337 3300045051 Ga0451576_0851743 Ga0451576_0851743_169_477 102
338 3300045051 Ga0451576_1081953 Ga0451576_1081953_385_693 102
339 3300045051 Ga0451576_1471604 Ga0451576_1471604_213_521 102
340 3300045051 Ga0451576_2051095 Ga0451576_2051095_92_400 102
341 3300045051 Ga0451576_2575901 Ga0451576_2575901_77_385 102
342 3300046454 Ga0495592_0000087 Ga0495592_0000087_41122_41430 102
343 3300046454 Ga0495592_0247569 Ga0495592_0247569_371_679 102
344 3300046459 Ga0495629_0166802 Ga0495629_0166802_719_1027 102
345 3300046473 Ga0495582_0015399 Ga0495582_0015399_1278_1586 102
346 3300046475 Ga0495639_0413466 Ga0495639_0413466_170_478 102
347 3300046475 Ga0495639_0475857 Ga0495639_0475857_309_617 102
348 3300046476 Ga0495662_0109798 Ga0495662_0109798_578_886 102
349 3300046476 Ga0495662_0249652 Ga0495662_0249652_167_475 102
350 3300046477 Ga0495664_0290587 Ga0495664_0290587_22_330 102
351 3300046511 Ga0495608_0223523 Ga0495608_0223523_194_502 102
352 3300046511 Ga0495608_0549137 Ga0495608_0549137_196_504 102
353 3300046514 Ga0495618_0000575 Ga0495618_0000575_14902_15210 102
354 3300046514 Ga0495618_0001019 Ga0495618_0001019_8045_8353 102
355 3300046516 Ga0495628_0000056 Ga0495628_0000056_45477_45785 102
356 3300046516 Ga0495628_0330479 Ga0495628_0330479_124_432 102
357 3300046516 Ga0495628_0855126 Ga0495628_0855126_44_352 102
358 3300046517 Ga0495630_0000226 Ga0495630_0000226_135_443 102
359 3300046517 Ga0495630_0016036 Ga0495630_0016036_5111_5419 102
360 3300046517 Ga0495630_0033929 Ga0495630_0033929_2825_3133 102
361 3300046517 Ga0495630_0481629 Ga0495630_0481629_565_873 102
362 3300046517 Ga0495630_1205283 Ga0495630_1205283_28_336 102
363 3300046517 Ga0495630_1431256 Ga0495630_1431256_126_434 102
364 3300046526 Ga0495666_0026314 Ga0495666_0026314_741_1049 102
365 3300046526 Ga0495666_0049944 Ga0495666_0049944_714_1022 102
366 3300046529 Ga0495652_0245292 Ga0495652_0245292_76_384 102
367 3300046533 Ga0495640_0004603 Ga0495640_0004603_5649_5957 102
368 3300046533 Ga0495640_0144500 Ga0495640_0144500_428_736 102
369 3300046533 Ga0495640_0246607 Ga0495640_0246607_87_395 102
370 3300046533 Ga0495640_0377210 Ga0495640_0377210_227_535 102
371 3300046535 Ga0495586_0000114 Ga0495586_0000114_44344_44652 102
372 3300046535 Ga0495586_0000553 Ga0495586_0000553_9233_9541 102
373 3300046535 Ga0495586_0003122 Ga0495586_0003122_5372_5680 102
374 3300046535 Ga0495586_0005284 Ga0495586_0005284_804_1112 102
375 3300046535 Ga0495586_0033543 Ga0495586_0033543_408_716 102
376 3300046535 Ga0495586_0051744 Ga0495586_0051744_1396_1704 102
377 3300046535 Ga0495586_0360066 Ga0495586_0360066_232_540 102
378 3300046535 Ga0495586_0620675 Ga0495586_0620675_157_465 102
379 3300046535 Ga0495586_0722087 Ga0495586_0722087_224_532 102
380 3300046536 Ga0495587_0623296 Ga0495587_0623296_156_464 102
381 3300046543 Ga0495645_0029766 Ga0495645_0029766_528_836 102
382 3300046543 Ga0495645_0119282 Ga0495645_0119282_1360_1668 102
383 3300046543 Ga0495645_0521206 Ga0495645_0521206_112_420 102
384 3300046543 Ga0495645_0788882 Ga0495645_0788882_168_476 102
385 3300046559 Ga0495667_0022084 Ga0495667_0022084_3293_3601 102
386 3300046559 Ga0495667_0104607 Ga0495667_0104607_1345_1653 102
387 3300046642 Ga0495634_0002448 Ga0495634_0002448_9220_9528 102
388 3300046642 Ga0495634_0027656 Ga0495634_0027656_1237_1545 102
