F462249

General Info

Members Datasets Scaffolds Average Seq Length
548 255 1096 131

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0871407|Ga0395899_0871407_25_429
Length 134
Sequence VVRGSCLCGGVQFELAEEPGPLTFCHCTTCKRLSGGVGTANVGVASTAIRILKGRELLRTFQPSEGSAKTFCAACGANLFGGGWPESERASVRVPTLSDFDPRPANHIFVRSVAPWETVPDDGLDRFEIRATKQ

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
91 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
92 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
151 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
152 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
153 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
167 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
168 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
169 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
170 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
174 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
175 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
181 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 11.86
Rhizosphere 86.68
Stem 0
Stem Tuber 0
Unclassified 15.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0871407 3300037312 Unclassified 551
2 Ga0070683_100413920 3300005329 Bacteria 1286
3 Ga0070690_100012298 3300005330 Bacteria 5036
4 Ga0070690_100282658 3300005330 Bacteria 1184
5 Ga0070670_100315881 3300005331 Bacteria 1368
6 Ga0070677_10327779 3300005333 Unclassified 786
7 Ga0070680_100046651 3300005336 Bacteria 3526
8 Ga0070680_101151428 3300005336 Bacteria 670
9 Ga0070682_100199779 3300005337 Unclassified 1409
10 Ga0070682_100739146 3300005337 Bacteria 793
11 Ga0068868_100018282 3300005338 Bacteria 5237
12 Ga0068868_100184602 3300005338 Bacteria 1732
13 Ga0070660_100089541 3300005339 Bacteria 2425
14 Ga0070691_10003705 3300005341 Bacteria 6903
15 Ga0070687_100439087 3300005343 Unclassified 865
16 Ga0070692_10004824 3300005345 Bacteria 5671
17 Ga0070668_100046665 3300005347 Bacteria 3328
18 Ga0070669_100172363 3300005353 Bacteria 1688
19 Ga0070669_101409272 3300005353 Bacteria 605
20 Ga0070675_101299133 3300005354 Bacteria 670
21 Ga0070671_100203984 3300005355 Bacteria 1677
22 Ga0070674_100048128 3300005356 Bacteria 2925
23 Ga0070674_100213908 3300005356 Bacteria 1496
24 Ga0070673_100343614 3300005364 Bacteria 1323
25 Ga0070673_100590679 3300005364 Bacteria 1012
26 Ga0070688_101385737 3300005365 Bacteria 569
27 Ga0070709_10066396 3300005434 Bacteria 2313
28 Ga0070709_11618907 3300005434 Unclassified 527
29 Ga0070714_100018010 3300005435 Bacteria 5729
30 Ga0070714_101517872 3300005435 Bacteria 654
31 Ga0070713_100635922 3300005436 Unclassified 1015
32 Ga0070713_100740386 3300005436 Bacteria 940
33 Ga0070710_10011446 3300005437 Bacteria 4382
34 Ga0070701_10098522 3300005438 Bacteria 1615
35 Ga0070701_10549728 3300005438 Bacteria 757
36 Ga0070701_10864346 3300005438 Unclassified 622
37 Ga0070711_100133350 3300005439 Bacteria 1853
38 Ga0070711_100227349 3300005439 Bacteria 1453
39 Ga0070711_100475332 3300005439 Unclassified 1026
40 Ga0070705_100006207 3300005440 Bacteria 5851
41 Ga0070705_100012596 3300005440 Bacteria 4302
42 Ga0070700_100012297 3300005441 Bacteria 4770
43 Ga0070700_100226047 3300005441 Bacteria 1329
44 Ga0070694_100005836 3300005444 Bacteria 7470
45 Ga0070708_100248337 3300005445 Bacteria 1671
46 Ga0070663_100554981 3300005455 Bacteria 961
47 Ga0070678_100061133 3300005456 Bacteria 2775
48 Ga0070662_100086978 3300005457 Bacteria 2339
49 Ga0068867_100474000 3300005459 Bacteria 1071
50 Ga0070706_100435345 3300005467 Bacteria 1220
51 Ga0070698_100015275 3300005471 Bacteria 8119
52 Ga0070698_100682642 3300005471 Bacteria 969
53 Ga0070698_101863955 3300005471 Unclassified 554
54 Ga0070699_100057743 3300005518 Bacteria 3361
55 Ga0070679_100181908 3300005530 Bacteria 2074
56 Ga0070697_100115722 3300005536 Bacteria 2239
57 Ga0070697_100533743 3300005536 Bacteria 1028
58 Ga0070697_101113198 3300005536 Unclassified 703
59 Ga0070672_100646850 3300005543 Bacteria 923
60 Ga0070672_101608488 3300005543 Unclassified 583
61 Ga0070686_100009062 3300005544 Bacteria 5582
62 Ga0070686_100496549 3300005544 Bacteria 946
63 Ga0070695_100125320 3300005545 Bacteria 1763
64 Ga0070696_100005650 3300005546 Bacteria 8356
65 Ga0070696_100065183 3300005546 Bacteria 2553
66 Ga0070696_100217580 3300005546 Bacteria 1432
67 Ga0070693_100010651 3300005547 Bacteria 4610
68 Ga0070693_100022440 3300005547 Bacteria 3357
69 Ga0070665_101239583 3300005548 Bacteria 756
70 Ga0070704_100038004 3300005549 Bacteria 3293
71 Ga0070704_100088356 3300005549 Bacteria 2302
72 Ga0068855_100048908 3300005563 Bacteria 4989
73 Ga0068856_100517491 3300005614 Bacteria 1214
74 Ga0068856_100750853 3300005614 Bacteria 996
75 Ga0070702_100012892 3300005615 Bacteria 4209
76 Ga0070702_100191463 3300005615 Bacteria 1346
77 Ga0068852_100226072 3300005616 Unclassified 1782
78 Ga0068859_100871358 3300005617 Unclassified 986
79 Ga0068864_100037567 3300005618 Bacteria 4133
80 Ga0068861_100008499 3300005719 Bacteria 7069
81 Ga0068863_100892114 3300005841 Bacteria 889
82 Ga0068858_101261018 3300005842 Unclassified 727
83 Ga0068860_100034743 3300005843 Bacteria 4837
