F462245
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 548 | 225 | 548 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300035085|Ga0373929_0000348|Ga0373929_0000348_7077_7427 |
| Length | 116 |
| Sequence | VNPDLFLQLDRVIHEKGRLAIMSMLAASPELSFTELRDALAMTDGNLTTHIRALQEEGFVAVAKSYQNKRPLTTCSLTAGGRKAFAEYIALLEQIVRQNKPPAVFYFVVQSINDKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 105 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 107 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 108 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 109 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 110 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 111 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 112 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 114 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 117 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 118 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 120 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 121 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 122 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 127 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 129 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 130 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 131 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 132 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 133 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 134 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 135 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 136 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 137 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 138 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 139 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 140 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 141 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 142 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 146 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 148 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 151 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 152 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 155 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 156 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 159 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 162 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 163 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 164 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 165 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 166 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 167 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 168 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 169 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 205 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 206 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 225 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.36 |
| Nodule | 0 |
| Rhizoplane | 0.73 |
| Rhizosphere | 98.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10251543 | 3300003320 | Bacteria | 1530 |
| 2 | Ga0070658_10211947 | 3300005327 | Unclassified | 1637 |
| 3 | Ga0070658_10768592 | 3300005327 | Unclassified | 837 |
| 4 | Ga0070690_100002129 | 3300005330 | Bacteria | 10577 |
| 5 | Ga0068869_100568915 | 3300005334 | Unclassified | 954 |
| 6 | Ga0070680_101444077 | 3300005336 | Bacteria | 596 |
| 7 | Ga0068868_100497576 | 3300005338 | Unclassified | 1067 |
| 8 | Ga0070689_100099838 | 3300005340 | Unclassified | 2296 |
| 9 | Ga0070691_10849526 | 3300005341 | Bacteria | 559 |
| 10 | Ga0070687_100014296 | 3300005343 | Bacteria | 3564 |
| 11 | Ga0070687_101255270 | 3300005343 | Unclassified | 548 |
| 12 | Ga0070688_100719582 | 3300005365 | Bacteria | 775 |
| 13 | Ga0070714_100001033 | 3300005435 | Bacteria | 19833 |
| 14 | Ga0070714_100310679 | 3300005435 | Unclassified | 1472 |
| 15 | Ga0070713_100022832 | 3300005436 | Bacteria | 4842 |
| 16 | Ga0070713_100918936 | 3300005436 | Unclassified | 842 |
| 17 | Ga0070713_101204219 | 3300005436 | Unclassified | 733 |
| 18 | Ga0070710_10877641 | 3300005437 | Unclassified | 646 |
| 19 | Ga0070711_100001133 | 3300005439 | Bacteria | 14260 |
| 20 | Ga0070711_100944116 | 3300005439 | Bacteria | 738 |
| 21 | Ga0070711_101078968 | 3300005439 | Unclassified | 691 |
| 22 | Ga0070700_101353651 | 3300005441 | Unclassified | 600 |
| 23 | Ga0070708_100168828 | 3300005445 | Unclassified | 2041 |
| 24 | Ga0070681_10054505 | 3300005458 | Unclassified | 3985 |
| 25 | Ga0070681_10098707 | 3300005458 | Bacteria | 2867 |
| 26 | Ga0070685_11022475 | 3300005466 | Unclassified | 621 |
| 27 | Ga0070706_101393449 | 3300005467 | Unclassified | 642 |
| 28 | Ga0070679_100111731 | 3300005530 | Bacteria | 2719 |
| 29 | Ga0070679_100384124 | 3300005530 | Unclassified | 1351 |
| 30 | Ga0070684_101023586 | 3300005535 | Bacteria | 775 |
| 31 | Ga0068853_101588407 | 3300005539 | Bacteria | 634 |
| 32 | Ga0070686_101160828 | 3300005544 | Unclassified | 640 |
| 33 | Ga0070693_100340851 | 3300005547 | Unclassified | 1023 |
| 34 | Ga0068855_100030384 | 3300005563 | Bacteria | 6463 |
| 35 | Ga0068855_100081250 | 3300005563 | Unclassified | 3757 |
| 36 | Ga0068855_100095627 | 3300005563 | Unclassified | 3424 |
| 37 | Ga0068855_100688857 | 3300005563 | Bacteria | 1095 |
| 38 | Ga0068855_100721559 | 3300005563 | Unclassified | 1065 |
| 39 | Ga0068855_100886038 | 3300005563 | Bacteria | 943 |
| 40 | Ga0068857_100051795 | 3300005577 | Unclassified | 3643 |
| 41 | Ga0068857_101596636 | 3300005577 | Unclassified | 637 |
| 42 | Ga0068854_101421372 | 3300005578 | Bacteria | 628 |
| 43 | Ga0068856_100000017 | 3300005614 | Bacteria | 154589 |
| 44 | Ga0068856_100017053 | 3300005614 | Bacteria | 7040 |
| 45 | Ga0068856_100978463 | 3300005614 | Bacteria | 865 |
| 46 | Ga0068856_101573793 | 3300005614 | Unclassified | 671 |
| 47 | Ga0068856_101968084 | 3300005614 | Bacteria | 595 |
| 48 | Ga0068856_102651687 | 3300005614 | Unclassified | 507 |
| 49 | Ga0070702_100047054 | 3300005615 | Unclassified | 2448 |
| 50 | Ga0068859_100133363 | 3300005617 | Bacteria | 2556 |
| 51 | Ga0068859_100705960 | 3300005617 | Bacteria | 1099 |
| 52 | Ga0068859_100736603 | 3300005617 | Bacteria | 1075 |
| 53 | Ga0068859_101426724 | 3300005617 | Bacteria | 764 |
| 54 | Ga0068859_101621239 | 3300005617 | Unclassified | 715 |
| 55 | Ga0068859_102867031 | 3300005617 | Unclassified | 528 |
| 56 | Ga0068864_100635560 | 3300005618 | Unclassified | 1038 |
| 57 | Ga0068866_10035949 | 3300005718 | Unclassified | 2423 |
| 58 | Ga0068851_10125965 | 3300005834 | Bacteria | 1381 |
| 59 | Ga0068863_100220329 | 3300005841 | Bacteria | 1828 |
| 60 | Ga0068863_100334151 | 3300005841 | Bacteria | 1473 |
| 61 | Ga0068863_100771218 | 3300005841 | Unclassified | 958 |
| 62 | Ga0068858_100466842 | 3300005842 | Bacteria | 1217 |
| 63 | Ga0068858_100572382 | 3300005842 | Unclassified | 1094 |
| 64 | Ga0068858_101740071 | 3300005842 | Bacteria | 616 |
| 65 | Ga0070715_10180916 | 3300006163 | Bacteria | 1057 |
| 66 | Ga0070712_100729529 | 3300006175 | Unclassified | 847 |
| 67 | Ga0097621_100053105 | 3300006237 | Bacteria | 3303 |
| 68 | Ga0097621_100534904 | 3300006237 | Unclassified | 1065 |
| 69 | Ga0097621_100535535 | 3300006237 | Bacteria | 1065 |
| 70 | Ga0097621_100687658 | 3300006237 | Bacteria | 941 |
| 71 | Ga0097621_101064026 | 3300006237 | Unclassified | 758 |
| 72 | Ga0068871_100049844 | 3300006358 | Bacteria | 3386 |
| 73 | Ga0068871_100234696 | 3300006358 | Unclassified | 1593 |
| 74 | Ga0068871_100272728 | 3300006358 | Bacteria | 1478 |
| 75 | Ga0068871_100615568 | 3300006358 | Bacteria | 989 |
| 76 | Ga0075428_100904884 | 3300006844 | Archaea | 936 |
| 77 | Ga0075431_100070025 | 3300006847 | Archaea | 3619 |
| 78 | Ga0075434_100447965 | 3300006871 | Bacteria | 1312 |
| 79 | Ga0075429_100337453 | 3300006880 | Archaea | 1319 |
| 80 | Ga0068865_100274295 | 3300006881 | Unclassified | 1340 |
| 81 | Ga0075436_100648059 | 3300006914 | Unclassified | 780 |
| 82 | Ga0097620_100133369 | 3300006931 | Bacteria | 2556 |
| 83 | Ga0097620_100705935 | 3300006931 | Bacteria | 1099 |
| 84 | Ga0097620_100736655 | 3300006931 | Bacteria | 1075 |
| 85 | Ga0097620_101426800 | 3300006931 | Bacteria | 764 |
| 86 | Ga0097620_101621172 | 3300006931 | Unclassified | 715 |
| 87 | Ga0097620_102867029 | 3300006931 | Unclassified | 528 |
| 88 | Ga0075435_100568981 | 3300007076 | Unclassified | 982 |
| 89 | Ga0075435_101511504 | 3300007076 | Bacteria | 589 |
| 90 | Ga0105240_10048613 | 3300009093 | Bacteria | 5360 |
| 91 | Ga0105240_10147342 | 3300009093 | Bacteria | 2807 |
| 92 | Ga0105240_10247869 | 3300009093 | Bacteria | 2062 |
| 93 | Ga0105240_10324523 | 3300009093 | Bacteria | 1754 |
| 94 | Ga0105240_10501278 | 3300009093 | Bacteria | 1350 |
| 95 | Ga0105240_10784319 | 3300009093 | Unclassified | 1033 |
| 96 | Ga0105240_10887825 | 3300009093 | Bacteria | 960 |
| 97 | Ga0111539_10112968 | 3300009094 | Unclassified | 3186 |
| 98 | Ga0111539_10823064 | 3300009094 | Unclassified | 1080 |
| 99 | Ga0105245_10132000 | 3300009098 | Unclassified | 2344 |
| 100 | Ga0105245_10952583 | 3300009098 | Unclassified | 901 |
| 101 | Ga0114129_12940037 | 3300009147 | Unclassified | 562 |
| 102 | Ga0105241_10861740 | 3300009174 | Bacteria | 839 |
| 103 | Ga0105242_10121585 | 3300009176 | Unclassified | 2242 |
| 104 | Ga0105248_10546754 | 3300009177 | Bacteria | 1306 |
| 105 | Ga0105248_10821664 | 3300009177 | Bacteria | 1049 |
| 106 | Ga0105248_10889663 | 3300009177 | Bacteria | 1005 |
| 107 | Ga0105248_11021961 | 3300009177 | Bacteria | 934 |
| 108 | Ga0105248_12539012 | 3300009177 | Unclassified | 584 |