389 3300046663 Ga0495635_0292640 Ga0495635_0292640_677_985 102
390 3300046663 Ga0495635_0610374 Ga0495635_0610374_217_525 102
391 3300046678 Ga0495599_0106958 Ga0495599_0106958_40_348 102
392 3300046678 Ga0495599_0167575 Ga0495599_0167575_652_960 102
393 3300046678 Ga0495599_0402560 Ga0495599_0402560_41_349 102
394 3300046678 Ga0495599_0780504 Ga0495599_0780504_46_354 102
395 3300046681 Ga0495647_0081453 Ga0495647_0081453_800_1108 102
396 3300046683 Ga0495658_0019066 Ga0495658_0019066_744_1052 102
397 3300046683 Ga0495658_0099958 Ga0495658_0099958_876_1184 102
398 3300046683 Ga0495658_0147455 Ga0495658_0147455_750_1058 102
399 3300046683 Ga0495658_0940724 Ga0495658_0940724_120_428 102
400 3300046684 Ga0495669_0233942 Ga0495669_0233942_292_600 102
401 3300046689 Ga0495613_0000632 Ga0495613_0000632_18496_18804 102
402 3300046689 Ga0495613_0023520 Ga0495613_0023520_2120_2428 102
403 3300046689 Ga0495613_0115584 Ga0495613_0115584_591_899 102
404 3300046689 Ga0495613_0266984 Ga0495613_0266984_55_363 102
405 3300046689 Ga0495613_0850974 Ga0495613_0850974_157_465 102
406 3300046690 Ga0495624_0072750 Ga0495624_0072750_733_1041 102
407 3300046690 Ga0495624_0076641 Ga0495624_0076641_986_1294 102
408 3300047315 Ga0495581_0031118 Ga0495581_0031118_698_1006 102
409 3300047315 Ga0495581_0292270 Ga0495581_0292270_613_921 102
410 3300047317 Ga0495604_0887513 Ga0495604_0887513_186_494 102
411 3300047319 Ga0495674_0010420 Ga0495674_0010420_5159_5467 102
412 3300047319 Ga0495674_0466067 Ga0495674_0466067_626_934 102
413 3300047321 Ga0495676_0021470 Ga0495676_0021470_4989_5297 102
414 3300047322 Ga0495680_0001937 Ga0495680_0001937_10695_11003 102
415 3300047322 Ga0495680_0812124 Ga0495680_0812124_236_544 102
416 3300047322 Ga0495680_0964399 Ga0495680_0964399_87_395 102
417 3300047471 Ga0495684_0574419 Ga0495684_0574419_282_590 102
418 3300048089 Ga0495614_0050004 Ga0495614_0050004_1389_1697 102
419 3300048089 Ga0495614_0313367 Ga0495614_0313367_343_651 102
420 3300048915 Ga0496112_0887547 Ga0496112_0887547_47_355 102
421 3300049568 Ga0501031_0042912 Ga0501031_0042912_1388_1696 102
422 3300049569 Ga0501032_0995904 Ga0501032_0995904_81_389 102
423 3300049570 Ga0501033_0020698 Ga0501033_0020698_4129_4437 102
424 3300049571 Ga0501034_0141318 Ga0501034_0141318_771_1079 102
425 3300049572 Ga0501036_0900262 Ga0501036_0900262_302_610 102
426 3300049572 Ga0501036_1104244 Ga0501036_1104244_35_343 102
427 3300049579 Ga0501043_0051513 Ga0501043_0051513_2213_2521 102
428 3300049581 Ga0501047_0378712 Ga0501047_0378712_485_793 102
429 3300049742 Ga0501080_0650112 Ga0501080_0650112_128_436 102
430 3300049822 Ga0501035_0213927 Ga0501035_0213927_812_1120 102
431 3300049822 Ga0501035_1065029 Ga0501035_1065029_106_414 102
432 3300049823 Ga0501044_0020029 Ga0501044_0020029_1828_2136 102
433 3300049823 Ga0501044_0976545 Ga0501044_0976545_91_399 102
434 3300050508 nmdc:mga09592_257340_c1 nmdc:mga09592_257340_c1_1044_1352 102
435 3300050509 nmdc:mga0qj67_371853_c1 nmdc:mga0qj67_371853_c1_134_442 102
436 3300050510 nmdc:mga06r32_39429_c1 nmdc:mga06r32_39429_c1_2044_2352 102
437 3300050511 nmdc:mga08y16_1187903_c1 nmdc:mga08y16_1187903_c1_410_718 102
438 3300050511 nmdc:mga08y16_609313_c1 nmdc:mga08y16_609313_c1_539_847 102
439 3300050513 nmdc:mga0rr50_1412458_c1 nmdc:mga0rr50_1412458_c1_141_449 102