84 Ga0068860_102467786 3300005843 Bacteria 540
85 Ga0068862_100055214 3300005844 Bacteria 3402
86 Ga0081455_10043709 3300005937 Bacteria 3916
87 Ga0070717_10127628 3300006028 Bacteria 2185
88 Ga0070717_10245637 3300006028 Bacteria 1580
89 Ga0070717_10352010 3300006028 Unclassified 1317
90 Ga0075365_10082483 3300006038 Bacteria 2180
91 Ga0075432_10013011 3300006058 Bacteria 2828
92 Ga0075432_10034708 3300006058 Bacteria 1753
93 Ga0075432_10070883 3300006058 Bacteria 1252
94 Ga0070715_10261900 3300006163 Bacteria 908
95 Ga0070716_100117591 3300006173 Bacteria 1658
96 Ga0070712_100128720 3300006175 Bacteria 1916
97 Ga0070712_101060612 3300006175 Bacteria 702
98 Ga0075367_10419495 3300006178 Bacteria 847
99 Ga0075367_11037065 3300006178 Bacteria 524
100 Ga0075427_10088061 3300006194 Unclassified 567
101 Ga0097621_100017668 3300006237 Bacteria 5424
102 Ga0068871_100317649 3300006358 Bacteria 1371
103 Ga0075428_100021782 3300006844 Bacteria 7096
104 Ga0075428_100142839 3300006844 Bacteria 2602
105 Ga0075428_100178294 3300006844 Bacteria 2301
106 Ga0075430_100044310 3300006846 Bacteria 3763
107 Ga0075430_100230011 3300006846 Bacteria 1537
108 Ga0075430_100277825 3300006846 Bacteria 1386
109 Ga0075431_100078992 3300006847 Bacteria 3397
110 Ga0075431_100138237 3300006847 Bacteria 2511
111 Ga0075431_100277915 3300006847 Bacteria 1696
112 Ga0075431_100531004 3300006847 Unclassified 1165
113 Ga0075433_10052020 3300006852 Bacteria 3568
114 Ga0075433_11810392 3300006852 Bacteria 525
115 Ga0075434_100072971 3300006871 Bacteria 3424
116 Ga0075434_100423163 3300006871 Bacteria 1353
117 Ga0075434_100431524 3300006871 Bacteria 1339
118 Ga0075429_100010729 3300006880 Bacteria 7922
119 Ga0075429_100452650 3300006880 Bacteria 1125
120 Ga0075429_101391882 3300006880 Bacteria 611
121 Ga0068865_100045592 3300006881 Bacteria 3005
122 Ga0068865_100383970 3300006881 Bacteria 1146
123 Ga0075436_100025241 3300006914 Bacteria 4088
124 Ga0075436_100686750 3300006914 Unclassified 758
125 Ga0075436_101301627 3300006914 Unclassified 550
126 Ga0097620_100871278 3300006931 Unclassified 986
127 Ga0075435_100037341 3300007076 Bacteria 3867
128 Ga0075435_100046816 3300007076 Bacteria 3471
129 Ga0075435_100194491 3300007076 Bacteria 1717
130 Ga0105240_11315103 3300009093 Unclassified 762
131 Ga0105240_11445854 3300009093 Unclassified 722
132 Ga0111539_10045158 3300009094 Bacteria 5275
133 Ga0111539_10048461 3300009094 Bacteria 5072
134 Ga0111539_10139464 3300009094 Bacteria 2839
135 Ga0111539_10701702 3300009094 Bacteria 1178
136 Ga0105245_10019550 3300009098 Bacteria 5933
137 Ga0105245_10034650 3300009098 Bacteria 4478
138 Ga0105245_10053387 3300009098 Bacteria 3627
139 Ga0105245_10238295 3300009098 Bacteria 1762
140 Ga0105245_10685343 3300009098 Bacteria 1057
141 Ga0105245_10747344 3300009098 Bacteria 1014
142 Ga0114129_10059641 3300009147 Bacteria 5334
143 Ga0114129_10137036 3300009147 Bacteria 3358
144 Ga0114129_10172265 3300009147 Unclassified 2950
145 Ga0114129_10180652 3300009147 Bacteria 2871
146 Ga0114129_10207190 3300009147 Bacteria 2653
147 Ga0114129_10481182 3300009147 Bacteria 1624
148 Ga0114129_11384631 3300009147 Unclassified 868
149 Ga0114129_11418455 3300009147 Bacteria 856
150 Ga0114129_11671851 3300009147 Unclassified 778
151 Ga0114129_13060268 3300009147 Unclassified 548
152 Ga0114129_13219045 3300009147 Unclassified 530
153 Ga0105243_10196798 3300009148 Bacteria 1765
154 Ga0105243_10202435 3300009148 Unclassified 1742
155 Ga0105243_10309703 3300009148 Bacteria 1434
156 Ga0105243_10400740 3300009148 Bacteria 1274
157 Ga0105243_10491090 3300009148 Bacteria 1161
158 Ga0105243_11455954 3300009148 Bacteria 707
159 Ga0105241_10331955 3300009174 Bacteria 1315
160 Ga0105242_10065272 3300009176 Bacteria 3003
161 Ga0105242_10525110 3300009176 Bacteria 1130
162 Ga0105248_10177650 3300009177 Bacteria 2399
163 Ga0105248_10233358 3300009177 Bacteria 2071
164 Ga0105237_10173958 3300009545 Bacteria 2153
165 Ga0105238_10227731 3300009551 Bacteria 1841
166 Ga0105249_10038733 3300009553 Bacteria 4325
167 Ga0105249_10128773 3300009553 Bacteria 2414
168 Ga0105249_11274603 3300009553 Bacteria 806
169 Ga0105239_10033043 3300010375 Bacteria 5682
170 Ga0105239_10417992 3300010375 Bacteria 1519
171 Ga0157341_1036176 3300012494 Unclassified 554
172 Ga0157315_1070020 3300012508 Unclassified 514
173 Ga0157316_1003600 3300012510 Bacteria 1127
174 Ga0157371_10884831 3300013102 Unclassified 677
175 Ga0157371_11535341 3300013102 Bacteria 520
176 Ga0157374_10066011 3300013296 Bacteria 3400
177 Ga0157378_10112297 3300013297 Bacteria 2500
178 Ga0163162_10174147 3300013306 Bacteria 2277
179 Ga0157372_10065653 3300013307 Bacteria 4075
180 Ga0157372_11401001 3300013307 Bacteria 806
181 Ga0157375_10028599 3300013308 Bacteria 5228
182 Ga0157380_10024437 3300014326 Bacteria 4574
183 Ga0182008_10073955 3300014497 Bacteria 1677
184 Ga0157377_10153962 3300014745 Bacteria 1424
185 Ga0157377_10668021 3300014745 Unclassified 750
186 Ga0157376_10044974 3300014969 Bacteria 3632
187 Ga0157376_10472990 3300014969 Bacteria 1227
188 Ga0163161_10016355 3300017792 Bacteria 5177
189 Ga0207642_10083440 3300025899 Bacteria 1558
190 Ga0207642_10454475 3300025899 Bacteria 777