| 109 | Ga0105248_13220435 | 3300009177 | Unclassified | 519 |
| 110 | Ga0105237_10935361 | 3300009545 | Unclassified | 874 |
| 111 | Ga0105237_12053638 | 3300009545 | Unclassified | 580 |
| 112 | Ga0105238_10017171 | 3300009551 | Bacteria | 7349 |
| 113 | Ga0105238_10039954 | 3300009551 | Bacteria | 4755 |
| 114 | Ga0105238_10054936 | 3300009551 | Bacteria | 3999 |
| 115 | Ga0105238_10158439 | 3300009551 | Unclassified | 2239 |
| 116 | Ga0105238_11178361 | 3300009551 | Unclassified | 790 |
| 117 | Ga0105238_11349338 | 3300009551 | Bacteria | 740 |
| 118 | Ga0105249_11947881 | 3300009553 | Unclassified | 660 |
| 119 | Ga0105239_12652995 | 3300010375 | Unclassified | 584 |
| 120 | Ga0105246_10253222 | 3300011119 | Unclassified | 1399 |
| 121 | Ga0105246_12232882 | 3300011119 | Unclassified | 533 |
| 122 | Ga0157370_10291479 | 3300013104 | Unclassified | 1507 |
| 123 | Ga0157369_10814740 | 3300013105 | Bacteria | 959 |
| 124 | Ga0157374_10101521 | 3300013296 | Bacteria | 2758 |
| 125 | Ga0157374_10574304 | 3300013296 | Unclassified | 1136 |
| 126 | Ga0157374_10649577 | 3300013296 | Bacteria | 1067 |
| 127 | Ga0157374_10794599 | 3300013296 | Bacteria | 962 |
| 128 | Ga0157374_11537911 | 3300013296 | Bacteria | 689 |
| 129 | Ga0157374_11628977 | 3300013296 | Unclassified | 670 |
| 130 | Ga0157378_11162158 | 3300013297 | Bacteria | 810 |
| 131 | Ga0163162_11039653 | 3300013306 | Unclassified | 927 |
| 132 | Ga0163162_12747317 | 3300013306 | Unclassified | 567 |
| 133 | Ga0163162_12826550 | 3300013306 | Bacteria | 559 |
| 134 | Ga0163162_13006015 | 3300013306 | Bacteria | 542 |
| 135 | Ga0157372_10409459 | 3300013307 | Bacteria | 1580 |
| 136 | Ga0157372_11107833 | 3300013307 | Unclassified | 916 |
| 137 | Ga0157372_11604449 | 3300013307 | Bacteria | 749 |
| 138 | Ga0157375_10042780 | 3300013308 | Bacteria | 4387 |
| 139 | Ga0157375_10420412 | 3300013308 | Bacteria | 1503 |
| 140 | Ga0157375_10610364 | 3300013308 | Unclassified | 1249 |
| 141 | Ga0163163_10000010 | 3300014325 | Bacteria | 264773 |
| 142 | Ga0163163_10133090 | 3300014325 | Unclassified | 2527 |
| 143 | Ga0163163_10822775 | 3300014325 | Bacteria | 992 |
| 144 | Ga0157380_11743477 | 3300014326 | Bacteria | 681 |
| 145 | Ga0157377_10652579 | 3300014745 | Bacteria | 758 |
| 146 | Ga0157379_10702592 | 3300014968 | Bacteria | 949 |
| 147 | Ga0157376_10363863 | 3300014969 | Bacteria | 1388 |
| 148 | Ga0157376_11588487 | 3300014969 | Unclassified | 688 |
| 149 | Ga0207656_10349333 | 3300025321 | Bacteria | 738 |
| 150 | Ga0207692_10461127 | 3300025898 | Unclassified | 801 |
| 151 | Ga0207699_11143049 | 3300025906 | Bacteria | 577 |
| 152 | Ga0207699_11414192 | 3300025906 | Unclassified | 515 |
| 153 | Ga0207705_10504898 | 3300025909 | Bacteria | 939 |
| 154 | Ga0207707_10245369 | 3300025912 | Bacteria | 1556 |
| 155 | Ga0207707_10281890 | 3300025912 | Unclassified | 1439 |
| 156 | Ga0207695_10059235 | 3300025913 | Bacteria | 3972 |
| 157 | Ga0207695_10083854 | 3300025913 | Bacteria | 3219 |
| 158 | Ga0207695_10096397 | 3300025913 | Unclassified | 2960 |
| 159 | Ga0207671_11572106 | 3300025914 | Unclassified | 506 |
| 160 | Ga0207693_10255937 | 3300025915 | Unclassified | 1373 |
| 161 | Ga0207693_10617418 | 3300025915 | Unclassified | 843 |
| 162 | Ga0207663_10009822 | 3300025916 | Bacteria | 5064 |
| 163 | Ga0207662_10054301 | 3300025918 | Unclassified | 2389 |
| 164 | Ga0207662_10785284 | 3300025918 | Unclassified | 671 |
| 165 | Ga0207652_10592950 | 3300025921 | Unclassified | 994 |
| 166 | Ga0207646_11411551 | 3300025922 | Unclassified | 605 |
| 167 | Ga0207694_10003771 | 3300025924 | Bacteria | 12004 |
| 168 | Ga0207694_10009450 | 3300025924 | Bacteria | 7349 |
| 169 | Ga0207694_10058365 | 3300025924 | Bacteria | 3001 |
| 170 | Ga0207694_10105331 | 3300025924 | Unclassified | 2239 |
| 171 | Ga0207659_10658745 | 3300025926 | Unclassified | 895 |
| 172 | Ga0207700_11742558 | 3300025928 | Bacteria | 549 |
| 173 | Ga0207700_11775799 | 3300025928 | Unclassified | 543 |
| 174 | Ga0207664_10000746 | 3300025929 | Bacteria | 22125 |
| 175 | Ga0207706_10729885 | 3300025933 | Bacteria | 845 |
| 176 | Ga0207686_10398525 | 3300025934 | Unclassified | 1048 |
| 177 | Ga0207670_10047403 | 3300025936 | Unclassified | 2862 |
| 178 | Ga0207704_10549061 | 3300025938 | Unclassified | 939 |
| 179 | Ga0207711_11427100 | 3300025941 | Unclassified | 635 |
| 180 | Ga0207689_10497059 | 3300025942 | Unclassified | 1022 |
| 181 | Ga0207667_10044512 | 3300025949 | Unclassified | 4703 |
| 182 | Ga0207667_10431843 | 3300025949 | Unclassified | 1339 |
| 183 | Ga0207667_10475744 | 3300025949 | Bacteria | 1268 |
| 184 | Ga0207667_10602266 | 3300025949 | Bacteria | 1108 |
| 185 | Ga0207667_10641948 | 3300025949 | Unclassified | 1068 |
| 186 | Ga0207651_12035064 | 3300025960 | Unclassified | 516 |
| 187 | Ga0207712_10449765 | 3300025961 | Bacteria | 1092 |
| 188 | Ga0207703_10257118 | 3300026035 | Unclassified | 1577 |
| 189 | Ga0207703_10431479 | 3300026035 | Bacteria | 1228 |
| 190 | Ga0207708_10203692 | 3300026075 | Bacteria | 1579 |
| 191 | Ga0207702_10000630 | 3300026078 | Bacteria | 38742 |
| 192 | Ga0207702_10011100 | 3300026078 | Bacteria | 7519 |
| 193 | Ga0207702_10196051 | 3300026078 | Bacteria | 1869 |
| 194 | Ga0207702_10388237 | 3300026078 | Unclassified | 1344 |
| 195 | Ga0207641_11305506 | 3300026088 | Bacteria | 726 |
| 196 | Ga0207648_10147735 | 3300026089 | Unclassified | 2074 |
| 197 | Ga0207676_10498592 | 3300026095 | Bacteria | 1156 |
| 198 | Ga0207674_10065691 | 3300026116 | Unclassified | 3656 |
| 199 | Ga0207428_10735596 | 3300027907 | Unclassified | 704 |
| 200 | Ga0268265_10851376 | 3300028380 | Unclassified | 892 |
| 201 | Ga0265337_1000210 | 3300028556 | Bacteria | 31339 |
| 202 | Ga0265337_1001805 | 3300028556 | Bacteria | 10278 |
| 203 | Ga0265337_1004707 | 3300028556 | Bacteria | 5607 |
| 204 | Ga0265337_1004917 | 3300028556 | Bacteria | 5440 |
| 205 | Ga0265337_1006396 | 3300028556 | Bacteria | 4551 |
| 206 | Ga0265337_1008070 | 3300028556 | Unclassified | 3868 |
| 207 | Ga0265337_1053246 | 3300028556 | Bacteria | 1135 |
| 208 | Ga0265326_10000722 | 3300028558 | Bacteria | 12193 |
| 209 | Ga0265326_10009025 | 3300028558 | Unclassified | 2987 |
| 210 | Ga0265326_10023695 | 3300028558 | Unclassified | 1754 |
| 211 | Ga0265326_10037819 | 3300028558 | Bacteria | 1372 |
| 212 | Ga0265326_10041600 | 3300028558 | Bacteria | 1305 |
| 213 | Ga0265319_1031529 | 3300028563 | Unclassified | 1845 |
| 214 | Ga0265319_1066093 | 3300028563 | Bacteria | 1165 |
| 215 | Ga0265334_10013593 | 3300028573 | Unclassified | 3406 |
| 216 | Ga0265334_10019726 | 3300028573 | Unclassified | 2769 |
| 217 | Ga0265334_10154527 | 3300028573 | Unclassified | 808 |
| 218 | Ga0265334_10311898 | 3300028573 | Unclassified | 538 |
| 219 | Ga0265318_10009290 | 3300028577 | Unclassified | 4331 |
| 220 | Ga0265318_10031152 | 3300028577 | Bacteria | 2070 |
| 221 | Ga0265318_10084650 | 3300028577 | Bacteria | 1169 |
| 222 | Ga0265323_10000312 | 3300028653 | Bacteria | 28043 |
| 223 | Ga0265323_10016950 | 3300028653 | Unclassified | 2837 |
| 224 | Ga0265323_10028204 | 3300028653 | Bacteria | 2106 |
| 225 | Ga0265323_10054921 | 3300028653 | Bacteria | 1402 |
| 226 | Ga0265323_10090757 | 3300028653 | Bacteria | 1021 |
| 227 | Ga0265323_10131820 | 3300028653 | Bacteria | 809 |
| 228 | Ga0265322_10032669 | 3300028654 | Unclassified | 1484 |
| 229 | Ga0265322_10033400 | 3300028654 | Bacteria | 1467 |
| 230 | Ga0265322_10055438 | 3300028654 | Bacteria | 1124 |
| 231 | Ga0265322_10062552 | 3300028654 | Unclassified | 1056 |
| 232 | Ga0265322_10068535 | 3300028654 | Bacteria | 1006 |
| 233 | Ga0265336_10002219 | 3300028666 | Bacteria | 8163 |
| 234 | Ga0265336_10004034 | 3300028666 | Bacteria | 5595 |
| 235 | Ga0265336_10013027 | 3300028666 | Bacteria | 2782 |
| 236 | Ga0265336_10023395 | 3300028666 | Bacteria | 1959 |
| 237 | Ga0265336_10091841 | 3300028666 | Unclassified | 905 |
| 238 | Ga0265338_10000160 | 3300028800 | Bacteria | 122713 |
| 239 | Ga0265338_10000310 | 3300028800 | Bacteria | 88170 |
| 240 | Ga0265338_10000433 | 3300028800 | Bacteria | 75181 |
| 241 | Ga0265338_10000626 | 3300028800 | Bacteria | 61483 |
| 242 | Ga0265338_10000988 | 3300028800 | Bacteria | 47929 |
| 243 | Ga0265338_10001793 | 3300028800 | Bacteria | 33791 |
| 244 | Ga0265338_10002328 | 3300028800 | Bacteria | 28735 |
| 245 | Ga0265338_10009937 | 3300028800 | Bacteria | 11248 |
| 246 | Ga0265338_10014917 | 3300028800 | Bacteria | 8592 |
| 247 | Ga0265338_10015696 | 3300028800 | Bacteria | 8300 |
| 248 | Ga0265338_10020032 | 3300028800 | Bacteria | 7056 |
| 249 | Ga0265338_10020503 | 3300028800 | Bacteria | 6949 |
| 250 | Ga0265338_10030959 | 3300028800 | Bacteria | 5256 |
| 251 | Ga0265338_10040841 | 3300028800 | Unclassified | 4350 |
| 252 | Ga0265338_10052738 | 3300028800 | Bacteria | 3646 |
| 253 | Ga0265338_10056915 | 3300028800 | Bacteria | 3463 |
| 254 | Ga0265338_10065623 | 3300028800 | Bacteria | 3147 |
| 255 | Ga0265338_10090678 | 3300028800 | Unclassified | 2529 |
| 256 | Ga0265338_10160436 | 3300028800 | Unclassified | 1737 |
| 257 | Ga0265338_10161091 | 3300028800 | Bacteria | 1733 |
| 258 | Ga0265338_10164231 | 3300028800 | Bacteria | 1711 |
| 259 | Ga0265338_10246153 | 3300028800 | Unclassified | 1321 |
| 260 | Ga0265338_10319209 | 3300028800 | Unclassified | 1125 |
| 261 | Ga0265338_10367945 | 3300028800 | Bacteria | 1030 |
| 262 | Ga0265338_10403627 | 3300028800 | Unclassified | 974 |
| 263 | Ga0265338_10520859 | 3300028800 | Unclassified | 835 |
| 264 | Ga0265338_10603714 | 3300028800 | Unclassified | 764 |
| 265 | Ga0265324_10000170 | 3300029957 | Bacteria | 50529 |
| 266 | Ga0265324_10000403 | 3300029957 | Bacteria | 31109 |
| 267 | Ga0265324_10022337 | 3300029957 | Unclassified | 2262 |