440 3300050514 nmdc:mga08x19_568400_c1 nmdc:mga08x19_568400_c1_55_363 102
441 3300053077 Ga0495601_0746581 Ga0495601_0746581_19_327 102
442 3300053078 Ga0495612_0441493 Ga0495612_0441493_10_318 102
443 3300053098 Ga0500650_0115469 Ga0500650_0115469_247_555 102
444 3300053098 Ga0500650_0238235 Ga0500650_0238235_93_401 102
445 3300005327 Ga0070658_10211947 Ga0070658_102119474 103
446 3300005336 Ga0070680_101444077 Ga0070680_1014440772 103
447 3300005338 Ga0068868_100497576 Ga0068868_1004975762 103
448 3300005435 Ga0070714_100001033 Ga0070714_1000010339 103
449 3300005445 Ga0070708_100168828 Ga0070708_1001688281 103
450 3300005458 Ga0070681_10054505 Ga0070681_100545052 103
451 3300005467 Ga0070706_101393449 Ga0070706_1013934492 103
452 3300005530 Ga0070679_100111731 Ga0070679_1001117314 103
453 3300005530 Ga0070679_100384124 Ga0070679_1003841242 103
454 3300005563 Ga0068855_100081250 Ga0068855_1000812506 103
455 3300005563 Ga0068855_100095627 Ga0068855_1000956272 103
456 3300005563 Ga0068855_100886038 Ga0068855_1008860382 103
457 3300005577 Ga0068857_101596636 Ga0068857_1015966361 103
458 3300005578 Ga0068854_101421372 Ga0068854_1014213722 103
459 3300005614 Ga0068856_101573793 Ga0068856_1015737932 103
460 3300005614 Ga0068856_102651687 Ga0068856_1026516872 103
461 3300005834 Ga0068851_10125965 Ga0068851_101259652 103
462 3300006237 Ga0097621_100535535 Ga0097621_1005355352 103
463 3300006358 Ga0068871_100272728 Ga0068871_1002727282 103
464 3300009093 Ga0105240_10324523 Ga0105240_103245232 103
465 3300009093 Ga0105240_10501278 Ga0105240_105012783 103
466 3300009093 Ga0105240_10784319 Ga0105240_107843192 103
467 3300009147 Ga0114129_12940037 Ga0114129_129400372 103
468 3300009174 Ga0105241_10861740 Ga0105241_108617402 103
469 3300009551 Ga0105238_10039954 Ga0105238_100399545 103
470 3300010375 Ga0105239_12652995 Ga0105239_126529951 103
471 3300011119 Ga0105246_12232882 Ga0105246_122328822 103
472 3300013104 Ga0157370_10291479 Ga0157370_102914793 103
473 3300013105 Ga0157369_10814740 Ga0157369_108147402 103
474 3300013296 Ga0157374_11537911 Ga0157374_115379112 103
475 3300013307 Ga0157372_10409459 Ga0157372_104094593 103
476 3300013307 Ga0157372_11604449 Ga0157372_116044491 103
477 3300014745 Ga0157377_10652579 Ga0157377_106525792 103
478 3300014969 Ga0157376_11588487 Ga0157376_115884872 103
479 3300025321 Ga0207656_10349333 Ga0207656_103493332 103
480 3300025909 Ga0207705_10504898 Ga0207705_105048982 103
481 3300025912 Ga0207707_10281890 Ga0207707_102818902 103
482 3300025915 Ga0207693_10617418 Ga0207693_106174182 103
483 3300025921 Ga0207652_10592950 Ga0207652_105929502 103
484 3300025922 Ga0207646_11411551 Ga0207646_114115512 103
485 3300025924 Ga0207694_10003771 Ga0207694_100037717 103
486 3300025928 Ga0207700_11742558 Ga0207700_117425581 103
487 3300025929 Ga0207664_10000746 Ga0207664_1000074618 103
488 3300025949 Ga0207667_10475744 Ga0207667_104757442 103
489 3300025949 Ga0207667_10602266 Ga0207667_106022662 103
490 3300026078 Ga0207702_10196051 Ga0207702_101960512 103
491 3300028800 Ga0265338_10014917 Ga0265338_100149178 103
492 3300028800 Ga0265338_10052738 Ga0265338_100527382 103
493 3300028800 Ga0265338_10056915 Ga0265338_100569153 103
494 3300028800 Ga0265338_10161091 Ga0265338_101610912 103
495 3300028800 Ga0265338_10164231 Ga0265338_101642312 103