191 Ga0207685_10033233 3300025905 Bacteria 1863
192 Ga0207699_10034222 3300025906 Bacteria 2879
193 Ga0207693_10009234 3300025915 Bacteria 8051
194 Ga0207663_10028315 3300025916 Bacteria 3278
195 Ga0207663_10474309 3300025916 Unclassified 968
196 Ga0207660_10351480 3300025917 Bacteria 1181
197 Ga0207657_10022820 3300025919 Bacteria 5843
198 Ga0207681_10267030 3300025923 Bacteria 1342
199 Ga0207659_10145854 3300025926 Bacteria 1843
200 Ga0207659_10678659 3300025926 Bacteria 881
201 Ga0207659_11007836 3300025926 Bacteria 717
202 Ga0207687_10062716 3300025927 Bacteria 2630
203 Ga0207687_10372403 3300025927 Bacteria 1168
204 Ga0207687_11131568 3300025927 Unclassified 673
205 Ga0207700_10379718 3300025928 Bacteria 1235
206 Ga0207664_10017862 3300025929 Bacteria 5211
207 Ga0207644_10235952 3300025931 Bacteria 1455
208 Ga0207690_10012597 3300025932 Bacteria 5063
209 Ga0207706_10014118 3300025933 Bacteria 7243
210 Ga0207706_11238461 3300025933 Bacteria 619
211 Ga0207686_10069425 3300025934 Bacteria 2260
212 Ga0207709_10409337 3300025935 Bacteria 1039
213 Ga0207709_11674454 3300025935 Bacteria 529
214 Ga0207669_10254287 3300025937 Unclassified 1310
215 Ga0207704_10389972 3300025938 Bacteria 1096
216 Ga0207704_11145616 3300025938 Bacteria 662
217 Ga0207665_10002725 3300025939 Bacteria 11850
218 Ga0207691_10401241 3300025940 Bacteria 1169
219 Ga0207691_11017674 3300025940 Bacteria 691
220 Ga0207711_10146726 3300025941 Bacteria 2126
221 Ga0207661_10259993 3300025944 Bacteria 1546
222 Ga0207667_10314291 3300025949 Bacteria 1600
223 Ga0207651_10263330 3300025960 Bacteria 1417
224 Ga0207651_11429217 3300025960 Unclassified 623
225 Ga0207712_10089849 3300025961 Bacteria 2259
226 Ga0207712_10664683 3300025961 Unclassified 907
227 Ga0207668_10471026 3300025972 Bacteria 1076
228 Ga0207668_10796449 3300025972 Bacteria 836
229 Ga0207668_10823052 3300025972 Unclassified 823
230 Ga0207640_10041914 3300025981 Bacteria 2915
231 Ga0207658_10576940 3300025986 Bacteria 1009
232 Ga0207677_10015924 3300026023 Bacteria 4439
233 Ga0207677_10253086 3300026023 Bacteria 1431
234 Ga0207677_11821314 3300026023 Unclassified 565
235 Ga0207703_10912819 3300026035 Bacteria 841
236 Ga0207678_10091196 3300026067 Bacteria 2604
237 Ga0207708_10091945 3300026075 Bacteria 2340
238 Ga0207708_10101424 3300026075 Bacteria 2228
239 Ga0207702_10165412 3300026078 Bacteria 2023
240 Ga0207641_10223659 3300026088 Bacteria 1747
241 Ga0207648_10003852 3300026089 Bacteria 15674
242 Ga0207648_10070333 3300026089 Bacteria 3051
243 Ga0207676_10341636 3300026095 Bacteria 1381
244 Ga0207675_100020206 3300026118 Bacteria 6209
245 Ga0207675_100025473 3300026118 Bacteria 5506
246 Ga0207683_10019406 3300026121 Bacteria 5805
247 Ga0207683_10077992 3300026121 Bacteria 2935
248 Ga0209966_1003854 3300027695 Bacteria 2531
249 Ga0207428_10002045 3300027907 Bacteria 20377
250 Ga0207428_10002288 3300027907 Bacteria 19226
251 Ga0207428_10192095 3300027907 Bacteria 1539
252 Ga0268265_10233472 3300028380 Bacteria 1618
253 Ga0307408_102061756 3300031548 Unclassified 549
254 Ga0307410_10849839 3300031852 Unclassified 779
255 Ga0307409_100032243 3300031995 Bacteria 3796
256 Ga0307409_100276042 3300031995 Bacteria 1551
257 Ga0307415_101111981 3300032126 Unclassified 740
258 Ga0373948_0013626 3300034817 Bacteria 1471
259 Ga0373959_0054627 3300034820 Bacteria 870
260 Ga0373938_0249312 3300034957 Viruses 507
261 Ga0373940_0285544 3300035088 Bacteria 565
262 Ga0373939_0222776 3300035114 Bacteria 723
263 Ga0373960_0185122 3300035121 Unclassified 729
264 Ga0373943_0912711 3300035170 Unclassified 525
265 Ga0373946_0031397 3300035171 Bacteria 2127
266 Ga0373961_0006539 3300035241 Bacteria 2801
267 Ga0373962_0022260 3300035242 Unclassified 1679
268 Ga0373931_0395552 3300035691 Unclassified 874
269 Ga0373935_0640657 3300035692 Bacteria 779
270 Ga0395899_0011110 3300037312 Bacteria 6897
271 Ga0395899_0029409 3300037312 Bacteria 4132
272 Ga0395899_0051369 3300037312 Bacteria 3060
273 Ga0395899_0092770 3300037312 Bacteria 2186
274 Ga0395899_0154773 3300037312 Bacteria 1623
275 Ga0395899_0457652 3300037312 Bacteria 834
276 Ga0395899_0811122 3300037312 Bacteria 577
277 Ga0395900_0004582 3300037418 Bacteria 14585
278 Ga0395900_0008009 3300037418 Bacteria 10874
279 Ga0395900_0010714 3300037418 Bacteria 9377
280 Ga0395900_0016921 3300037418 Bacteria 7442
281 Ga0395900_0059143 3300037418 Bacteria 3945
282 Ga0395900_0293418 3300037418 Bacteria 1614
283 Ga0395900_0445083 3300037418 Unclassified 1252
284 Ga0395900_0462337 3300037418 Unclassified 1223
285 Ga0395900_0480168 3300037418 Bacteria 1195
286 Ga0395900_0487831 3300037418 Unclassified 1184
287 Ga0395900_0786845 3300037418 Bacteria 880
288 Ga0395900_1219892 3300037418 Unclassified 667
289 Ga0395898_0003528 3300037466 Bacteria 17440
290 Ga0395898_0007785 3300037466 Bacteria 11371
291 Ga0395898_0008049 3300037466 Bacteria 11172
292 Ga0395898_0016545 3300037466 Bacteria 7542
293 Ga0395898_0075559 3300037466 Bacteria 3254
294 Ga0395898_0096032 3300037466 Unclassified 2847
295 Ga0395898_0202519 3300037466 Bacteria 1894
296 Ga0395898_0220332 3300037466 Bacteria 1810
297 Ga0395898_0360232 3300037466 Bacteria 1387
298 Ga0395898_0610809 3300037466 Bacteria 1033