| 268 | Ga0265324_10032028 | 3300029957 | Unclassified | 1839 |
| 269 | Ga0265324_10039022 | 3300029957 | Bacteria | 1647 |
| 270 | Ga0265324_10039117 | 3300029957 | Bacteria | 1644 |
| 271 | Ga0265324_10119079 | 3300029957 | Bacteria | 897 |
| 272 | Ga0265324_10145797 | 3300029957 | Bacteria | 804 |
| 273 | Ga0307511_10152622 | 3300030521 | Bacteria | 1321 |
| 274 | Ga0265330_10187486 | 3300031235 | Unclassified | 876 |
| 275 | Ga0265332_10018121 | 3300031238 | Unclassified | 3105 |
| 276 | Ga0265320_10000886 | 3300031240 | Bacteria | 22561 |
| 277 | Ga0265320_10001914 | 3300031240 | Bacteria | 14713 |
| 278 | Ga0265320_10007127 | 3300031240 | Bacteria | 6970 |
| 279 | Ga0265320_10014563 | 3300031240 | Bacteria | 4471 |
| 280 | Ga0265320_10018983 | 3300031240 | Bacteria | 3770 |
| 281 | Ga0265320_10061198 | 3300031240 | Unclassified | 1795 |
| 282 | Ga0265320_10207035 | 3300031240 | Bacteria | 875 |
| 283 | Ga0265320_10279899 | 3300031240 | Unclassified | 739 |
| 284 | Ga0265320_10315754 | 3300031240 | Bacteria | 691 |
| 285 | Ga0265320_10487271 | 3300031240 | Unclassified | 544 |
| 286 | Ga0265325_10017329 | 3300031241 | Bacteria | 4006 |
| 287 | Ga0265325_10019440 | 3300031241 | Bacteria | 3754 |
| 288 | Ga0265325_10048881 | 3300031241 | Bacteria | 2184 |
| 289 | Ga0265325_10053350 | 3300031241 | Unclassified | 2073 |
| 290 | Ga0265325_10220027 | 3300031241 | Bacteria | 869 |
| 291 | Ga0265340_10000209 | 3300031247 | Bacteria | 29637 |
| 292 | Ga0265340_10018649 | 3300031247 | Unclassified | 3578 |
| 293 | Ga0265340_10131792 | 3300031247 | Bacteria | 1146 |
| 294 | Ga0265340_10303458 | 3300031247 | Bacteria | 708 |
| 295 | Ga0265339_10032070 | 3300031249 | Bacteria | 2965 |
| 296 | Ga0265339_10038991 | 3300031249 | Bacteria | 2647 |
| 297 | Ga0265339_10448231 | 3300031249 | Unclassified | 599 |
| 298 | Ga0265339_10458740 | 3300031249 | Bacteria | 591 |
| 299 | Ga0265339_10588681 | 3300031249 | Bacteria | 510 |
| 300 | Ga0265331_10399138 | 3300031250 | Bacteria | 617 |
| 301 | Ga0265327_10010372 | 3300031251 | Bacteria | 6561 |
| 302 | Ga0265327_10038719 | 3300031251 | Bacteria | 2598 |
| 303 | Ga0265327_10070581 | 3300031251 | Bacteria | 1750 |
| 304 | Ga0265316_10023093 | 3300031344 | Bacteria | 5229 |
| 305 | Ga0265316_10049083 | 3300031344 | Bacteria | 3326 |
| 306 | Ga0265316_10073158 | 3300031344 | Unclassified | 2640 |
| 307 | Ga0265316_10116873 | 3300031344 | Bacteria | 2016 |
| 308 | Ga0265316_10178126 | 3300031344 | Bacteria | 1583 |
| 309 | Ga0265316_10245663 | 3300031344 | Unclassified | 1315 |
| 310 | Ga0265316_10335651 | 3300031344 | Bacteria | 1096 |
| 311 | Ga0265316_10414104 | 3300031344 | Bacteria | 969 |
| 312 | Ga0265316_10845954 | 3300031344 | Bacteria | 640 |
| 313 | Ga0265316_10851179 | 3300031344 | Unclassified | 638 |
| 314 | Ga0265316_10997165 | 3300031344 | Unclassified | 583 |
| 315 | Ga0265313_10003416 | 3300031595 | Bacteria | 12863 |
| 316 | Ga0265313_10439808 | 3300031595 | Bacteria | 508 |
| 317 | Ga0265314_10007829 | 3300031711 | Bacteria | 9232 |
| 318 | Ga0265314_10018966 | 3300031711 | Bacteria | 5338 |
| 319 | Ga0265314_10031202 | 3300031711 | Unclassified | 3937 |
| 320 | Ga0265314_10098494 | 3300031711 | Bacteria | 1886 |
| 321 | Ga0265314_10296348 | 3300031711 | Bacteria | 909 |
| 322 | Ga0265314_10330187 | 3300031711 | Unclassified | 846 |
| 323 | Ga0265314_10331276 | 3300031711 | Unclassified | 844 |
| 324 | Ga0265314_10503947 | 3300031711 | Unclassified | 637 |
| 325 | Ga0265342_10020872 | 3300031712 | Unclassified | 4191 |
| 326 | Ga0265342_10133485 | 3300031712 | Unclassified | 1389 |
| 327 | Ga0265342_10174611 | 3300031712 | Bacteria | 1180 |
| 328 | Ga0265342_10399182 | 3300031712 | Bacteria | 710 |
| 329 | Ga0316576_10727874 | 3300031727 | Bacteria | 718 |
| 330 | Ga0316578_10080391 | 3300031728 | Bacteria | 1939 |
| 331 | Ga0307516_10608913 | 3300031730 | Bacteria | 747 |
| 332 | Ga0373930_0001337 | 3300034816 | Bacteria | 3634 |
| 333 | Ga0373950_0016686 | 3300034818 | Bacteria | 1258 |
| 334 | Ga0373938_0026708 | 3300034957 | Bacteria | 1210 |
| 335 | Ga0373926_0256861 | 3300035083 | Unclassified | 678 |
| 336 | Ga0373926_0336500 | 3300035083 | Unclassified | 592 |
| 337 | Ga0373928_0000009 | 3300035084 | Bacteria | 32800 |
| 338 | Ga0373929_0000348 | 3300035085 | Bacteria | 8656 |
| 339 | Ga0373929_0209622 | 3300035085 | Unclassified | 550 |
| 340 | Ga0373944_0000137 | 3300035089 | Bacteria | 14088 |
| 341 | Ga0373944_0255063 | 3300035089 | Bacteria | 648 |
| 342 | Ga0373949_0003669 | 3300035090 | Bacteria | 3604 |
| 343 | Ga0373951_0062769 | 3300035091 | Unclassified | 933 |
| 344 | Ga0373952_0258297 | 3300035092 | Unclassified | 530 |
| 345 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 346 | Ga0373941_0129099 | 3300035115 | Unclassified | 909 |
| 347 | Ga0373945_0015480 | 3300035116 | Bacteria | 2567 |
| 348 | Ga0373953_0158812 | 3300035117 | Unclassified | 971 |
| 349 | Ga0373953_0161213 | 3300035117 | Unclassified | 964 |
| 350 | Ga0373954_0072278 | 3300035118 | Bacteria | 1640 |
| 351 | Ga0373954_0163539 | 3300035118 | Bacteria | 1089 |
| 352 | Ga0373954_0631578 | 3300035118 | Unclassified | 531 |
| 353 | Ga0373956_0003802 | 3300035119 | Bacteria | 6067 |
| 354 | Ga0373956_0135670 | 3300035119 | Bacteria | 1154 |
| 355 | Ga0373956_0522807 | 3300035119 | Unclassified | 566 |
| 356 | Ga0373943_0194441 | 3300035170 | Bacteria | 1120 |
| 357 | Ga0373943_0688763 | 3300035170 | Unclassified | 605 |
| 358 | Ga0373955_0223979 | 3300035172 | Bacteria | 1124 |
| 359 | Ga0373962_0000056 | 3300035242 | Bacteria | 24939 |
| 360 | Ga0373924_0133121 | 3300035410 | Bacteria | 1082 |
| 361 | Ga0373931_0000002 | 3300035691 | Bacteria | 599830 |
| 362 | Ga0373931_0328930 | 3300035691 | Bacteria | 951 |
| 363 | Ga0373931_0432954 | 3300035691 | Bacteria | 838 |
| 364 | Ga0373935_0011690 | 3300035692 | Bacteria | 5272 |
| 365 | Ga0373935_0050915 | 3300035692 | Bacteria | 2629 |
| 366 | Ga0373935_0701539 | 3300035692 | Unclassified | 744 |
| 367 | Ga0373935_0910877 | 3300035692 | Unclassified | 651 |
| 368 | Ga0373927_0004818 | 3300035695 | Bacteria | 9381 |
| 369 | Ga0373927_0056614 | 3300035695 | Bacteria | 2535 |
| 370 | Ga0373933_0105459 | 3300035724 | Unclassified | 1753 |
| 371 | Ga0373933_0667897 | 3300035724 | Bacteria | 683 |
| 372 | Ga0373933_0681547 | 3300035724 | Bacteria | 676 |
| 373 | Ga0373947_0009161 | 3300035725 | Bacteria | 5691 |
| 374 | Ga0373947_0123677 | 3300035725 | Bacteria | 1645 |
| 375 | Ga0373947_0298002 | 3300035725 | Bacteria | 1075 |
| 376 | Ga0373947_0448265 | 3300035725 | Unclassified | 874 |
| 377 | Ga0373947_0872150 | 3300035725 | Unclassified | 614 |
| 378 | Ga0373937_0000659 | 3300036401 | Bacteria | 30219 |
| 379 | Ga0373937_0326662 | 3300036401 | Bacteria | 1452 |
| 380 | Ga0373937_0808742 | 3300036401 | Bacteria | 885 |
| 381 | Ga0373937_1013910 | 3300036401 | Bacteria | 779 |
| 382 | Ga0373937_1250376 | 3300036401 | Unclassified | 691 |
| 383 | Ga0373937_1458015 | 3300036401 | Bacteria | 632 |
| 384 | Ga0316582_0563628 | 3300036647 | Bacteria | 785 |
| 385 | Ga0316584_1155434 | 3300036712 | Unclassified | 512 |
| 386 | Ga0373925_0000121 | 3300037068 | Bacteria | 84624 |
| 387 | Ga0373925_0001575 | 3300037068 | Bacteria | 19287 |
| 388 | Ga0373925_0003106 | 3300037068 | Bacteria | 13030 |
| 389 | Ga0373925_1214742 | 3300037068 | Unclassified | 619 |
| 390 | Ga0395900_0089607 | 3300037418 | Unclassified | 3162 |
| 391 | Ga0395905_0012307 | 3300037471 | Bacteria | 8236 |
| 392 | Ga0451804_0589685 | 3300041463 | Unclassified | 680 |
| 393 | Ga0451577_0001517 | 3300042876 | Bacteria | 30610 |
| 394 | Ga0451577_0008776 | 3300042876 | Bacteria | 9798 |
| 395 | Ga0451577_0015292 | 3300042876 | Bacteria | 7141 |
| 396 | Ga0451577_0098140 | 3300042876 | Bacteria | 2617 |
| 397 | Ga0451577_1393957 | 3300042876 | Unclassified | 622 |
| 398 | Ga0453683_0148599 | 3300044673 | Unclassified | 1480 |
| 399 | Ga0453683_0287262 | 3300044673 | Unclassified | 1051 |
| 400 | Ga0466966_0105170 | 3300044684 | Bacteria | 1743 |
| 401 | Ga0453684_0010898 | 3300044712 | Bacteria | 15393 |
| 402 | Ga0453684_0049879 | 3300044712 | Bacteria | 5511 |
| 403 | Ga0453684_0113559 | 3300044712 | Bacteria | 3285 |
| 404 | Ga0453684_0269000 | 3300044712 | Bacteria | 1949 |
| 405 | Ga0453684_0303559 | 3300044712 | Bacteria | 1814 |
| 406 | Ga0453684_0670742 | 3300044712 | Bacteria | 1129 |
| 407 | Ga0453684_0887320 | 3300044712 | Bacteria | 956 |
| 408 | Ga0451576_0065865 | 3300045051 | Unclassified | 3772 |
| 409 | Ga0451576_0074318 | 3300045051 | Bacteria | 3537 |
| 410 | Ga0451576_0076812 | 3300045051 | Unclassified | 3476 |
| 411 | Ga0451576_0198541 | 3300045051 | Unclassified | 2095 |
| 412 | Ga0451576_0398633 | 3300045051 | Unclassified | 1443 |
| 413 | Ga0451576_0415804 | 3300045051 | Unclassified | 1411 |
| 414 | Ga0451576_0455047 | 3300045051 | Unclassified | 1344 |
| 415 | Ga0451576_0704040 | 3300045051 | Bacteria | 1061 |
| 416 | Ga0451576_0721477 | 3300045051 | Bacteria | 1047 |
| 417 | Ga0451576_0851743 | 3300045051 | Unclassified | 957 |
| 418 | Ga0451576_1081953 | 3300045051 | Bacteria | 839 |
| 419 | Ga0451576_1471604 | 3300045051 | Bacteria | 708 |
| 420 | Ga0451576_2051095 | 3300045051 | Unclassified | 589 |
| 421 | Ga0451576_2575901 | 3300045051 | Unclassified | 519 |
| 422 | Ga0495592_0000087 | 3300046454 | Bacteria | 81851 |
| 423 | Ga0495592_0069909 | 3300046454 | Bacteria | 2559 |
| 424 | Ga0495592_0247569 | 3300046454 | Unclassified | 1180 |
| 425 | Ga0495629_0166802 | 3300046459 | Unclassified | 1529 |
| 426 | Ga0495653_0561959 | 3300046463 | Bacteria | 705 |
| 427 | Ga0495582_0015399 | 3300046473 | Unclassified | 4201 |
| 428 | Ga0495639_0413466 | 3300046475 | Unclassified | 682 |