496 3300030521 Ga0307511_10152622 Ga0307511_101526222 103
497 3300031240 Ga0265320_10001914 Ga0265320_100019145 103
498 3300031241 Ga0265325_10053350 Ga0265325_100533501 103
499 3300031241 Ga0265325_10220027 Ga0265325_102200272 103
500 3300031249 Ga0265339_10458740 Ga0265339_104587401 103
501 3300031595 Ga0265313_10439808 Ga0265313_104398082 103
502 3300031712 Ga0265342_10174611 Ga0265342_101746112 103
503 3300035117 Ga0373953_0161213 Ga0373953_0161213_205_516 103
504 3300035118 Ga0373954_0163539 Ga0373954_0163539_274_585 103
505 3300035118 Ga0373954_0631578 Ga0373954_0631578_185_496 103
506 3300035119 Ga0373956_0135670 Ga0373956_0135670_596_907 103
507 3300035119 Ga0373956_0522807 Ga0373956_0522807_221_532 103
508 3300035172 Ga0373955_0223979 Ga0373955_0223979_597_908 103
509 3300035410 Ga0373924_0133121 Ga0373924_0133121_375_686 103
510 3300035724 Ga0373933_0681547 Ga0373933_0681547_82_393 103
511 3300036401 Ga0373937_0808742 Ga0373937_0808742_483_794 103
512 3300044684 Ga0466966_0105170 Ga0466966_0105170_367_678 103
513 3300044712 Ga0453684_0010898 Ga0453684_0010898_9545_9856 103
514 3300044712 Ga0453684_0269000 Ga0453684_0269000_634_945 103
515 3300044712 Ga0453684_0670742 Ga0453684_0670742_565_876 103
516 3300045051 Ga0451576_0704040 Ga0451576_0704040_36_347 103
517 3300046454 Ga0495592_0069909 Ga0495592_0069909_78_389 103
518 3300046463 Ga0495653_0561959 Ga0495653_0561959_148_459 103
519 3300046476 Ga0495662_0287043 Ga0495662_0287043_228_539 103
520 3300046477 Ga0495664_0641137 Ga0495664_0641137_274_585 103
521 3300046499 Ga0495594_0806493 Ga0495594_0806493_96_407 103
522 3300046514 Ga0495618_0778831 Ga0495618_0778831_153_464 103
523 3300046516 Ga0495628_0448802 Ga0495628_0448802_593_904 103
524 3300046517 Ga0495630_0498982 Ga0495630_0498982_313_624 103
525 3300046517 Ga0495630_1217769 Ga0495630_1217769_121_432 103
526 3300046529 Ga0495652_0590090 Ga0495652_0590090_171_482 103
527 3300046533 Ga0495640_0555944 Ga0495640_0555944_327_638 103
528 3300046543 Ga0495645_0288340 Ga0495645_0288340_405_716 103
529 3300046616 Ga0495668_0314033 Ga0495668_0314033_169_480 103
530 3300046663 Ga0495635_0325099 Ga0495635_0325099_417_728 103
531 3300046678 Ga0495599_0126535 Ga0495599_0126535_44_355 103
532 3300046684 Ga0495669_0039944 Ga0495669_0039944_832_1143 103
533 3300047317 Ga0495604_0352841 Ga0495604_0352841_508_819 103
534 3300047319 Ga0495674_0273840 Ga0495674_0273840_361_672 103
535 3300047471 Ga0495684_0326605 Ga0495684_0326605_347_658 103
536 3300048918 Ga0496115_0046825 Ga0496115_0046825_1961_2272 103
537 3300048918 Ga0496115_0235014 Ga0496115_0235014_198_509 103
538 3300061719 Ga0466962_0417796 Ga0466962_0417796_79_390 103
539 3300003320 rootH2_10251543 rootH2_102515432 104
540 3300005435 Ga0070714_100310679 Ga0070714_1003106792 104
541 3300009551 Ga0105238_11349338 Ga0105238_113493381 104
542 3300026075 Ga0207708_10203692 Ga0207708_102036922 104
543 3300031711 Ga0265314_10331276 Ga0265314_103312761 104
544 3300031730 Ga0307516_10608913 Ga0307516_106089132 104
545 3300035085 Ga0373929_0000348 Ga0373929_0000348_7077_7427 104
546 3300041463 Ga0451804_0589685 Ga0451804_0589685_133_447 104
547 3300042876 Ga0451577_0015292 Ga0451577_0015292_259_573 104
548 3300044712 Ga0453684_0113559 Ga0453684_0113559_486_800 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13601