299 Ga0395898_1111485 3300037466 Bacteria 723
300 Ga0395898_1184773 3300037466 Bacteria 695
301 Ga0395905_0002818 3300037471 Bacteria 19056
302 Ga0395905_0014081 3300037471 Bacteria 7646
303 Ga0395905_0014945 3300037471 Bacteria 7405
304 Ga0395905_0022616 3300037471 Bacteria 5943
305 Ga0395905_0036372 3300037471 Bacteria 4624
306 Ga0395905_0087844 3300037471 Bacteria 2914
307 Ga0395905_0171773 3300037471 Bacteria 2036
308 Ga0395905_0315691 3300037471 Bacteria 1452
309 Ga0395905_0460177 3300037471 Bacteria 1170
310 Ga0395905_0568628 3300037471 Bacteria 1035
311 Ga0395901_0012915 3300038443 Bacteria 8471
312 Ga0395901_0019084 3300038443 Bacteria 7011
313 Ga0395901_0021294 3300038443 Bacteria 6640
314 Ga0395901_0026742 3300038443 Bacteria 5923
315 Ga0395901_0061062 3300038443 Bacteria 3922
316 Ga0395901_0105377 3300038443 Bacteria 2959
317 Ga0395901_0139586 3300038443 Bacteria 2547
318 Ga0395901_0169235 3300038443 Bacteria 2293
319 Ga0395901_0176251 3300038443 Bacteria 2243
320 Ga0395901_0179445 3300038443 Bacteria 2221
321 Ga0395901_0435477 3300038443 Bacteria 1343
322 Ga0395901_0696002 3300038443 Bacteria 1014
323 Ga0395901_0989570 3300038443 Bacteria 817
324 Ga0395901_1058039 3300038443 Unclassified 784
325 Ga0395901_1697948 3300038443 Unclassified 583
326 Ga0451802_1118619 3300041460 Unclassified 552
327 Ga0451804_0467396 3300041463 Bacteria 1159
328 Ga0451839_0752305 3300041496 Bacteria 940
329 Ga0451841_1118202 3300041498 Bacteria 700
330 Ga0451845_0548414 3300041501 Bacteria 781
331 Ga0451853_3109224 3300041512 Bacteria 1977
332 Ga0439448_0055193 3300042005 Bacteria 1306
333 Ga0450920_028675 3300042122 Bacteria 1091
334 Ga0450907_005644 3300042146 Unclassified 2107
335 Ga0450907_029451 3300042146 Bacteria 932
336 Ga0450918_014956 3300042531 Bacteria 1349
337 Ga0495580_0325231 3300046472 Bacteria 1045
338 Ga0495582_0313355 3300046473 Bacteria 902
339 Ga0495584_0035195 3300046491 Bacteria 2532
340 Ga0495594_0467813 3300046499 Bacteria 717
341 Ga0495596_0072137 3300046500 Bacteria 1341
342 Ga0495607_0294519 3300046501 Bacteria 766
343 Ga0495631_0253139 3300046518 Bacteria 751
344 Ga0495644_0146195 3300046523 Bacteria 904
345 Ga0495644_0209182 3300046523 Unclassified 753
346 Ga0495663_0144598 3300046525 Bacteria 809
347 Ga0495663_0228472 3300046525 Bacteria 656
348 Ga0495598_0325544 3300046537 Unclassified 587
349 Ga0495656_0343155 3300046615 Bacteria 773
350 Ga0495656_0486374 3300046615 Bacteria 653
351 Ga0495656_0742068 3300046615 Bacteria 529
352 Ga0495668_0257819 3300046616 Bacteria 955
353 Ga0495611_0132974 3300046648 Unclassified 1161
354 Ga0495659_0011573 3300046664 Bacteria 2843
355 Ga0495661_0258071 3300046665 Bacteria 887
356 Ga0495588_0409027 3300046674 Bacteria 712
357 Ga0495670_0272908 3300046691 Bacteria 904
358 Ga0495671_0423196 3300046692 Unclassified 637
359 Ga0495671_0456958 3300046692 Unclassified 610
360 Ga0496100_0111075 3300048903 Bacteria 1904
361 Ga0496100_0133604 3300048903 Bacteria 1750
362 Ga0496100_0303799 3300048903 Bacteria 1195
363 Ga0496100_0725202 3300048903 Bacteria 776
364 Ga0496100_1368861 3300048903 Unclassified 558
365 Ga0496101_0214531 3300048904 Bacteria 1492
366 Ga0496101_0214703 3300048904 Bacteria 1491
367 Ga0496101_0246859 3300048904 Unclassified 1390
368 Ga0496101_0609361 3300048904 Bacteria 863
369 Ga0496101_0739096 3300048904 Unclassified 776
370 Ga0496102_0094765 3300048905 Bacteria 2766
371 Ga0496102_0122035 3300048905 Bacteria 2434
372 Ga0496102_0272879 3300048905 Bacteria 1594
373 Ga0496102_0703976 3300048905 Bacteria 933
374 Ga0496103_0110830 3300048906 Bacteria 1743
375 Ga0496103_0961847 3300048906 Unclassified 533
376 Ga0496104_0001925 3300048907 Bacteria 17988
377 Ga0496104_0003031 3300048907 Bacteria 14474
378 Ga0496104_0143623 3300048907 Bacteria 2292
379 Ga0496105_0001301 3300048908 Bacteria 17470
380 Ga0496105_0075861 3300048908 Bacteria 2776
381 Ga0496105_0156040 3300048908 Bacteria 1874
382 Ga0496106_0181803 3300048909 Bacteria 1669
383 Ga0496106_0201742 3300048909 Bacteria 1583
384 Ga0496106_0351358 3300048909 Bacteria 1184
385 Ga0496106_0796835 3300048909 Bacteria 749
386 Ga0496107_0185392 3300048910 Bacteria 1545
387 Ga0496107_0768290 3300048910 Bacteria 706
388 Ga0496108_0001139 3300048911 Bacteria 20752
389 Ga0496108_0054623 3300048911 Bacteria 3352
390 Ga0496108_0058145 3300048911 Bacteria 3249
391 Ga0496108_0063168 3300048911 Bacteria 3118
392 Ga0496108_1169897 3300048911 Unclassified 651
393 Ga0496108_1461819 3300048911 Unclassified 570
394 Ga0496109_0007510 3300048912 Bacteria 9234
395 Ga0496109_0009410 3300048912 Bacteria 8327
396 Ga0496109_0152391 3300048912 Bacteria 2164
397 Ga0496110_0021230 3300048913 Bacteria 5493
398 Ga0496110_0044493 3300048913 Bacteria 3877
399 Ga0496110_0056468 3300048913 Bacteria 3455
400 Ga0496110_0106356 3300048913 Bacteria 2517
401 Ga0496110_0143267 3300048913 Bacteria 2161
402 Ga0496111_0000183 3300048914 Bacteria 28637
403 Ga0496111_0008644 3300048914 Bacteria 6752
404 Ga0496111_0060091 3300048914 Bacteria 2754
405 Ga0496111_0132646 3300048914 Bacteria 1844
406 Ga0496111_0588537 3300048914 Bacteria 815
407 Ga0496112_0003540 3300048915 Bacteria 12965
408 Ga0496112_0038728 3300048915 Bacteria 4656