| 429 | Ga0495639_0475857 | 3300046475 | Unclassified | 636 |
| 430 | Ga0495662_0109798 | 3300046476 | Bacteria | 1351 |
| 431 | Ga0495662_0249652 | 3300046476 | Unclassified | 874 |
| 432 | Ga0495662_0287043 | 3300046476 | Unclassified | 810 |
| 433 | Ga0495664_0290587 | 3300046477 | Unclassified | 987 |
| 434 | Ga0495664_0641137 | 3300046477 | Bacteria | 630 |
| 435 | Ga0495594_0806493 | 3300046499 | Unclassified | 529 |
| 436 | Ga0495608_0223523 | 3300046511 | Unclassified | 1180 |
| 437 | Ga0495608_0549137 | 3300046511 | Bacteria | 696 |
| 438 | Ga0495618_0000575 | 3300046514 | Bacteria | 26127 |
| 439 | Ga0495618_0001019 | 3300046514 | Bacteria | 19204 |
| 440 | Ga0495618_0778831 | 3300046514 | Unclassified | 558 |
| 441 | Ga0495628_0000056 | 3300046516 | Bacteria | 89432 |
| 442 | Ga0495628_0330479 | 3300046516 | Unclassified | 1123 |
| 443 | Ga0495628_0448802 | 3300046516 | Bacteria | 937 |
| 444 | Ga0495628_0855126 | 3300046516 | Bacteria | 634 |
| 445 | Ga0495630_0000226 | 3300046517 | Bacteria | 44816 |
| 446 | Ga0495630_0016036 | 3300046517 | Bacteria | 5476 |
| 447 | Ga0495630_0033929 | 3300046517 | Bacteria | 3807 |
| 448 | Ga0495630_0481629 | 3300046517 | Unclassified | 951 |
| 449 | Ga0495630_0498982 | 3300046517 | Bacteria | 933 |
| 450 | Ga0495630_1205283 | 3300046517 | Unclassified | 572 |
| 451 | Ga0495630_1217769 | 3300046517 | Unclassified | 569 |
| 452 | Ga0495630_1431256 | 3300046517 | Unclassified | 519 |
| 453 | Ga0495666_0026314 | 3300046526 | Bacteria | 2869 |
| 454 | Ga0495666_0049944 | 3300046526 | Bacteria | 2011 |
| 455 | Ga0495652_0245292 | 3300046529 | Unclassified | 1330 |
| 456 | Ga0495652_0590090 | 3300046529 | Bacteria | 759 |
| 457 | Ga0495640_0004603 | 3300046533 | Bacteria | 11001 |
| 458 | Ga0495640_0144500 | 3300046533 | Bacteria | 1531 |
| 459 | Ga0495640_0246607 | 3300046533 | Bacteria | 1120 |
| 460 | Ga0495640_0377210 | 3300046533 | Unclassified | 873 |
| 461 | Ga0495640_0555944 | 3300046533 | Bacteria | 695 |
| 462 | Ga0495586_0000114 | 3300046535 | Bacteria | 48074 |
| 463 | Ga0495586_0000553 | 3300046535 | Bacteria | 21702 |
| 464 | Ga0495586_0003122 | 3300046535 | Bacteria | 8914 |
| 465 | Ga0495586_0005284 | 3300046535 | Bacteria | 6911 |
| 466 | Ga0495586_0033543 | 3300046535 | Unclassified | 2755 |
| 467 | Ga0495586_0051744 | 3300046535 | Bacteria | 2223 |
| 468 | Ga0495586_0360066 | 3300046535 | Bacteria | 836 |
| 469 | Ga0495586_0620675 | 3300046535 | Unclassified | 625 |
| 470 | Ga0495586_0722087 | 3300046535 | Unclassified | 575 |
| 471 | Ga0495587_0623296 | 3300046536 | Bacteria | 593 |
| 472 | Ga0495645_0029766 | 3300046543 | Unclassified | 3974 |
| 473 | Ga0495645_0119282 | 3300046543 | Bacteria | 1859 |
| 474 | Ga0495645_0288340 | 3300046543 | Bacteria | 1077 |
| 475 | Ga0495645_0521206 | 3300046543 | Unclassified | 740 |
| 476 | Ga0495645_0530826 | 3300046543 | Unclassified | 732 |
| 477 | Ga0495645_0788882 | 3300046543 | Bacteria | 571 |
| 478 | Ga0495667_0022084 | 3300046559 | Bacteria | 4289 |
| 479 | Ga0495667_0104607 | 3300046559 | Unclassified | 1830 |
| 480 | Ga0495668_0314033 | 3300046616 | Bacteria | 859 |
| 481 | Ga0495634_0002448 | 3300046642 | Bacteria | 15426 |
| 482 | Ga0495634_0027656 | 3300046642 | Unclassified | 3945 |
| 483 | Ga0495635_0292640 | 3300046663 | Bacteria | 1092 |
| 484 | Ga0495635_0325099 | 3300046663 | Bacteria | 1029 |
| 485 | Ga0495635_0610374 | 3300046663 | Bacteria | 712 |
| 486 | Ga0495599_0106958 | 3300046678 | Unclassified | 1743 |
| 487 | Ga0495599_0126535 | 3300046678 | Bacteria | 1588 |
| 488 | Ga0495599_0167575 | 3300046678 | Bacteria | 1356 |
| 489 | Ga0495599_0402560 | 3300046678 | Unclassified | 815 |
| 490 | Ga0495599_0780504 | 3300046678 | Bacteria | 547 |
| 491 | Ga0495647_0081453 | 3300046681 | Bacteria | 1313 |
| 492 | Ga0495658_0019066 | 3300046683 | Unclassified | 3576 |
| 493 | Ga0495658_0099958 | 3300046683 | Bacteria | 1730 |
| 494 | Ga0495658_0147455 | 3300046683 | Unclassified | 1443 |
| 495 | Ga0495658_0940724 | 3300046683 | Bacteria | 552 |
| 496 | Ga0495669_0039944 | 3300046684 | Bacteria | 2079 |
| 497 | Ga0495669_0233942 | 3300046684 | Unclassified | 882 |
| 498 | Ga0495613_0000632 | 3300046689 | Bacteria | 28018 |
| 499 | Ga0495613_0023520 | 3300046689 | Bacteria | 4591 |
| 500 | Ga0495613_0115584 | 3300046689 | Unclassified | 1930 |
| 501 | Ga0495613_0266984 | 3300046689 | Unclassified | 1191 |
| 502 | Ga0495613_0850974 | 3300046689 | Bacteria | 593 |
| 503 | Ga0495624_0072750 | 3300046690 | Unclassified | 2138 |
| 504 | Ga0495624_0076641 | 3300046690 | Bacteria | 2075 |
| 505 | Ga0495581_0031118 | 3300047315 | Unclassified | 3092 |
| 506 | Ga0495581_0292270 | 3300047315 | Bacteria | 953 |
| 507 | Ga0495604_0352841 | 3300047317 | Bacteria | 977 |
| 508 | Ga0495604_0887513 | 3300047317 | Unclassified | 558 |
| 509 | Ga0495674_0010420 | 3300047319 | Bacteria | 8801 |
| 510 | Ga0495674_0273840 | 3300047319 | Bacteria | 1384 |
| 511 | Ga0495674_0466067 | 3300047319 | Unclassified | 1014 |
| 512 | Ga0495676_0021470 | 3300047321 | Bacteria | 5637 |
| 513 | Ga0495680_0001937 | 3300047322 | Bacteria | 21766 |
| 514 | Ga0495680_0812124 | 3300047322 | Unclassified | 610 |
| 515 | Ga0495680_0964399 | 3300047322 | Unclassified | 547 |
| 516 | Ga0495684_0326605 | 3300047471 | Bacteria | 1095 |
| 517 | Ga0495684_0574419 | 3300047471 | Unclassified | 764 |
| 518 | Ga0495614_0050004 | 3300048089 | Bacteria | 1792 |
| 519 | Ga0495614_0313367 | 3300048089 | Unclassified | 727 |
| 520 | Ga0496112_0887547 | 3300048915 | Unclassified | 814 |
| 521 | Ga0496115_0046825 | 3300048918 | Bacteria | 3458 |
| 522 | Ga0496115_0235014 | 3300048918 | Bacteria | 1511 |
| 523 | Ga0501031_0042912 | 3300049568 | Bacteria | 2953 |
| 524 | Ga0501032_0995904 | 3300049569 | Bacteria | 526 |
| 525 | Ga0501033_0020698 | 3300049570 | Unclassified | 4971 |
| 526 | Ga0501034_0141318 | 3300049571 | Unclassified | 2387 |
| 527 | Ga0501036_0900262 | 3300049572 | Unclassified | 726 |
| 528 | Ga0501036_1104244 | 3300049572 | Bacteria | 648 |
| 529 | Ga0501043_0051513 | 3300049579 | Unclassified | 3235 |
| 530 | Ga0501047_0378712 | 3300049581 | Bacteria | 1250 |
| 531 | Ga0501080_0650112 | 3300049742 | Bacteria | 933 |
| 532 | Ga0501035_0213927 | 3300049822 | Bacteria | 1648 |
| 533 | Ga0501035_1065029 | 3300049822 | Unclassified | 633 |
| 534 | Ga0501044_0020029 | 3300049823 | Bacteria | 7143 |
| 535 | Ga0501044_0976545 | 3300049823 | Unclassified | 719 |
| 536 | nmdc:mga09592_257340_c1 | 3300050508 | Archaea | 1513 |
| 537 | nmdc:mga0qj67_371853_c1 | 3300050509 | Archaea | 1154 |
| 538 | nmdc:mga06r32_39429_c1 | 3300050510 | Unclassified | 4481 |
| 539 | nmdc:mga08y16_1187903_c1 | 3300050511 | Unclassified | 734 |
| 540 | nmdc:mga08y16_1393772_c1 | 3300050511 | Unclassified | 664 |
| 541 | nmdc:mga08y16_609313_c1 | 3300050511 | Unclassified | 1100 |
| 542 | nmdc:mga0rr50_1412458_c1 | 3300050513 | Bacteria | 589 |
| 543 | nmdc:mga08x19_568400_c1 | 3300050514 | Unclassified | 803 |
| 544 | Ga0495601_0746581 | 3300053077 | Unclassified | 623 |
| 545 | Ga0495612_0441493 | 3300053078 | Unclassified | 594 |
| 546 | Ga0500650_0115469 | 3300053098 | Bacteria | 1253 |
| 547 | Ga0500650_0238235 | 3300053098 | Bacteria | 819 |
| 548 | Ga0466962_0417796 | 3300061719 | Unclassified | 673 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025934 | Ga0207686_10398525 | Ga0207686_103985252 | 100 |
| 2 | 3300005327 | Ga0070658_10768592 | Ga0070658_107685921 | 101 |
| 3 | 3300005330 | Ga0070690_100002129 | Ga0070690_1000021297 | 101 |
| 4 | 3300005341 | Ga0070691_10849526 | Ga0070691_108495261 | 101 |
| 5 | 3300005539 | Ga0068853_101588407 | Ga0068853_1015884072 | 101 |
| 6 | 3300005563 | Ga0068855_100030384 | Ga0068855_1000303848 | 101 |
| 7 | 3300005563 | Ga0068855_100688857 | Ga0068855_1006888572 | 101 |
| 8 | 3300005614 | Ga0068856_100000017 | Ga0068856_10000001767 | 101 |
| 9 | 3300005614 | Ga0068856_100978463 | Ga0068856_1009784632 | 101 |
| 10 | 3300005614 | Ga0068856_101968084 | Ga0068856_1019680842 | 101 |
| 11 | 3300005718 | Ga0068866_10035949 | Ga0068866_100359494 | 101 |
| 12 | 3300006358 | Ga0068871_100049844 | Ga0068871_1000498444 | 101 |
| 13 | 3300009093 | Ga0105240_10247869 | Ga0105240_102478692 | 101 |
| 14 | 3300009551 | Ga0105238_10017171 | Ga0105238_100171717 | 101 |
| 15 | 3300009551 | Ga0105238_10054936 | Ga0105238_100549364 | 101 |
| 16 | 3300013296 | Ga0157374_10649577 | Ga0157374_106495772 | 101 |
| 17 | 3300013296 | Ga0157374_10794599 | Ga0157374_107945992 | 101 |
| 18 | 3300025913 | Ga0207695_10083854 | Ga0207695_100838543 | 101 |
| 19 | 3300025924 | Ga0207694_10009450 | Ga0207694_100094507 | 101 |
| 20 | 3300025924 | Ga0207694_10058365 | Ga0207694_100583653 | 101 |
| 21 | 3300025949 | Ga0207667_10044512 | Ga0207667_100445122 | 101 |
| 22 | 3300025949 | Ga0207667_10431843 | Ga0207667_104318432 | 101 |
| 23 | 3300025949 | Ga0207667_10641948 | Ga0207667_106419482 | 101 |
| 24 | 3300026078 | Ga0207702_10000630 | Ga0207702_1000063013 | 101 |
| 25 | 3300026078 | Ga0207702_10388237 | Ga0207702_103882372 | 101 |
| 26 | 3300028556 | Ga0265337_1001805 | Ga0265337_10018059 | 101 |
| 27 | 3300028558 | Ga0265326_10000722 | Ga0265326_100007227 | 101 |
| 28 | 3300028653 | Ga0265323_10090757 | Ga0265323_100907572 | 101 |
| 29 | 3300028666 | Ga0265336_10002219 | Ga0265336_100022196 | 101 |
| 30 | 3300028800 | Ga0265338_10000160 | Ga0265338_1000016067 | 101 |
| 31 | 3300028800 | Ga0265338_10000310 | Ga0265338_1000031048 | 101 |
| 32 | 3300028800 | Ga0265338_10000626 | Ga0265338_1000062650 | 101 |
| 33 | 3300029957 | Ga0265324_10000403 | Ga0265324_1000040320 | 101 |
| 34 | 3300029957 | Ga0265324_10039117 | Ga0265324_100391172 | 101 |
| 35 | 3300029957 | Ga0265324_10145797 | Ga0265324_101457972 | 101 |