HTH_34

Winged helix DNA-binding domain

18

96

0.99

PF12840

HTH_20

Helix-turn-helix domain

14

63

0.97

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

18

61

0.97

PF01047

MarR

MarR family

15

72

0.96

PF01022

HTH_5

Bacterial regulatory protein, arsR family

15

62

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l9t-assembly1.cif.gz_N model of human anaphase-promoting complex/cyclosome (apc/c-cdh1) with e2 ube2s poised for polyubiquitination where ube2s, apc2, and apc11 are modeled into low resolution density 0.9164 18 60
6c9t-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9117 17 93
8cll-assembly1.cif.gz_F structural insights into human tfiiic promoter recognition 0.8993 31 77
5h20-assembly1.cif.gz_A-2 x-ray structure of padr-like transcription factor from bacteroid fragilis 0.8971 10 98
6c2s-assembly2.cif.gz_C transcriptional repressor, cour, bound to a 23-mer dna duplex 0.8954 19 93
ID Description Score Start End Superfamily
af_Q57874_1_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9664 19 100 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9419 21 78 1.10.10.10
af_P64638_1_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9052 21 78 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9048 20 78 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8989 18 77 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0Q8UM00-F1-model_v4 MarR family transcriptional regulator 1.002 19 98 GO:0003700
AF-A0A7W7W4T9-F1-model_v4 DNA-binding MarR family transcriptional regulator 1.001 19 99 GO:0003677
AF-A0A535WYS1-F1-model_v4 Transcriptional regulator 0.9996 18 96
AF-A0A368LCJ6-F1-model_v4 MarR family transcriptional regulator 0.9987 19 97
AF-A0A448KFQ3-F1-model_v4 Helix-turn-helix domain 0.9983 18 96

Feature Viewer

pLDDT pTM Quality
94.36 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map