409 Ga0496112_0152147 3300048915 Bacteria 2281
410 Ga0496112_0228387 3300048915 Bacteria 1816
411 Ga0496112_0333721 3300048915 Bacteria 1460
412 Ga0496112_1012962 3300048915 Bacteria 750
413 Ga0496113_0309493 3300048916 Unclassified 1265
414 Ga0496114_0025271 3300048917 Bacteria 4854
415 Ga0496114_0163546 3300048917 Unclassified 1936
416 Ga0496114_0576274 3300048917 Unclassified 993
417 Ga0496114_1443730 3300048917 Unclassified 575
418 Ga0496115_0014681 3300048918 Bacteria 5932
419 Ga0496115_0366627 3300048918 Bacteria 1173
420 Ga0496115_0977160 3300048918 Unclassified 648
421 Ga0496115_1170490 3300048918 Bacteria 579
422 Ga0496115_1270785 3300048918 Unclassified 550
423 Ga0501031_0001976 3300049568 Bacteria 12947
424 Ga0501031_0091348 3300049568 Bacteria 1986
425 Ga0501032_0006726 3300049569 Bacteria 8438
426 Ga0501033_0004305 3300049570 Bacteria 11427
427 Ga0501034_0005985 3300049571 Bacteria 13159
428 Ga0501036_0066566 3300049572 Bacteria 3048
429 Ga0501037_0007726 3300049573 Bacteria 7872
430 Ga0501037_0068373 3300049573 Bacteria 2586
431 Ga0501038_0003559 3300049574 Bacteria 14496
432 Ga0501038_0181466 3300049574 Bacteria 1698
433 Ga0501039_0019537 3300049575 Bacteria 5194
434 Ga0501039_0189210 3300049575 Bacteria 1619
435 Ga0501039_0200161 3300049575 Bacteria 1570
436 Ga0501039_0403282 3300049575 Bacteria 1074
437 Ga0501039_1043227 3300049575 Bacteria 634
438 Ga0501040_0081988 3300049576 Bacteria 2235
439 Ga0501040_0212222 3300049576 Bacteria 1376
440 Ga0501041_0204396 3300049577 Bacteria 1238
441 Ga0501042_0034503 3300049578 Bacteria 3588
442 Ga0501042_0166500 3300049578 Unclassified 1590
443 Ga0501042_0571433 3300049578 Bacteria 822
444 Ga0501043_0039536 3300049579 Bacteria 3706
445 Ga0501046_0016777 3300049580 Bacteria 6122
446 Ga0501046_0155213 3300049580 Unclassified 1725
447 Ga0501047_0182249 3300049581 Bacteria 1966
448 Ga0501048_0008231 3300049582 Bacteria 7888
449 Ga0501048_0161990 3300049582 Bacteria 1583
450 Ga0501067_0007819 3300049583 Bacteria 5946
451 Ga0501068_0006523 3300049584 Bacteria 6437
452 Ga0501069_0002815 3300049585 Bacteria 8898
453 Ga0501069_0046413 3300049585 Bacteria 2409
454 Ga0501069_0666461 3300049585 Bacteria 626
455 Ga0501070_0005213 3300049586 Bacteria 11078
456 Ga0501070_0181144 3300049586 Bacteria 1734
457 Ga0501071_0074500 3300049587 Bacteria 2477
458 Ga0501071_0143690 3300049587 Bacteria 1778
459 Ga0501071_0183229 3300049587 Bacteria 1569
460 Ga0501071_0733443 3300049587 Unclassified 761
461 Ga0501071_1577023 3300049587 Bacteria 507
462 Ga0501072_0029638 3300049588 Bacteria 4276
463 Ga0501072_0110584 3300049588 Bacteria 2187
464 Ga0501072_0345999 3300049588 Bacteria 1180
465 Ga0501072_0442361 3300049588 Unclassified 1030
466 Ga0501072_0522096 3300049588 Bacteria 939
467 Ga0501072_0732798 3300049588 Bacteria 776
468 Ga0501072_0886250 3300049588 Bacteria 697
469 Ga0501073_0007092 3300049589 Bacteria 8347
470 Ga0501073_0186419 3300049589 Bacteria 1436
471 Ga0501073_0371965 3300049589 Bacteria 987
472 Ga0501074_0020522 3300049590 Bacteria 4801
473 Ga0501074_0171989 3300049590 Bacteria 1546
474 Ga0501074_0259012 3300049590 Bacteria 1237
475 Ga0501074_0400265 3300049590 Bacteria 974
476 Ga0501074_0606189 3300049590 Bacteria 774
477 Ga0501074_0821237 3300049590 Bacteria 655
478 Ga0501074_0957127 3300049590 Unclassified 602
479 Ga0501075_0035592 3300049591 Bacteria 3714
480 Ga0501075_0084057 3300049591 Bacteria 2410
481 Ga0501075_0234184 3300049591 Bacteria 1400
482 Ga0501076_0110212 3300049592 Bacteria 2225
483 Ga0501076_0148896 3300049592 Bacteria 1903
484 Ga0501076_0164120 3300049592 Bacteria 1810
485 Ga0501077_0060239 3300049593 Bacteria 2409
486 Ga0501077_0163922 3300049593 Bacteria 1411
487 Ga0501077_0227341 3300049593 Bacteria 1186
488 Ga0501079_0036694 3300049741 Bacteria 3775
489 Ga0501079_0061352 3300049741 Bacteria 2900
490 Ga0501079_0184862 3300049741 Bacteria 1627
491 Ga0501079_0470813 3300049741 Unclassified 987
492 Ga0501079_0508745 3300049741 Unclassified 947
493 Ga0501080_0034259 3300049742 Bacteria 4739
494 Ga0501080_0317766 3300049742 Bacteria 1410
495 Ga0501081_0112665 3300049743 Bacteria 1931
496 Ga0501081_0406623 3300049743 Bacteria 1008
497 Ga0501081_1540952 3300049743 Unclassified 505
498 Ga0501083_0003927 3300049744 Bacteria 10441
499 Ga0501083_0415853 3300049744 Unclassified 875
500 Ga0501035_0028764 3300049822 Bacteria 5071
501 Ga0501035_0692904 3300049822 Bacteria 822
502 Ga0501044_0028326 3300049823 Bacteria 5913
503 Ga0501044_0216427 3300049823 Bacteria 1868
504 Ga0501045_0019948 3300049824 Bacteria 4784
505 Ga0501045_0371053 3300049824 Bacteria 1065
506 nmdc:mga06z11_949844_c1 3300050494 Bacteria 524
507 nmdc:mga05p37_123991_c1 3300050507 Bacteria 3174
508 nmdc:mga05p37_1295403_c1 3300050507 Bacteria 743
509 nmdc:mga05p37_42629_c1 3300050507 Bacteria 5577
510 nmdc:mga05p37_631085_c1 3300050507 Bacteria 1204
511 nmdc:mga09592_112631_c1 3300050508 Bacteria 2334
512 nmdc:mga09592_131004_c1 3300050508 Bacteria 2157
513 nmdc:mga09592_26880_c1 3300050508 Bacteria 4771
514 nmdc:mga09592_655182_c1 3300050508 Bacteria 896
515 nmdc:mga0qj67_42413_c1 3300050509 Unclassified 3581
516 nmdc:mga0qj67_458654_c1 3300050509 Bacteria 1026