| 36 | 3300031235 | Ga0265330_10187486 | Ga0265330_101874862 | 101 |
| 37 | 3300031240 | Ga0265320_10014563 | Ga0265320_100145632 | 101 |
| 38 | 3300031240 | Ga0265320_10487271 | Ga0265320_104872711 | 101 |
| 39 | 3300031249 | Ga0265339_10038991 | Ga0265339_100389913 | 101 |
| 40 | 3300031344 | Ga0265316_10178126 | Ga0265316_101781263 | 101 |
| 41 | 3300031711 | Ga0265314_10007829 | Ga0265314_100078296 | 101 |
| 42 | 3300031711 | Ga0265314_10098494 | Ga0265314_100984942 | 101 |
| 43 | 3300031711 | Ga0265314_10330187 | Ga0265314_103301872 | 101 |
| 44 | 3300037418 | Ga0395900_0089607 | Ga0395900_0089607_727_1038 | 101 |
| 45 | 3300037471 | Ga0395905_0012307 | Ga0395905_0012307_2107_2418 | 101 |
| 46 | 3300042876 | Ga0451577_0098140 | Ga0451577_0098140_1458_1763 | 101 |
| 47 | 3300044712 | Ga0453684_0303559 | Ga0453684_0303559_1249_1554 | 101 |
| 48 | 3300046543 | Ga0495645_0530826 | Ga0495645_0530826_329_634 | 101 |
| 49 | 3300050511 | nmdc:mga08y16_1393772_c1 | nmdc:mga08y16_1393772_c1_226_531 | 101 |
| 50 | 3300005334 | Ga0068869_100568915 | Ga0068869_1005689152 | 102 |
| 51 | 3300005340 | Ga0070689_100099838 | Ga0070689_1000998382 | 102 |
| 52 | 3300005343 | Ga0070687_100014296 | Ga0070687_1000142962 | 102 |
| 53 | 3300005343 | Ga0070687_101255270 | Ga0070687_1012552701 | 102 |
| 54 | 3300005365 | Ga0070688_100719582 | Ga0070688_1007195821 | 102 |
| 55 | 3300005436 | Ga0070713_100022832 | Ga0070713_1000228323 | 102 |
| 56 | 3300005436 | Ga0070713_100918936 | Ga0070713_1009189362 | 102 |
| 57 | 3300005436 | Ga0070713_101204219 | Ga0070713_1012042192 | 102 |
| 58 | 3300005437 | Ga0070710_10877641 | Ga0070710_108776411 | 102 |
| 59 | 3300005439 | Ga0070711_100001133 | Ga0070711_10000113311 | 102 |
| 60 | 3300005439 | Ga0070711_100944116 | Ga0070711_1009441162 | 102 |
| 61 | 3300005439 | Ga0070711_101078968 | Ga0070711_1010789682 | 102 |
| 62 | 3300005441 | Ga0070700_101353651 | Ga0070700_1013536512 | 102 |
| 63 | 3300005458 | Ga0070681_10098707 | Ga0070681_100987072 | 102 |
| 64 | 3300005466 | Ga0070685_11022475 | Ga0070685_110224751 | 102 |
| 65 | 3300005535 | Ga0070684_101023586 | Ga0070684_1010235862 | 102 |
| 66 | 3300005544 | Ga0070686_101160828 | Ga0070686_1011608282 | 102 |
| 67 | 3300005547 | Ga0070693_100340851 | Ga0070693_1003408511 | 102 |
| 68 | 3300005563 | Ga0068855_100721559 | Ga0068855_1007215592 | 102 |
| 69 | 3300005577 | Ga0068857_100051795 | Ga0068857_1000517953 | 102 |
| 70 | 3300005614 | Ga0068856_100017053 | Ga0068856_1000170537 | 102 |
| 71 | 3300005615 | Ga0070702_100047054 | Ga0070702_1000470542 | 102 |
| 72 | 3300005617 | Ga0068859_100133363 | Ga0068859_1001333633 | 102 |
| 73 | 3300005617 | Ga0068859_100705960 | Ga0068859_1007059602 | 102 |
| 74 | 3300005617 | Ga0068859_100736603 | Ga0068859_1007366031 | 102 |
| 75 | 3300005617 | Ga0068859_101426724 | Ga0068859_1014267242 | 102 |
| 76 | 3300005617 | Ga0068859_101621239 | Ga0068859_1016212391 | 102 |
| 77 | 3300005617 | Ga0068859_102867031 | Ga0068859_1028670312 | 102 |
| 78 | 3300005618 | Ga0068864_100635560 | Ga0068864_1006355602 | 102 |
| 79 | 3300005841 | Ga0068863_100220329 | Ga0068863_1002203292 | 102 |
| 80 | 3300005841 | Ga0068863_100334151 | Ga0068863_1003341513 | 102 |
| 81 | 3300005841 | Ga0068863_100771218 | Ga0068863_1007712182 | 102 |
| 82 | 3300005842 | Ga0068858_100466842 | Ga0068858_1004668422 | 102 |
| 83 | 3300005842 | Ga0068858_100572382 | Ga0068858_1005723822 | 102 |
| 84 | 3300005842 | Ga0068858_101740071 | Ga0068858_1017400712 | 102 |
| 85 | 3300006163 | Ga0070715_10180916 | Ga0070715_101809162 | 102 |
| 86 | 3300006175 | Ga0070712_100729529 | Ga0070712_1007295292 | 102 |
| 87 | 3300006237 | Ga0097621_100053105 | Ga0097621_1000531054 | 102 |
| 88 | 3300006237 | Ga0097621_100534904 | Ga0097621_1005349042 | 102 |
| 89 | 3300006237 | Ga0097621_100687658 | Ga0097621_1006876582 | 102 |
| 90 | 3300006237 | Ga0097621_101064026 | Ga0097621_1010640262 | 102 |
| 91 | 3300006358 | Ga0068871_100234696 | Ga0068871_1002346962 | 102 |
| 92 | 3300006358 | Ga0068871_100615568 | Ga0068871_1006155682 | 102 |
| 93 | 3300006844 | Ga0075428_100904884 | Ga0075428_1009048842 | 102 |
| 94 | 3300006847 | Ga0075431_100070025 | Ga0075431_1000700253 | 102 |
| 95 | 3300006871 | Ga0075434_100447965 | Ga0075434_1004479652 | 102 |
| 96 | 3300006880 | Ga0075429_100337453 | Ga0075429_1003374532 | 102 |
| 97 | 3300006881 | Ga0068865_100274295 | Ga0068865_1002742952 | 102 |
| 98 | 3300006914 | Ga0075436_100648059 | Ga0075436_1006480591 | 102 |
| 99 | 3300006931 | Ga0097620_100133369 | Ga0097620_1001333693 | 102 |
| 100 | 3300006931 | Ga0097620_100705935 | Ga0097620_1007059352 | 102 |
| 101 | 3300006931 | Ga0097620_100736655 | Ga0097620_1007366551 | 102 |
| 102 | 3300006931 | Ga0097620_101426800 | Ga0097620_1014268002 | 102 |
| 103 | 3300006931 | Ga0097620_101621172 | Ga0097620_1016211721 | 102 |
| 104 | 3300006931 | Ga0097620_102867029 | Ga0097620_1028670292 | 102 |
| 105 | 3300007076 | Ga0075435_100568981 | Ga0075435_1005689811 | 102 |
| 106 | 3300007076 | Ga0075435_101511504 | Ga0075435_1015115042 | 102 |
| 107 | 3300009093 | Ga0105240_10048613 | Ga0105240_100486134 | 102 |
| 108 | 3300009093 | Ga0105240_10147342 | Ga0105240_101473423 | 102 |
| 109 | 3300009093 | Ga0105240_10887825 | Ga0105240_108878252 | 102 |
| 110 | 3300009094 | Ga0111539_10112968 | Ga0111539_101129684 | 102 |
| 111 | 3300009094 | Ga0111539_10823064 | Ga0111539_108230642 | 102 |
| 112 | 3300009098 | Ga0105245_10132000 | Ga0105245_101320003 | 102 |
| 113 | 3300009098 | Ga0105245_10952583 | Ga0105245_109525831 | 102 |
| 114 | 3300009176 | Ga0105242_10121585 | Ga0105242_101215854 | 102 |
| 115 | 3300009177 | Ga0105248_10546754 | Ga0105248_105467541 | 102 |
| 116 | 3300009177 | Ga0105248_10821664 | Ga0105248_108216642 | 102 |
| 117 | 3300009177 | Ga0105248_10889663 | Ga0105248_108896632 | 102 |
| 118 | 3300009177 | Ga0105248_11021961 | Ga0105248_110219612 | 102 |
| 119 | 3300009177 | Ga0105248_12539012 | Ga0105248_125390121 | 102 |
| 120 | 3300009177 | Ga0105248_13220435 | Ga0105248_132204351 | 102 |
| 121 | 3300009545 | Ga0105237_10935361 | Ga0105237_109353612 | 102 |
| 122 | 3300009545 | Ga0105237_12053638 | Ga0105237_120536382 | 102 |
| 123 | 3300009551 | Ga0105238_10158439 | Ga0105238_101584392 | 102 |
| 124 | 3300009551 | Ga0105238_11178361 | Ga0105238_111783611 | 102 |
| 125 | 3300009553 | Ga0105249_11947881 | Ga0105249_119478812 | 102 |
| 126 | 3300011119 | Ga0105246_10253222 | Ga0105246_102532222 | 102 |
| 127 | 3300013296 | Ga0157374_10101521 | Ga0157374_101015212 | 102 |
| 128 | 3300013296 | Ga0157374_10574304 | Ga0157374_105743042 | 102 |
| 129 | 3300013296 | Ga0157374_11628977 | Ga0157374_116289772 | 102 |
| 130 | 3300013297 | Ga0157378_11162158 | Ga0157378_111621582 | 102 |
| 131 | 3300013306 | Ga0163162_11039653 | Ga0163162_110396532 | 102 |
| 132 | 3300013306 | Ga0163162_12747317 | Ga0163162_127473171 | 102 |
| 133 | 3300013306 | Ga0163162_12826550 | Ga0163162_128265501 | 102 |
| 134 | 3300013306 | Ga0163162_13006015 | Ga0163162_130060152 | 102 |
| 135 | 3300013307 | Ga0157372_11107833 | Ga0157372_111078332 | 102 |
| 136 | 3300013308 | Ga0157375_10042780 | Ga0157375_100427805 | 102 |
| 137 | 3300013308 | Ga0157375_10420412 | Ga0157375_104204122 | 102 |
| 138 | 3300013308 | Ga0157375_10610364 | Ga0157375_106103642 | 102 |
| 139 | 3300014325 | Ga0163163_10000010 | Ga0163163_1000001079 | 102 |
| 140 | 3300014325 | Ga0163163_10133090 | Ga0163163_101330903 | 102 |
| 141 | 3300014325 | Ga0163163_10822775 | Ga0163163_108227752 | 102 |
| 142 | 3300014326 | Ga0157380_11743477 | Ga0157380_117434772 | 102 |
| 143 | 3300014968 | Ga0157379_10702592 | Ga0157379_107025922 | 102 |
| 144 | 3300014969 | Ga0157376_10363863 | Ga0157376_103638632 | 102 |
| 145 | 3300025898 | Ga0207692_10461127 | Ga0207692_104611272 | 102 |
| 146 | 3300025906 | Ga0207699_11143049 | Ga0207699_111430492 | 102 |
| 147 | 3300025906 | Ga0207699_11414192 | Ga0207699_114141922 | 102 |
| 148 | 3300025912 | Ga0207707_10245369 | Ga0207707_102453693 | 102 |
| 149 | 3300025913 | Ga0207695_10059235 | Ga0207695_100592353 | 102 |
| 150 | 3300025913 | Ga0207695_10096397 | Ga0207695_100963973 | 102 |
| 151 | 3300025914 | Ga0207671_11572106 | Ga0207671_115721062 | 102 |
| 152 | 3300025915 | Ga0207693_10255937 | Ga0207693_102559372 | 102 |
| 153 | 3300025916 | Ga0207663_10009822 | Ga0207663_100098224 | 102 |
| 154 | 3300025918 | Ga0207662_10054301 | Ga0207662_100543012 | 102 |
| 155 | 3300025918 | Ga0207662_10785284 | Ga0207662_107852841 | 102 |
| 156 | 3300025924 | Ga0207694_10105331 | Ga0207694_101053314 | 102 |
| 157 | 3300025926 | Ga0207659_10658745 | Ga0207659_106587452 | 102 |
| 158 | 3300025928 | Ga0207700_11775799 | Ga0207700_117757992 | 102 |
| 159 | 3300025933 | Ga0207706_10729885 | Ga0207706_107298852 | 102 |
| 160 | 3300025936 | Ga0207670_10047403 | Ga0207670_100474031 | 102 |
| 161 | 3300025938 | Ga0207704_10549061 | Ga0207704_105490612 | 102 |
| 162 | 3300025941 | Ga0207711_11427100 | Ga0207711_114271001 | 102 |
| 163 | 3300025942 | Ga0207689_10497059 | Ga0207689_104970592 | 102 |
| 164 | 3300025960 | Ga0207651_12035064 | Ga0207651_120350642 | 102 |
| 165 | 3300025961 | Ga0207712_10449765 | Ga0207712_104497652 | 102 |
| 166 | 3300026035 | Ga0207703_10257118 | Ga0207703_102571183 | 102 |
| 167 | 3300026035 | Ga0207703_10431479 | Ga0207703_104314792 | 102 |
| 168 | 3300026078 | Ga0207702_10011100 | Ga0207702_100111009 | 102 |
| 169 | 3300026088 | Ga0207641_11305506 | Ga0207641_113055061 | 102 |
| 170 | 3300026089 | Ga0207648_10147735 | Ga0207648_101477353 | 102 |
| 171 | 3300026095 | Ga0207676_10498592 | Ga0207676_104985922 | 102 |
| 172 | 3300026116 | Ga0207674_10065691 | Ga0207674_100656914 | 102 |
| 173 | 3300027907 | Ga0207428_10735596 | Ga0207428_107355962 | 102 |
| 174 | 3300028380 | Ga0268265_10851376 | Ga0268265_108513762 | 102 |
| 175 | 3300028556 | Ga0265337_1000210 | Ga0265337_100021020 | 102 |
| 176 | 3300028556 | Ga0265337_1004707 | Ga0265337_10047074 | 102 |
| 177 | 3300028556 | Ga0265337_1004917 | Ga0265337_10049172 | 102 |
| 178 | 3300028556 | Ga0265337_1006396 | Ga0265337_10063965 | 102 |
| 179 | 3300028556 | Ga0265337_1008070 | Ga0265337_10080704 | 102 |
| 180 | 3300028556 | Ga0265337_1053246 | Ga0265337_10532462 | 102 |
| 181 | 3300028558 | Ga0265326_10009025 | Ga0265326_100090254 | 102 |
| 182 | 3300028558 | Ga0265326_10023695 | Ga0265326_100236953 | 102 |
| 183 | 3300028558 | Ga0265326_10037819 | Ga0265326_100378193 | 102 |
| 184 | 3300028558 | Ga0265326_10041600 | Ga0265326_100416002 | 102 |
| 185 | 3300028563 | Ga0265319_1031529 | Ga0265319_10315292 | 102 |
| 186 | 3300028563 | Ga0265319_1066093 | Ga0265319_10660933 | 102 |
| 187 | 3300028573 | Ga0265334_10013593 | Ga0265334_100135934 | 102 |
| 188 | 3300028573 | Ga0265334_10019726 | Ga0265334_100197262 | 102 |
| 189 | 3300028573 | Ga0265334_10154527 | Ga0265334_101545271 | 102 |
| 190 | 3300028573 | Ga0265334_10311898 | Ga0265334_103118981 | 102 |
| 191 | 3300028577 | Ga0265318_10009290 | Ga0265318_100092905 | 102 |
| 192 | 3300028577 | Ga0265318_10031152 | Ga0265318_100311523 | 102 |
| 193 | 3300028577 | Ga0265318_10084650 | Ga0265318_100846502 | 102 |
| 194 | 3300028653 | Ga0265323_10000312 | Ga0265323_1000031214 | 102 |
| 195 | 3300028653 | Ga0265323_10016950 | Ga0265323_100169503 | 102 |
| 196 | 3300028653 | Ga0265323_10028204 | Ga0265323_100282042 | 102 |
| 197 | 3300028653 | Ga0265323_10054921 | Ga0265323_100549212 | 102 |
| 198 | 3300028653 | Ga0265323_10131820 | Ga0265323_101318202 | 102 |
| 199 | 3300028654 | Ga0265322_10032669 | Ga0265322_100326693 | 102 |
| 200 | 3300028654 | Ga0265322_10033400 | Ga0265322_100334003 | 102 |
| 201 | 3300028654 | Ga0265322_10055438 | Ga0265322_100554382 | 102 |
| 202 | 3300028654 | Ga0265322_10062552 | Ga0265322_100625522 | 102 |
| 203 | 3300028654 | Ga0265322_10068535 | Ga0265322_100685352 | 102 |
| 204 | 3300028666 | Ga0265336_10004034 | Ga0265336_100040343 | 102 |
| 205 | 3300028666 | Ga0265336_10013027 | Ga0265336_100130274 | 102 |
| 206 | 3300028666 | Ga0265336_10023395 | Ga0265336_100233953 | 102 |
| 207 | 3300028666 | Ga0265336_10091841 | Ga0265336_100918412 | 102 |
| 208 | 3300028800 | Ga0265338_10000433 | Ga0265338_1000043356 | 102 |
| 209 | 3300028800 | Ga0265338_10000988 | Ga0265338_1000098812 | 102 |
| 210 | 3300028800 | Ga0265338_10001793 | Ga0265338_1000179331 | 102 |
| 211 | 3300028800 | Ga0265338_10002328 | Ga0265338_1000232812 | 102 |
| 212 | 3300028800 | Ga0265338_10009937 | Ga0265338_100099379 | 102 |
| 213 | 3300028800 | Ga0265338_10015696 | Ga0265338_100156969 | 102 |
| 214 | 3300028800 | Ga0265338_10020032 | Ga0265338_100200323 | 102 |
| 215 | 3300028800 | Ga0265338_10020503 | Ga0265338_100205036 | 102 |
| 216 | 3300028800 | Ga0265338_10030959 | Ga0265338_100309595 | 102 |
| 217 | 3300028800 | Ga0265338_10040841 | Ga0265338_100408414 | 102 |
| 218 | 3300028800 | Ga0265338_10065623 | Ga0265338_100656234 | 102 |
| 219 | 3300028800 | Ga0265338_10090678 | Ga0265338_100906784 | 102 |
| 220 | 3300028800 | Ga0265338_10160436 | Ga0265338_101604362 | 102 |
| 221 | 3300028800 | Ga0265338_10246153 | Ga0265338_102461532 | 102 |
| 222 | 3300028800 | Ga0265338_10319209 | Ga0265338_103192092 | 102 |
| 223 | 3300028800 | Ga0265338_10367945 | Ga0265338_103679452 | 102 |
| 224 | 3300028800 | Ga0265338_10403627 | Ga0265338_104036272 | 102 |
| 225 | 3300028800 | Ga0265338_10520859 | Ga0265338_105208591 | 102 |
| 226 | 3300028800 | Ga0265338_10603714 | Ga0265338_106037142 | 102 |
| 227 | 3300029957 | Ga0265324_10000170 | Ga0265324_1000017014 | 102 |
| 228 | 3300029957 | Ga0265324_10022337 | Ga0265324_100223373 | 102 |
| 229 | 3300029957 | Ga0265324_10032028 | Ga0265324_100320282 | 102 |
| 230 | 3300029957 | Ga0265324_10039022 | Ga0265324_100390221 | 102 |
| 231 | 3300029957 | Ga0265324_10119079 | Ga0265324_101190792 | 102 |
| 232 | 3300031238 | Ga0265332_10018121 | Ga0265332_100181215 | 102 |
| 233 | 3300031240 | Ga0265320_10000886 | Ga0265320_1000088612 | 102 |
| 234 | 3300031240 | Ga0265320_10007127 | Ga0265320_100071274 | 102 |
| 235 | 3300031240 | Ga0265320_10018983 | Ga0265320_100189835 | 102 |
| 236 | 3300031240 | Ga0265320_10061198 | Ga0265320_100611984 | 102 |
| 237 | 3300031240 | Ga0265320_10207035 | Ga0265320_102070352 | 102 |
| 238 | 3300031240 | Ga0265320_10279899 | Ga0265320_102798992 | 102 |
| 239 | 3300031240 | Ga0265320_10315754 | Ga0265320_103157542 | 102 |
| 240 | 3300031241 | Ga0265325_10017329 | Ga0265325_100173295 | 102 |
| 241 | 3300031241 | Ga0265325_10019440 | Ga0265325_100194404 | 102 |
| 242 | 3300031241 | Ga0265325_10048881 | Ga0265325_100488813 | 102 |
| 243 | 3300031247 | Ga0265340_10000209 | Ga0265340_1000020917 | 102 |
| 244 | 3300031247 | Ga0265340_10018649 | Ga0265340_100186494 | 102 |
| 245 | 3300031247 | Ga0265340_10131792 | Ga0265340_101317922 | 102 |
| 246 | 3300031247 | Ga0265340_10303458 | Ga0265340_103034582 | 102 |
| 247 | 3300031249 | Ga0265339_10032070 | Ga0265339_100320705 | 102 |
| 248 | 3300031249 | Ga0265339_10448231 | Ga0265339_104482311 | 102 |
| 249 | 3300031249 | Ga0265339_10588681 | Ga0265339_105886811 | 102 |
| 250 | 3300031250 | Ga0265331_10399138 | Ga0265331_103991382 | 102 |
| 251 | 3300031251 | Ga0265327_10010372 | Ga0265327_100103727 | 102 |
| 252 | 3300031251 | Ga0265327_10038719 | Ga0265327_100387191 | 102 |
| 253 | 3300031251 | Ga0265327_10070581 | Ga0265327_100705812 | 102 |
| 254 | 3300031344 | Ga0265316_10023093 | Ga0265316_100230936 | 102 |
| 255 | 3300031344 | Ga0265316_10049083 | Ga0265316_100490835 | 102 |
| 256 | 3300031344 | Ga0265316_10073158 | Ga0265316_100731582 | 102 |
| 257 | 3300031344 | Ga0265316_10116873 | Ga0265316_101168732 | 102 |
| 258 | 3300031344 | Ga0265316_10245663 | Ga0265316_102456632 | 102 |
| 259 | 3300031344 | Ga0265316_10335651 | Ga0265316_103356513 | 102 |
| 260 | 3300031344 | Ga0265316_10414104 | Ga0265316_104141042 | 102 |
| 261 | 3300031344 | Ga0265316_10845954 | Ga0265316_108459541 | 102 |
| 262 | 3300031344 | Ga0265316_10851179 | Ga0265316_108511792 | 102 |
| 263 | 3300031344 | Ga0265316_10997165 | Ga0265316_109971651 | 102 |
| 264 | 3300031595 | Ga0265313_10003416 | Ga0265313_100034168 | 102 |
| 265 | 3300031711 | Ga0265314_10018966 | Ga0265314_100189665 | 102 |
| 266 | 3300031711 | Ga0265314_10031202 | Ga0265314_100312024 | 102 |
| 267 | 3300031711 | Ga0265314_10296348 | Ga0265314_102963482 | 102 |
| 268 | 3300031711 | Ga0265314_10503947 | Ga0265314_105039472 | 102 |
| 269 | 3300031712 | Ga0265342_10020872 | Ga0265342_100208725 | 102 |
| 270 | 3300031712 | Ga0265342_10133485 | Ga0265342_101334852 | 102 |
| 271 | 3300031712 | Ga0265342_10399182 | Ga0265342_103991822 | 102 |
| 272 | 3300031727 | Ga0316576_10727874 | Ga0316576_107278742 | 102 |
| 273 | 3300031728 | Ga0316578_10080391 | Ga0316578_100803912 | 102 |
| 274 | 3300034816 | Ga0373930_0001337 | Ga0373930_0001337_1482_1790 | 102 |
| 275 | 3300034818 | Ga0373950_0016686 | Ga0373950_0016686_236_544 | 102 |
| 276 | 3300034957 | Ga0373938_0026708 | Ga0373938_0026708_326_634 | 102 |
| 277 | 3300035083 | Ga0373926_0256861 | Ga0373926_0256861_101_409 | 102 |
| 278 | 3300035083 | Ga0373926_0336500 | Ga0373926_0336500_234_542 | 102 |
| 279 | 3300035084 | Ga0373928_0000009 | Ga0373928_0000009_13432_13740 | 102 |
| 280 | 3300035085 | Ga0373929_0209622 | Ga0373929_0209622_52_360 | 102 |
| 281 | 3300035089 | Ga0373944_0000137 | Ga0373944_0000137_11523_11831 | 102 |
| 282 | 3300035089 | Ga0373944_0255063 | Ga0373944_0255063_113_421 | 102 |
| 283 | 3300035090 | Ga0373949_0003669 | Ga0373949_0003669_1301_1609 | 102 |
| 284 | 3300035091 | Ga0373951_0062769 | Ga0373951_0062769_404_712 | 102 |
| 285 | 3300035092 | Ga0373952_0258297 | Ga0373952_0258297_157_465 | 102 |
| 286 | 3300035112 | Ga0373932_0000001 | Ga0373932_0000001_1403078_1403386 | 102 |
| 287 | 3300035115 | Ga0373941_0129099 | Ga0373941_0129099_23_331 | 102 |
| 288 | 3300035116 | Ga0373945_0015480 | Ga0373945_0015480_1142_1450 | 102 |
| 289 | 3300035117 | Ga0373953_0158812 | Ga0373953_0158812_522_830 | 102 |
| 290 | 3300035118 | Ga0373954_0072278 | Ga0373954_0072278_1252_1560 | 102 |
| 291 | 3300035119 | Ga0373956_0003802 | Ga0373956_0003802_2237_2545 | 102 |
| 292 | 3300035170 | Ga0373943_0194441 | Ga0373943_0194441_799_1107 | 102 |
| 293 | 3300035170 | Ga0373943_0688763 | Ga0373943_0688763_235_543 | 102 |
| 294 | 3300035242 | Ga0373962_0000056 | Ga0373962_0000056_4444_4752 | 102 |
| 295 | 3300035691 | Ga0373931_0000002 | Ga0373931_0000002_92012_92320 | 102 |
| 296 | 3300035691 | Ga0373931_0328930 | Ga0373931_0328930_28_336 | 102 |
| 297 | 3300035691 | Ga0373931_0432954 | Ga0373931_0432954_50_358 | 102 |
| 298 | 3300035692 | Ga0373935_0011690 | Ga0373935_0011690_214_522 | 102 |
| 299 | 3300035692 | Ga0373935_0050915 | Ga0373935_0050915_353_661 | 102 |
| 300 | 3300035692 | Ga0373935_0701539 | Ga0373935_0701539_97_405 | 102 |
| 301 | 3300035692 | Ga0373935_0910877 | Ga0373935_0910877_262_570 | 102 |
| 302 | 3300035695 | Ga0373927_0004818 | Ga0373927_0004818_8269_8577 | 102 |
| 303 | 3300035695 | Ga0373927_0056614 | Ga0373927_0056614_473_781 | 102 |
| 304 | 3300035724 | Ga0373933_0105459 | Ga0373933_0105459_1421_1729 | 102 |
| 305 | 3300035724 | Ga0373933_0667897 | Ga0373933_0667897_53_361 | 102 |
| 306 | 3300035725 | Ga0373947_0009161 | Ga0373947_0009161_2312_2620 | 102 |
| 307 | 3300035725 | Ga0373947_0123677 | Ga0373947_0123677_163_471 | 102 |
| 308 | 3300035725 | Ga0373947_0298002 | Ga0373947_0298002_282_590 | 102 |
| 309 | 3300035725 | Ga0373947_0448265 | Ga0373947_0448265_404_712 | 102 |
| 310 | 3300035725 | Ga0373947_0872150 | Ga0373947_0872150_260_568 | 102 |