517 nmdc:mga0qj67_6844_c1 3300050509 Bacteria 8381
518 nmdc:mga06r32_30826_c1 3300050510 Bacteria 5033
519 nmdc:mga06r32_396769_c1 3300050510 Bacteria 1362
520 nmdc:mga06r32_603516_c1 3300050510 Unclassified 1068
521 nmdc:mga08y16_28182_c1 3300050511 Bacteria 5920
522 nmdc:mga08y16_43502_c1 3300050511 Bacteria 4707
523 nmdc:mga08y16_597634_c1 3300050511 Bacteria 1112
524 nmdc:mga08y16_7052_c1 3300050511 Bacteria 11795
525 nmdc:mga0n895_10995_c1 3300050512 Bacteria 8045
526 nmdc:mga0n895_1704423_c1 3300050512 Bacteria 593
527 nmdc:mga0n895_211131_c1 3300050512 Bacteria 1971
528 nmdc:mga0n895_437505_c1 3300050512 Bacteria 1321
529 nmdc:mga0rr50_146907_c1 3300050513 Bacteria 1902
530 nmdc:mga0rr50_17517_c1 3300050513 Bacteria 4786
531 nmdc:mga0rr50_497274_c1 3300050513 Bacteria 1037
532 nmdc:mga0rr50_59584_c1 3300050513 Bacteria 2867
533 nmdc:mga08x19_1086063_c1 3300050514 Bacteria 568
534 nmdc:mga0a205_143257_c1 3300050515 Bacteria 2290
535 nmdc:mga0a205_18699_c1 3300050515 Bacteria 6521
536 nmdc:mga0a205_279475_c1 3300050515 Bacteria 1545
537 nmdc:mga0a205_412161_c1 3300050515 Bacteria 1214
538 nmdc:mga0a205_75592_c1 3300050515 Bacteria 3255
539 Ga0501084_0067247 3300054114 Bacteria 2999
540 Ga0501084_0109424 3300054114 Unclassified 2322
541 Ga0501084_0356458 3300054114 Bacteria 1236
542 Ga0501084_0508895 3300054114 Bacteria 1018
543 Ga0501084_1121499 3300054114 Unclassified 660
544 Ga0501082_0167183 3300060353 Bacteria 1911
545 Ga0501082_0367469 3300060353 Bacteria 1255
546 Ga0530510_0038731 3300061734 Bacteria 3442
547 Ga0530510_0043873 3300061734 Bacteria 3231
548 Ga0530510_0609482 3300061734 Bacteria 830
549 Ga0395899_0871407
550 Ga0070683_100413920
551 Ga0070690_100012298
552 Ga0070690_100282658
553 Ga0070670_100315881
554 Ga0070677_10327779
555 Ga0070680_100046651
556 Ga0070680_101151428
557 Ga0070682_100199779
558 Ga0070682_100739146
559 Ga0068868_100018282
560 Ga0068868_100184602
561 Ga0070660_100089541
562 Ga0070691_10003705
563 Ga0070687_100439087
564 Ga0070692_10004824
565 Ga0070668_100046665
566 Ga0070669_100172363
567 Ga0070669_101409272
568 Ga0070675_101299133
569 Ga0070671_100203984
570 Ga0070674_100048128
571 Ga0070674_100213908
572 Ga0070673_100343614
573 Ga0070673_100590679
574 Ga0070688_101385737
575 Ga0070709_10066396
576 Ga0070709_11618907
577 Ga0070714_100018010
578 Ga0070714_101517872
579 Ga0070713_100635922
580 Ga0070713_100740386
581 Ga0070710_10011446
582 Ga0070701_10098522
583 Ga0070701_10549728
584 Ga0070701_10864346
585 Ga0070711_100133350
586 Ga0070711_100227349
587 Ga0070711_100475332
588 Ga0070705_100006207
589 Ga0070705_100012596
590 Ga0070700_100012297
591 Ga0070700_100226047
592 Ga0070694_100005836
593 Ga0070708_100248337
594 Ga0070663_100554981
595 Ga0070678_100061133
596 Ga0070662_100086978
597 Ga0068867_100474000
598 Ga0070706_100435345
599 Ga0070698_100015275
600 Ga0070698_100682642
601 Ga0070698_101863955
602 Ga0070699_100057743
603 Ga0070679_100181908
604 Ga0070697_100115722
605 Ga0070697_100533743
606 Ga0070697_101113198
607 Ga0070672_100646850
608 Ga0070672_101608488
609 Ga0070686_100009062
610 Ga0070686_100496549
611 Ga0070695_100125320
612 Ga0070696_100005650
613 Ga0070696_100065183
614 Ga0070696_100217580
615 Ga0070693_100010651
616 Ga0070693_100022440
617 Ga0070665_101239583
618 Ga0070704_100038004
619 Ga0070704_100088356
620 Ga0068855_100048908
621 Ga0068856_100517491
622 Ga0068856_100750853
623 Ga0070702_100012892
624 Ga0070702_100191463
625 Ga0068852_100226072
626 Ga0068859_100871358
627 Ga0068864_100037567
628 Ga0068861_100008499
629 Ga0068863_100892114
630 Ga0068858_101261018
631 Ga0068860_100034743
632 Ga0068860_102467786
633 Ga0068862_100055214
634 Ga0081455_10043709
635 Ga0070717_10127628
636 Ga0070717_10245637
637 Ga0070717_10352010
638 Ga0075365_10082483
639 Ga0075432_10013011
640 Ga0075432_10034708
641 Ga0075432_10070883
642 Ga0070715_10261900
643 Ga0070716_100117591
644 Ga0070712_100128720
645 Ga0070712_101060612
646 Ga0075367_10419495
647 Ga0075367_11037065
648 Ga0075427_10088061
649 Ga0097621_100017668
650 Ga0068871_100317649
651 Ga0075428_100021782
652 Ga0075428_100142839
653 Ga0075428_100178294
654 Ga0075430_100044310
655 Ga0075430_100230011
656 Ga0075430_100277825
657 Ga0075431_100078992
658 Ga0075431_100138237
659 Ga0075431_100277915
660 Ga0075431_100531004
661 Ga0075433_10052020
662 Ga0075433_11810392
663 Ga0075434_100072971
664 Ga0075434_100423163
665 Ga0075434_100431524
666 Ga0075429_100010729
667 Ga0075429_100452650
668 Ga0075429_101391882
669 Ga0068865_100045592
670 Ga0068865_100383970
671 Ga0075436_100025241
672 Ga0075436_100686750
673 Ga0075436_101301627
674 Ga0097620_100871278
675 Ga0075435_100037341
676 Ga0075435_100046816
677 Ga0075435_100194491
678 Ga0105240_11315103
679 Ga0105240_11445854
680 Ga0111539_10045158
681 Ga0111539_10048461
682 Ga0111539_10139464
683 Ga0111539_10701702
684 Ga0105245_10019550
685 Ga0105245_10034650
686 Ga0105245_10053387
687 Ga0105245_10238295
688 Ga0105245_10685343
689 Ga0105245_10747344
690 Ga0114129_10059641
691 Ga0114129_10137036
692 Ga0114129_10172265
693 Ga0114129_10180652
694 Ga0114129_10207190
695 Ga0114129_10481182
696 Ga0114129_11384631
697 Ga0114129_11418455
698 Ga0114129_11671851
699 Ga0114129_13060268
700 Ga0114129_13219045
701 Ga0105243_10196798
702 Ga0105243_10202435
703 Ga0105243_10309703
704 Ga0105243_10400740
705 Ga0105243_10491090
706 Ga0105243_11455954
707 Ga0105241_10331955
708 Ga0105242_10065272
709 Ga0105242_10525110
710 Ga0105248_10177650
711 Ga0105248_10233358
712 Ga0105237_10173958
713 Ga0105238_10227731
714 Ga0105249_10038733
715 Ga0105249_10128773
716 Ga0105249_11274603
717 Ga0105239_10033043
718 Ga0105239_10417992
719 Ga0157341_1036176
720 Ga0157315_1070020
721 Ga0157316_1003600
722 Ga0157371_10884831
723 Ga0157371_11535341
724 Ga0157374_10066011
725 Ga0157378_10112297
726 Ga0163162_10174147
727 Ga0157372_10065653
728 Ga0157372_11401001
729 Ga0157375_10028599
730 Ga0157380_10024437
731 Ga0182008_10073955
732 Ga0157377_10153962
733 Ga0157377_10668021
734 Ga0157376_10044974
735 Ga0157376_10472990
736 Ga0163161_10016355
737 Ga0207642_10083440
738 Ga0207642_10454475
739 Ga0207685_10033233
740 Ga0207699_10034222
741 Ga0207693_10009234
742 Ga0207663_10028315
743 Ga0207663_10474309
744 Ga0207660_10351480
745 Ga0207657_10022820
746 Ga0207681_10267030
747 Ga0207659_10145854
748 Ga0207659_10678659
749 Ga0207659_11007836
750 Ga0207687_10062716
751 Ga0207687_10372403
752 Ga0207687_11131568
753 Ga0207700_10379718
754 Ga0207664_10017862
755 Ga0207644_10235952
756 Ga0207690_10012597
757 Ga0207706_10014118
758 Ga0207706_11238461
759 Ga0207686_10069425
760 Ga0207709_10409337
761 Ga0207709_11674454
762 Ga0207669_10254287
763 Ga0207704_10389972
764 Ga0207704_11145616
765 Ga0207665_10002725
766 Ga0207691_10401241
767 Ga0207691_11017674
768 Ga0207711_10146726
769 Ga0207661_10259993
770 Ga0207667_10314291
771 Ga0207651_10263330
772 Ga0207651_11429217
773 Ga0207712_10089849
774 Ga0207712_10664683
775 Ga0207668_10471026
776 Ga0207668_10796449
777 Ga0207668_10823052
778 Ga0207640_10041914
779 Ga0207658_10576940
780 Ga0207677_10015924
781 Ga0207677_10253086
782 Ga0207677_11821314
783 Ga0207703_10912819
784 Ga0207678_10091196
785 Ga0207708_10091945
786 Ga0207708_10101424
787 Ga0207702_10165412
788 Ga0207641_10223659
789 Ga0207648_10003852
790 Ga0207648_10070333
791 Ga0207676_10341636
792 Ga0207675_100020206
793 Ga0207675_100025473
794 Ga0207683_10019406
795 Ga0207683_10077992
796 Ga0209966_1003854
797 Ga0207428_10002045
798 Ga0207428_10002288
799 Ga0207428_10192095
800 Ga0268265_10233472
801 Ga0307408_102061756
802 Ga0307410_10849839
803 Ga0307409_100032243
804 Ga0307409_100276042
805 Ga0307415_101111981
806 Ga0373948_0013626
807 Ga0373959_0054627
808 Ga0373938_0249312
809 Ga0373940_0285544
810 Ga0373939_0222776
811 Ga0373960_0185122
812 Ga0373943_0912711
813 Ga0373946_0031397
814 Ga0373961_0006539
815 Ga0373962_0022260
816 Ga0373931_0395552
817 Ga0373935_0640657
818 Ga0395899_0011110
819 Ga0395899_0029409
820 Ga0395899_0051369
821 Ga0395899_0092770
822 Ga0395899_0154773
823 Ga0395899_0457652
824 Ga0395899_0811122
825 Ga0395900_0004582
826 Ga0395900_0008009
827 Ga0395900_0010714
828 Ga0395900_0016921
829 Ga0395900_0059143
830 Ga0395900_0293418
831 Ga0395900_0445083
832 Ga0395900_0462337
833 Ga0395900_0480168
834 Ga0395900_0487831
835 Ga0395900_0786845
836 Ga0395900_1219892
837 Ga0395898_0003528
838 Ga0395898_0007785
839 Ga0395898_0008049
840 Ga0395898_0016545
841 Ga0395898_0075559
842 Ga0395898_0096032
843 Ga0395898_0202519
844 Ga0395898_0220332
845 Ga0395898_0360232
846 Ga0395898_0610809
847 Ga0395898_1111485
848 Ga0395898_1184773
849 Ga0395905_0002818
850 Ga0395905_0014081
851 Ga0395905_0014945
852 Ga0395905_0022616
853 Ga0395905_0036372
854 Ga0395905_0087844
855 Ga0395905_0171773
856 Ga0395905_0315691
857 Ga0395905_0460177
858 Ga0395905_0568628
859 Ga0395901_0012915
860 Ga0395901_0019084
861 Ga0395901_0021294
862 Ga0395901_0026742
863 Ga0395901_0061062
864 Ga0395901_0105377
865 Ga0395901_0139586
866 Ga0395901_0169235
867 Ga0395901_0176251
868 Ga0395901_0179445
869 Ga0395901_0435477
870 Ga0395901_0696002
871 Ga0395901_0989570
872 Ga0395901_1058039
873 Ga0395901_1697948
874 Ga0451802_1118619
875 Ga0451804_0467396
876 Ga0451839_0752305
877 Ga0451841_1118202
878 Ga0451845_0548414
879 Ga0451853_3109224
880 Ga0439448_0055193
881 Ga0450920_028675
882 Ga0450907_005644
883 Ga0450907_029451
884 Ga0450918_014956
885 Ga0495580_0325231
886 Ga0495582_0313355
887 Ga0495584_0035195
888 Ga0495594_0467813
889 Ga0495596_0072137
890 Ga0495607_0294519
891 Ga0495631_0253139
892 Ga0495644_0146195
893 Ga0495644_0209182
894 Ga0495663_0144598
895 Ga0495663_0228472
896 Ga0495598_0325544
897 Ga0495656_0343155
898 Ga0495656_0486374
899 Ga0495656_0742068
900 Ga0495668_0257819
901 Ga0495611_0132974
902 Ga0495659_0011573
903 Ga0495661_0258071
904 Ga0495588_0409027
905 Ga0495670_0272908
906 Ga0495671_0423196
907 Ga0495671_0456958
908 Ga0496100_0111075
909 Ga0496100_0133604
910 Ga0496100_0303799
911 Ga0496100_0725202
912 Ga0496100_1368861
913 Ga0496101_0214531
914 Ga0496101_0214703
915 Ga0496101_0246859
916 Ga0496101_0609361
917 Ga0496101_0739096
918 Ga0496102_0094765
919 Ga0496102_0122035
920 Ga0496102_0272879
921 Ga0496102_0703976
922 Ga0496103_0110830
923 Ga0496103_0961847
924 Ga0496104_0001925
925 Ga0496104_0003031
926 Ga0496104_0143623
927 Ga0496105_0001301
928 Ga0496105_0075861
929 Ga0496105_0156040
930 Ga0496106_0181803
931 Ga0496106_0201742
932 Ga0496106_0351358
933 Ga0496106_0796835
934 Ga0496107_0185392
935 Ga0496107_0768290
936 Ga0496108_0001139
937 Ga0496108_0054623
938 Ga0496108_0058145
939 Ga0496108_0063168
940 Ga0496108_1169897
941 Ga0496108_1461819
942 Ga0496109_0007510
943 Ga0496109_0009410
944 Ga0496109_0152391
945 Ga0496110_0021230
946 Ga0496110_0044493
947 Ga0496110_0056468
948 Ga0496110_0106356
949 Ga0496110_0143267
950 Ga0496111_0000183
951 Ga0496111_0008644
952 Ga0496111_0060091
953 Ga0496111_0132646
954 Ga0496111_0588537
955 Ga0496112_0003540
956 Ga0496112_0038728
957 Ga0496112_0152147
958 Ga0496112_0228387
959 Ga0496112_0333721
960 Ga0496112_1012962
961 Ga0496113_0309493
962 Ga0496114_0025271
963 Ga0496114_0163546
964 Ga0496114_0576274
965 Ga0496114_1443730
966 Ga0496115_0014681
967 Ga0496115_0366627
968 Ga0496115_0977160
969 Ga0496115_1170490
970 Ga0496115_1270785
971 Ga0501031_0001976
972 Ga0501031_0091348
973 Ga0501032_0006726
974 Ga0501033_0004305
975 Ga0501034_0005985
976 Ga0501036_0066566
977 Ga0501037_0007726
978 Ga0501037_0068373
979 Ga0501038_0003559
980 Ga0501038_0181466
981 Ga0501039_0019537
982 Ga0501039_0189210
983 Ga0501039_0200161
984 Ga0501039_0403282
985 Ga0501039_1043227
986 Ga0501040_0081988
987 Ga0501040_0212222
988 Ga0501041_0204396
989 Ga0501042_0034503
990 Ga0501042_0166500
991 Ga0501042_0571433
992 Ga0501043_0039536
993 Ga0501046_0016777
994 Ga0501046_0155213
995 Ga0501047_0182249
996 Ga0501048_0008231
997 Ga0501048_0161990
998 Ga0501067_0007819
999 Ga0501068_0006523
1000 Ga0501069_0002815
1001 Ga0501069_0046413
1002 Ga0501069_0666461
1003 Ga0501070_0005213
1004 Ga0501070_0181144
1005 Ga0501071_0074500
1006 Ga0501071_0143690
1007 Ga0501071_0183229
1008 Ga0501071_0733443
1009 Ga0501071_1577023
1010 Ga0501072_0029638
1011 Ga0501072_0110584
1012 Ga0501072_0345999
1013 Ga0501072_0442361
1014 Ga0501072_0522096
1015 Ga0501072_0732798
1016 Ga0501072_0886250
1017 Ga0501073_0007092
1018 Ga0501073_0186419
1019 Ga0501073_0371965
1020 Ga0501074_0020522
1021 Ga0501074_0171989
1022 Ga0501074_0259012
1023 Ga0501074_0400265
1024 Ga0501074_0606189
1025 Ga0501074_0821237
1026 Ga0501074_0957127
1027 Ga0501075_0035592
1028 Ga0501075_0084057
1029 Ga0501075_0234184
1030 Ga0501076_0110212
1031 Ga0501076_0148896
1032 Ga0501076_0164120
1033 Ga0501077_0060239
1034 Ga0501077_0163922
1035 Ga0501077_0227341
1036 Ga0501079_0036694
1037 Ga0501079_0061352
1038 Ga0501079_0184862
1039 Ga0501079_0470813
1040 Ga0501079_0508745
1041 Ga0501080_0034259
1042 Ga0501080_0317766
1043 Ga0501081_0112665
1044 Ga0501081_0406623
1045 Ga0501081_1540952
1046 Ga0501083_0003927
1047 Ga0501083_0415853
1048 Ga0501035_0028764
1049 Ga0501035_0692904
1050 Ga0501044_0028326
1051 Ga0501044_0216427
1052 Ga0501045_0019948
1053 Ga0501045_0371053
1054 nmdc:mga06z11_949844_c1
1055 nmdc:mga05p37_123991_c1
1056 nmdc:mga05p37_1295403_c1
1057 nmdc:mga05p37_42629_c1
1058 nmdc:mga05p37_631085_c1
1059 nmdc:mga09592_112631_c1
1060 nmdc:mga09592_131004_c1
1061 nmdc:mga09592_26880_c1
1062 nmdc:mga09592_655182_c1
1063 nmdc:mga0qj67_42413_c1
1064 nmdc:mga0qj67_458654_c1
1065 nmdc:mga0qj67_6844_c1
1066 nmdc:mga06r32_30826_c1
1067 nmdc:mga06r32_396769_c1
1068 nmdc:mga06r32_603516_c1
1069 nmdc:mga08y16_28182_c1
1070 nmdc:mga08y16_43502_c1
1071 nmdc:mga08y16_597634_c1
1072 nmdc:mga08y16_7052_c1
1073 nmdc:mga0n895_10995_c1
1074 nmdc:mga0n895_1704423_c1
1075 nmdc:mga0n895_211131_c1
1076 nmdc:mga0n895_437505_c1
1077 nmdc:mga0rr50_146907_c1
1078 nmdc:mga0rr50_17517_c1
1079 nmdc:mga0rr50_497274_c1
1080 nmdc:mga0rr50_59584_c1
1081 nmdc:mga08x19_1086063_c1
1082 nmdc:mga0a205_143257_c1
1083 nmdc:mga0a205_18699_c1
1084 nmdc:mga0a205_279475_c1
1085 nmdc:mga0a205_412161_c1
1086 nmdc:mga0a205_75592_c1
1087 Ga0501084_0067247
1088 Ga0501084_0109424
1089 Ga0501084_0356458
1090 Ga0501084_0508895
1091 Ga0501084_1121499
1092 Ga0501082_0167183
1093 Ga0501082_0367469
1094 Ga0530510_0038731
1095 Ga0530510_0043873
1096 Ga0530510_0609482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

23

112

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8751 7 136
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8152 10 108
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.777 7 136
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7391 10 108
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.7353 2 140
ID Description Score Start End Superfamily
af_P9WJB9_9_114_3.30.1310.10 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8943 9 24 3.30.1310.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8515 8 136 3.90.1590.10
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8231 10 108 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8091 12 108 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8051 8 136 3.90.1590.10
ID Description Score Start End GO Terms
AF-A0A538F450-F1-model_v4 GFA family protein 0.9595 1 137 GO:0016846
GO:0046872
AF-A0A7W0SRB2-F1-model_v4 GFA family protein 0.9523 27 140 GO:0016846
GO:0046872
AF-A0A7W0S348-F1-model_v4 GFA family protein 0.9446 8 140 GO:0016846
GO:0046872
AF-A0A3C1ADG1-F1-model_v4 deleted 0.9384 7 87
AF-A0A524JSN6-F1-model_v4 GFA family protein 0.9377 5 87 GO:0016846
GO:0046872

Map