| 311 | 3300036401 | Ga0373937_0000659 | Ga0373937_0000659_12843_13151 | 102 |
| 312 | 3300036401 | Ga0373937_0326662 | Ga0373937_0326662_553_861 | 102 |
| 313 | 3300036401 | Ga0373937_1013910 | Ga0373937_1013910_241_549 | 102 |
| 314 | 3300036401 | Ga0373937_1250376 | Ga0373937_1250376_70_378 | 102 |
| 315 | 3300036401 | Ga0373937_1458015 | Ga0373937_1458015_38_346 | 102 |
| 316 | 3300036647 | Ga0316582_0563628 | Ga0316582_0563628_294_602 | 102 |
| 317 | 3300036712 | Ga0316584_1155434 | Ga0316584_1155434_21_329 | 102 |
| 318 | 3300037068 | Ga0373925_0000121 | Ga0373925_0000121_25773_26081 | 102 |
| 319 | 3300037068 | Ga0373925_0001575 | Ga0373925_0001575_18553_18861 | 102 |
| 320 | 3300037068 | Ga0373925_0003106 | Ga0373925_0003106_7961_8269 | 102 |
| 321 | 3300037068 | Ga0373925_1214742 | Ga0373925_1214742_219_527 | 102 |
| 322 | 3300042876 | Ga0451577_0001517 | Ga0451577_0001517_28316_28624 | 102 |
| 323 | 3300042876 | Ga0451577_0008776 | Ga0451577_0008776_125_433 | 102 |
| 324 | 3300042876 | Ga0451577_1393957 | Ga0451577_1393957_203_511 | 102 |
| 325 | 3300044673 | Ga0453683_0148599 | Ga0453683_0148599_820_1128 | 102 |
| 326 | 3300044673 | Ga0453683_0287262 | Ga0453683_0287262_405_713 | 102 |
| 327 | 3300044712 | Ga0453684_0049879 | Ga0453684_0049879_169_477 | 102 |
| 328 | 3300044712 | Ga0453684_0887320 | Ga0453684_0887320_519_827 | 102 |
| 329 | 3300045051 | Ga0451576_0065865 | Ga0451576_0065865_759_1067 | 102 |
| 330 | 3300045051 | Ga0451576_0074318 | Ga0451576_0074318_911_1219 | 102 |
| 331 | 3300045051 | Ga0451576_0076812 | Ga0451576_0076812_335_643 | 102 |
| 332 | 3300045051 | Ga0451576_0198541 | Ga0451576_0198541_338_646 | 102 |
| 333 | 3300045051 | Ga0451576_0398633 | Ga0451576_0398633_482_790 | 102 |
| 334 | 3300045051 | Ga0451576_0415804 | Ga0451576_0415804_893_1201 | 102 |
| 335 | 3300045051 | Ga0451576_0455047 | Ga0451576_0455047_717_1025 | 102 |
| 336 | 3300045051 | Ga0451576_0721477 | Ga0451576_0721477_19_327 | 102 |
| 337 | 3300045051 | Ga0451576_0851743 | Ga0451576_0851743_169_477 | 102 |
| 338 | 3300045051 | Ga0451576_1081953 | Ga0451576_1081953_385_693 | 102 |
| 339 | 3300045051 | Ga0451576_1471604 | Ga0451576_1471604_213_521 | 102 |
| 340 | 3300045051 | Ga0451576_2051095 | Ga0451576_2051095_92_400 | 102 |
| 341 | 3300045051 | Ga0451576_2575901 | Ga0451576_2575901_77_385 | 102 |
| 342 | 3300046454 | Ga0495592_0000087 | Ga0495592_0000087_41122_41430 | 102 |
| 343 | 3300046454 | Ga0495592_0247569 | Ga0495592_0247569_371_679 | 102 |
| 344 | 3300046459 | Ga0495629_0166802 | Ga0495629_0166802_719_1027 | 102 |
| 345 | 3300046473 | Ga0495582_0015399 | Ga0495582_0015399_1278_1586 | 102 |
| 346 | 3300046475 | Ga0495639_0413466 | Ga0495639_0413466_170_478 | 102 |
| 347 | 3300046475 | Ga0495639_0475857 | Ga0495639_0475857_309_617 | 102 |
| 348 | 3300046476 | Ga0495662_0109798 | Ga0495662_0109798_578_886 | 102 |
| 349 | 3300046476 | Ga0495662_0249652 | Ga0495662_0249652_167_475 | 102 |
| 350 | 3300046477 | Ga0495664_0290587 | Ga0495664_0290587_22_330 | 102 |
| 351 | 3300046511 | Ga0495608_0223523 | Ga0495608_0223523_194_502 | 102 |
| 352 | 3300046511 | Ga0495608_0549137 | Ga0495608_0549137_196_504 | 102 |
| 353 | 3300046514 | Ga0495618_0000575 | Ga0495618_0000575_14902_15210 | 102 |
| 354 | 3300046514 | Ga0495618_0001019 | Ga0495618_0001019_8045_8353 | 102 |
| 355 | 3300046516 | Ga0495628_0000056 | Ga0495628_0000056_45477_45785 | 102 |
| 356 | 3300046516 | Ga0495628_0330479 | Ga0495628_0330479_124_432 | 102 |
| 357 | 3300046516 | Ga0495628_0855126 | Ga0495628_0855126_44_352 | 102 |
| 358 | 3300046517 | Ga0495630_0000226 | Ga0495630_0000226_135_443 | 102 |
| 359 | 3300046517 | Ga0495630_0016036 | Ga0495630_0016036_5111_5419 | 102 |
| 360 | 3300046517 | Ga0495630_0033929 | Ga0495630_0033929_2825_3133 | 102 |
| 361 | 3300046517 | Ga0495630_0481629 | Ga0495630_0481629_565_873 | 102 |
| 362 | 3300046517 | Ga0495630_1205283 | Ga0495630_1205283_28_336 | 102 |
| 363 | 3300046517 | Ga0495630_1431256 | Ga0495630_1431256_126_434 | 102 |
| 364 | 3300046526 | Ga0495666_0026314 | Ga0495666_0026314_741_1049 | 102 |
| 365 | 3300046526 | Ga0495666_0049944 | Ga0495666_0049944_714_1022 | 102 |
| 366 | 3300046529 | Ga0495652_0245292 | Ga0495652_0245292_76_384 | 102 |
| 367 | 3300046533 | Ga0495640_0004603 | Ga0495640_0004603_5649_5957 | 102 |
| 368 | 3300046533 | Ga0495640_0144500 | Ga0495640_0144500_428_736 | 102 |
| 369 | 3300046533 | Ga0495640_0246607 | Ga0495640_0246607_87_395 | 102 |
| 370 | 3300046533 | Ga0495640_0377210 | Ga0495640_0377210_227_535 | 102 |
| 371 | 3300046535 | Ga0495586_0000114 | Ga0495586_0000114_44344_44652 | 102 |
| 372 | 3300046535 | Ga0495586_0000553 | Ga0495586_0000553_9233_9541 | 102 |
| 373 | 3300046535 | Ga0495586_0003122 | Ga0495586_0003122_5372_5680 | 102 |
| 374 | 3300046535 | Ga0495586_0005284 | Ga0495586_0005284_804_1112 | 102 |
| 375 | 3300046535 | Ga0495586_0033543 | Ga0495586_0033543_408_716 | 102 |
| 376 | 3300046535 | Ga0495586_0051744 | Ga0495586_0051744_1396_1704 | 102 |
| 377 | 3300046535 | Ga0495586_0360066 | Ga0495586_0360066_232_540 | 102 |
| 378 | 3300046535 | Ga0495586_0620675 | Ga0495586_0620675_157_465 | 102 |
| 379 | 3300046535 | Ga0495586_0722087 | Ga0495586_0722087_224_532 | 102 |
| 380 | 3300046536 | Ga0495587_0623296 | Ga0495587_0623296_156_464 | 102 |
| 381 | 3300046543 | Ga0495645_0029766 | Ga0495645_0029766_528_836 | 102 |
| 382 | 3300046543 | Ga0495645_0119282 | Ga0495645_0119282_1360_1668 | 102 |
| 383 | 3300046543 | Ga0495645_0521206 | Ga0495645_0521206_112_420 | 102 |
| 384 | 3300046543 | Ga0495645_0788882 | Ga0495645_0788882_168_476 | 102 |
| 385 | 3300046559 | Ga0495667_0022084 | Ga0495667_0022084_3293_3601 | 102 |
| 386 | 3300046559 | Ga0495667_0104607 | Ga0495667_0104607_1345_1653 | 102 |
| 387 | 3300046642 | Ga0495634_0002448 | Ga0495634_0002448_9220_9528 | 102 |
| 388 | 3300046642 | Ga0495634_0027656 | Ga0495634_0027656_1237_1545 | 102 |
| 389 | 3300046663 | Ga0495635_0292640 | Ga0495635_0292640_677_985 | 102 |
| 390 | 3300046663 | Ga0495635_0610374 | Ga0495635_0610374_217_525 | 102 |
| 391 | 3300046678 | Ga0495599_0106958 | Ga0495599_0106958_40_348 | 102 |
| 392 | 3300046678 | Ga0495599_0167575 | Ga0495599_0167575_652_960 | 102 |
| 393 | 3300046678 | Ga0495599_0402560 | Ga0495599_0402560_41_349 | 102 |
| 394 | 3300046678 | Ga0495599_0780504 | Ga0495599_0780504_46_354 | 102 |
| 395 | 3300046681 | Ga0495647_0081453 | Ga0495647_0081453_800_1108 | 102 |
| 396 | 3300046683 | Ga0495658_0019066 | Ga0495658_0019066_744_1052 | 102 |
| 397 | 3300046683 | Ga0495658_0099958 | Ga0495658_0099958_876_1184 | 102 |
| 398 | 3300046683 | Ga0495658_0147455 | Ga0495658_0147455_750_1058 | 102 |
| 399 | 3300046683 | Ga0495658_0940724 | Ga0495658_0940724_120_428 | 102 |
| 400 | 3300046684 | Ga0495669_0233942 | Ga0495669_0233942_292_600 | 102 |
| 401 | 3300046689 | Ga0495613_0000632 | Ga0495613_0000632_18496_18804 | 102 |
| 402 | 3300046689 | Ga0495613_0023520 | Ga0495613_0023520_2120_2428 | 102 |
| 403 | 3300046689 | Ga0495613_0115584 | Ga0495613_0115584_591_899 | 102 |
| 404 | 3300046689 | Ga0495613_0266984 | Ga0495613_0266984_55_363 | 102 |
| 405 | 3300046689 | Ga0495613_0850974 | Ga0495613_0850974_157_465 | 102 |
| 406 | 3300046690 | Ga0495624_0072750 | Ga0495624_0072750_733_1041 | 102 |
| 407 | 3300046690 | Ga0495624_0076641 | Ga0495624_0076641_986_1294 | 102 |
| 408 | 3300047315 | Ga0495581_0031118 | Ga0495581_0031118_698_1006 | 102 |
| 409 | 3300047315 | Ga0495581_0292270 | Ga0495581_0292270_613_921 | 102 |
| 410 | 3300047317 | Ga0495604_0887513 | Ga0495604_0887513_186_494 | 102 |
| 411 | 3300047319 | Ga0495674_0010420 | Ga0495674_0010420_5159_5467 | 102 |
| 412 | 3300047319 | Ga0495674_0466067 | Ga0495674_0466067_626_934 | 102 |
| 413 | 3300047321 | Ga0495676_0021470 | Ga0495676_0021470_4989_5297 | 102 |
| 414 | 3300047322 | Ga0495680_0001937 | Ga0495680_0001937_10695_11003 | 102 |
| 415 | 3300047322 | Ga0495680_0812124 | Ga0495680_0812124_236_544 | 102 |
| 416 | 3300047322 | Ga0495680_0964399 | Ga0495680_0964399_87_395 | 102 |
| 417 | 3300047471 | Ga0495684_0574419 | Ga0495684_0574419_282_590 | 102 |
| 418 | 3300048089 | Ga0495614_0050004 | Ga0495614_0050004_1389_1697 | 102 |
| 419 | 3300048089 | Ga0495614_0313367 | Ga0495614_0313367_343_651 | 102 |
| 420 | 3300048915 | Ga0496112_0887547 | Ga0496112_0887547_47_355 | 102 |
| 421 | 3300049568 | Ga0501031_0042912 | Ga0501031_0042912_1388_1696 | 102 |
| 422 | 3300049569 | Ga0501032_0995904 | Ga0501032_0995904_81_389 | 102 |
| 423 | 3300049570 | Ga0501033_0020698 | Ga0501033_0020698_4129_4437 | 102 |
| 424 | 3300049571 | Ga0501034_0141318 | Ga0501034_0141318_771_1079 | 102 |
| 425 | 3300049572 | Ga0501036_0900262 | Ga0501036_0900262_302_610 | 102 |
| 426 | 3300049572 | Ga0501036_1104244 | Ga0501036_1104244_35_343 | 102 |
| 427 | 3300049579 | Ga0501043_0051513 | Ga0501043_0051513_2213_2521 | 102 |
| 428 | 3300049581 | Ga0501047_0378712 | Ga0501047_0378712_485_793 | 102 |
| 429 | 3300049742 | Ga0501080_0650112 | Ga0501080_0650112_128_436 | 102 |
| 430 | 3300049822 | Ga0501035_0213927 | Ga0501035_0213927_812_1120 | 102 |
| 431 | 3300049822 | Ga0501035_1065029 | Ga0501035_1065029_106_414 | 102 |
| 432 | 3300049823 | Ga0501044_0020029 | Ga0501044_0020029_1828_2136 | 102 |
| 433 | 3300049823 | Ga0501044_0976545 | Ga0501044_0976545_91_399 | 102 |
| 434 | 3300050508 | nmdc:mga09592_257340_c1 | nmdc:mga09592_257340_c1_1044_1352 | 102 |
| 435 | 3300050509 | nmdc:mga0qj67_371853_c1 | nmdc:mga0qj67_371853_c1_134_442 | 102 |
| 436 | 3300050510 | nmdc:mga06r32_39429_c1 | nmdc:mga06r32_39429_c1_2044_2352 | 102 |
| 437 | 3300050511 | nmdc:mga08y16_1187903_c1 | nmdc:mga08y16_1187903_c1_410_718 | 102 |
| 438 | 3300050511 | nmdc:mga08y16_609313_c1 | nmdc:mga08y16_609313_c1_539_847 | 102 |
| 439 | 3300050513 | nmdc:mga0rr50_1412458_c1 | nmdc:mga0rr50_1412458_c1_141_449 | 102 |
| 440 | 3300050514 | nmdc:mga08x19_568400_c1 | nmdc:mga08x19_568400_c1_55_363 | 102 |
| 441 | 3300053077 | Ga0495601_0746581 | Ga0495601_0746581_19_327 | 102 |
| 442 | 3300053078 | Ga0495612_0441493 | Ga0495612_0441493_10_318 | 102 |
| 443 | 3300053098 | Ga0500650_0115469 | Ga0500650_0115469_247_555 | 102 |
| 444 | 3300053098 | Ga0500650_0238235 | Ga0500650_0238235_93_401 | 102 |
| 445 | 3300005327 | Ga0070658_10211947 | Ga0070658_102119474 | 103 |
| 446 | 3300005336 | Ga0070680_101444077 | Ga0070680_1014440772 | 103 |
| 447 | 3300005338 | Ga0068868_100497576 | Ga0068868_1004975762 | 103 |
| 448 | 3300005435 | Ga0070714_100001033 | Ga0070714_1000010339 | 103 |
| 449 | 3300005445 | Ga0070708_100168828 | Ga0070708_1001688281 | 103 |
| 450 | 3300005458 | Ga0070681_10054505 | Ga0070681_100545052 | 103 |
| 451 | 3300005467 | Ga0070706_101393449 | Ga0070706_1013934492 | 103 |
| 452 | 3300005530 | Ga0070679_100111731 | Ga0070679_1001117314 | 103 |
| 453 | 3300005530 | Ga0070679_100384124 | Ga0070679_1003841242 | 103 |
| 454 | 3300005563 | Ga0068855_100081250 | Ga0068855_1000812506 | 103 |
| 455 | 3300005563 | Ga0068855_100095627 | Ga0068855_1000956272 | 103 |
| 456 | 3300005563 | Ga0068855_100886038 | Ga0068855_1008860382 | 103 |
| 457 | 3300005577 | Ga0068857_101596636 | Ga0068857_1015966361 | 103 |
| 458 | 3300005578 | Ga0068854_101421372 | Ga0068854_1014213722 | 103 |
| 459 | 3300005614 | Ga0068856_101573793 | Ga0068856_1015737932 | 103 |
| 460 | 3300005614 | Ga0068856_102651687 | Ga0068856_1026516872 | 103 |
| 461 | 3300005834 | Ga0068851_10125965 | Ga0068851_101259652 | 103 |
| 462 | 3300006237 | Ga0097621_100535535 | Ga0097621_1005355352 | 103 |
| 463 | 3300006358 | Ga0068871_100272728 | Ga0068871_1002727282 | 103 |
| 464 | 3300009093 | Ga0105240_10324523 | Ga0105240_103245232 | 103 |
| 465 | 3300009093 | Ga0105240_10501278 | Ga0105240_105012783 | 103 |
| 466 | 3300009093 | Ga0105240_10784319 | Ga0105240_107843192 | 103 |
| 467 | 3300009147 | Ga0114129_12940037 | Ga0114129_129400372 | 103 |
| 468 | 3300009174 | Ga0105241_10861740 | Ga0105241_108617402 | 103 |
| 469 | 3300009551 | Ga0105238_10039954 | Ga0105238_100399545 | 103 |
| 470 | 3300010375 | Ga0105239_12652995 | Ga0105239_126529951 | 103 |
| 471 | 3300011119 | Ga0105246_12232882 | Ga0105246_122328822 | 103 |
| 472 | 3300013104 | Ga0157370_10291479 | Ga0157370_102914793 | 103 |
| 473 | 3300013105 | Ga0157369_10814740 | Ga0157369_108147402 | 103 |
| 474 | 3300013296 | Ga0157374_11537911 | Ga0157374_115379112 | 103 |
| 475 | 3300013307 | Ga0157372_10409459 | Ga0157372_104094593 | 103 |
| 476 | 3300013307 | Ga0157372_11604449 | Ga0157372_116044491 | 103 |
| 477 | 3300014745 | Ga0157377_10652579 | Ga0157377_106525792 | 103 |
| 478 | 3300014969 | Ga0157376_11588487 | Ga0157376_115884872 | 103 |
| 479 | 3300025321 | Ga0207656_10349333 | Ga0207656_103493332 | 103 |
| 480 | 3300025909 | Ga0207705_10504898 | Ga0207705_105048982 | 103 |
| 481 | 3300025912 | Ga0207707_10281890 | Ga0207707_102818902 | 103 |
| 482 | 3300025915 | Ga0207693_10617418 | Ga0207693_106174182 | 103 |
| 483 | 3300025921 | Ga0207652_10592950 | Ga0207652_105929502 | 103 |
| 484 | 3300025922 | Ga0207646_11411551 | Ga0207646_114115512 | 103 |
| 485 | 3300025924 | Ga0207694_10003771 | Ga0207694_100037717 | 103 |
| 486 | 3300025928 | Ga0207700_11742558 | Ga0207700_117425581 | 103 |
| 487 | 3300025929 | Ga0207664_10000746 | Ga0207664_1000074618 | 103 |
| 488 | 3300025949 | Ga0207667_10475744 | Ga0207667_104757442 | 103 |
| 489 | 3300025949 | Ga0207667_10602266 | Ga0207667_106022662 | 103 |
| 490 | 3300026078 | Ga0207702_10196051 | Ga0207702_101960512 | 103 |
| 491 | 3300028800 | Ga0265338_10014917 | Ga0265338_100149178 | 103 |
| 492 | 3300028800 | Ga0265338_10052738 | Ga0265338_100527382 | 103 |
| 493 | 3300028800 | Ga0265338_10056915 | Ga0265338_100569153 | 103 |
| 494 | 3300028800 | Ga0265338_10161091 | Ga0265338_101610912 | 103 |
| 495 | 3300028800 | Ga0265338_10164231 | Ga0265338_101642312 | 103 |
| 496 | 3300030521 | Ga0307511_10152622 | Ga0307511_101526222 | 103 |
| 497 | 3300031240 | Ga0265320_10001914 | Ga0265320_100019145 | 103 |
| 498 | 3300031241 | Ga0265325_10053350 | Ga0265325_100533501 | 103 |
| 499 | 3300031241 | Ga0265325_10220027 | Ga0265325_102200272 | 103 |
| 500 | 3300031249 | Ga0265339_10458740 | Ga0265339_104587401 | 103 |
| 501 | 3300031595 | Ga0265313_10439808 | Ga0265313_104398082 | 103 |
| 502 | 3300031712 | Ga0265342_10174611 | Ga0265342_101746112 | 103 |
| 503 | 3300035117 | Ga0373953_0161213 | Ga0373953_0161213_205_516 | 103 |
| 504 | 3300035118 | Ga0373954_0163539 | Ga0373954_0163539_274_585 | 103 |
| 505 | 3300035118 | Ga0373954_0631578 | Ga0373954_0631578_185_496 | 103 |
| 506 | 3300035119 | Ga0373956_0135670 | Ga0373956_0135670_596_907 | 103 |
| 507 | 3300035119 | Ga0373956_0522807 | Ga0373956_0522807_221_532 | 103 |
| 508 | 3300035172 | Ga0373955_0223979 | Ga0373955_0223979_597_908 | 103 |
| 509 | 3300035410 | Ga0373924_0133121 | Ga0373924_0133121_375_686 | 103 |
| 510 | 3300035724 | Ga0373933_0681547 | Ga0373933_0681547_82_393 | 103 |
| 511 | 3300036401 | Ga0373937_0808742 | Ga0373937_0808742_483_794 | 103 |
| 512 | 3300044684 | Ga0466966_0105170 | Ga0466966_0105170_367_678 | 103 |
| 513 | 3300044712 | Ga0453684_0010898 | Ga0453684_0010898_9545_9856 | 103 |
| 514 | 3300044712 | Ga0453684_0269000 | Ga0453684_0269000_634_945 | 103 |
| 515 | 3300044712 | Ga0453684_0670742 | Ga0453684_0670742_565_876 | 103 |
| 516 | 3300045051 | Ga0451576_0704040 | Ga0451576_0704040_36_347 | 103 |
| 517 | 3300046454 | Ga0495592_0069909 | Ga0495592_0069909_78_389 | 103 |
| 518 | 3300046463 | Ga0495653_0561959 | Ga0495653_0561959_148_459 | 103 |
| 519 | 3300046476 | Ga0495662_0287043 | Ga0495662_0287043_228_539 | 103 |
| 520 | 3300046477 | Ga0495664_0641137 | Ga0495664_0641137_274_585 | 103 |
| 521 | 3300046499 | Ga0495594_0806493 | Ga0495594_0806493_96_407 | 103 |
| 522 | 3300046514 | Ga0495618_0778831 | Ga0495618_0778831_153_464 | 103 |
| 523 | 3300046516 | Ga0495628_0448802 | Ga0495628_0448802_593_904 | 103 |
| 524 | 3300046517 | Ga0495630_0498982 | Ga0495630_0498982_313_624 | 103 |
| 525 | 3300046517 | Ga0495630_1217769 | Ga0495630_1217769_121_432 | 103 |
| 526 | 3300046529 | Ga0495652_0590090 | Ga0495652_0590090_171_482 | 103 |
| 527 | 3300046533 | Ga0495640_0555944 | Ga0495640_0555944_327_638 | 103 |
| 528 | 3300046543 | Ga0495645_0288340 | Ga0495645_0288340_405_716 | 103 |
| 529 | 3300046616 | Ga0495668_0314033 | Ga0495668_0314033_169_480 | 103 |
| 530 | 3300046663 | Ga0495635_0325099 | Ga0495635_0325099_417_728 | 103 |
| 531 | 3300046678 | Ga0495599_0126535 | Ga0495599_0126535_44_355 | 103 |
| 532 | 3300046684 | Ga0495669_0039944 | Ga0495669_0039944_832_1143 | 103 |
| 533 | 3300047317 | Ga0495604_0352841 | Ga0495604_0352841_508_819 | 103 |
| 534 | 3300047319 | Ga0495674_0273840 | Ga0495674_0273840_361_672 | 103 |
| 535 | 3300047471 | Ga0495684_0326605 | Ga0495684_0326605_347_658 | 103 |
| 536 | 3300048918 | Ga0496115_0046825 | Ga0496115_0046825_1961_2272 | 103 |
| 537 | 3300048918 | Ga0496115_0235014 | Ga0496115_0235014_198_509 | 103 |
| 538 | 3300061719 | Ga0466962_0417796 | Ga0466962_0417796_79_390 | 103 |
| 539 | 3300003320 | rootH2_10251543 | rootH2_102515432 | 104 |
| 540 | 3300005435 | Ga0070714_100310679 | Ga0070714_1003106792 | 104 |
| 541 | 3300009551 | Ga0105238_11349338 | Ga0105238_113493381 | 104 |
| 542 | 3300026075 | Ga0207708_10203692 | Ga0207708_102036922 | 104 |
| 543 | 3300031711 | Ga0265314_10331276 | Ga0265314_103312761 | 104 |
| 544 | 3300031730 | Ga0307516_10608913 | Ga0307516_106089132 | 104 |
| 545 | 3300035085 | Ga0373929_0000348 | Ga0373929_0000348_7077_7427 | 104 |
| 546 | 3300041463 | Ga0451804_0589685 | Ga0451804_0589685_133_447 | 104 |
| 547 | 3300042876 | Ga0451577_0015292 | Ga0451577_0015292_259_573 | 104 |
| 548 | 3300044712 | Ga0453684_0113559 | Ga0453684_0113559_486_800 | 104 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5l9t-assembly1.cif.gz_N | model of human anaphase-promoting complex/cyclosome (apc/c-cdh1) with e2 ube2s poised for polyubiquitination where ube2s, apc2, and apc11 are modeled into low resolution density | 0.9164 | 18 | 60 |
| 6c9t-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9117 | 17 | 93 |
| 8cll-assembly1.cif.gz_F | structural insights into human tfiiic promoter recognition | 0.8993 | 31 | 77 |
| 5h20-assembly1.cif.gz_A-2 | x-ray structure of padr-like transcription factor from bacteroid fragilis | 0.8971 | 10 | 98 |
| 6c2s-assembly2.cif.gz_C | transcriptional repressor, cour, bound to a 23-mer dna duplex | 0.8954 | 19 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57874_1_91_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9664 | 19 | 100 | 1.10.10.10 |
| af_Q57682_5_95_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9419 | 21 | 78 | 1.10.10.10 |
| af_P64638_1_78_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9052 | 21 | 78 | 1.10.10.10 |
| af_Q9C106_1_81_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9048 | 20 | 78 | 1.10.10.10 |
| 2vxzA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8989 | 18 | 77 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q8UM00-F1-model_v4 | MarR family transcriptional regulator | 1.002 | 19 | 98 |
GO:0003700
|
| AF-A0A7W7W4T9-F1-model_v4 | DNA-binding MarR family transcriptional regulator | 1.001 | 19 | 99 |
GO:0003677
|
| AF-A0A535WYS1-F1-model_v4 | Transcriptional regulator | 0.9996 | 18 | 96 |
|
| AF-A0A368LCJ6-F1-model_v4 | MarR family transcriptional regulator | 0.9987 | 19 | 97 |
|
| AF-A0A448KFQ3-F1-model_v4 | Helix-turn-helix domain | 0.9983 | 18 | 96 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar