F462264

General Info

Members Datasets Scaffolds Average Seq Length
548 242 1094 268

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0000474|Ga0466957_0000474_16137_17066
Length 309
Sequence MKTAAPAADFFCPHLSQYCNKTINQNYMTTDQQLKEIVKAKYSEIALQDKADNQASCCGSGCCSTEVYNIMTDDYSNLEGYNPDADLGLGCGLPTQFAQIKKGDVVIDLGSGAGNDAFIARAETGETGKVIGIDFTPAMIDKARANAEKLGFNNVQFRQGDIEKMPVTANVADVIVSNCVLNLVPNKDGVFKEIYRVLKPGGHFSISDIVLEGVLPQPIKEAAEMYAGCVSGAIQKQVYLELIESNGFHHIAIQKDKAIVIPDDILSQYLSAEQITAFKQSGTGISSITVYAEKPAEEKKSCCGPDCCK

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
180 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
183 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
184 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
185 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
186 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
214 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
221 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
222 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
223 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
224 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
236 2738541278 Niastella sp. CF465 Isolate Unclassified
237 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
238 2818991444 Filimonas endophytica 3197 Isolate Unclassified
239 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
240 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
241 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
242 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 0
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.47
Nodule 0
Rhizoplane 1.09
Rhizosphere 85.95
Stem 0
Stem Tuber 0
Unclassified 13.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0000474 3300044842 Bacteria 19959
2 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
3 MBSR1b_contig_8395545 2162886012 Bacteria 1693
4 JGI24740J21852_10000881 3300001979 Bacteria 13265
5 JGI24739J22299_10001910 3300001989 Bacteria 7970
6 JGI24737J22298_10001399 3300001990 Bacteria 8551
7 JGI24735J21928_10000004 3300002067 Bacteria 381713
8 JGI25157J39369_1002312 3300002741 Bacteria 4981
9 rootH1_10008782 3300003316 Bacteria 7180
10 rootH1_10175978 3300003316 Bacteria 1961
11 rootH2_10001201 3300003320 Bacteria 26611
12 rootH2_10010515 3300003320 Bacteria 12220
13 rootH2_10071179 3300003320 Bacteria 2883
14 rootL2_10037652 3300003322 Bacteria 5396
15 rootL2_10204145 3300003322 Bacteria 3611
16 rootL2_10267457 3300003322 Bacteria 5548
17 rootL2_10311072 3300003322 Unclassified 1440
18 rootH1_10022382 3300003323 Bacteria 49541
19 rootH1_10083748 3300003323 Bacteria 1210
20 rootH1_10290119 3300003323 Bacteria 1499
21 rootH1_10378186 3300003323 Bacteria 1654
22 JGI25160J50197_1001714 3300003354 Bacteria 10638
23 JGI25160J50197_1006092 3300003354 Bacteria 4921
24 Ga0055531_10000139 3300003794 Bacteria 82993
25 Ga0065165_1022796 3300005262 Bacteria 2137
26 Ga0065714_10008835 3300005288 Bacteria 3635
27 Ga0065704_10070140 3300005289 Bacteria 482257
28 Ga0065712_10026012 3300005290 Bacteria 1798
29 Ga0065712_10088050 3300005290 Bacteria 2541
30 Ga0070658_10007677 3300005327 Bacteria 8695
31 Ga0070658_10226304 3300005327 Bacteria 1583
32 Ga0070676_10034971 3300005328 Bacteria 2887
33 Ga0070676_10064093 3300005328 Unclassified 2190
34 Ga0070683_100001570 3300005329 Bacteria 17652
35 Ga0070683_100006866 3300005329 Bacteria 9564
36 Ga0070683_100533591 3300005329 Bacteria 1122
37 Ga0070690_100130653 3300005330 Bacteria 1696
38 Ga0070670_100035814 3300005331 Bacteria 4273
39 Ga0070670_100049990 3300005331 Bacteria 3593
40 Ga0070670_100423388 3300005331 Unclassified 1177
41 Ga0070670_100433409 3300005331 Bacteria 1163
42 Ga0068869_100000952 3300005334 Bacteria 16792
43 Ga0068869_100008047 3300005334 Bacteria 6773
44 Ga0068869_100022140 3300005334 Bacteria 4376
45 Ga0068869_100082668 3300005334 Bacteria 2400
46 Ga0070666_10002979 3300005335 Bacteria 10267
47 Ga0070666_10026914 3300005335 Bacteria 3762
48 Ga0070680_100029806 3300005336 Bacteria 4380
49 Ga0070680_100090073 3300005336 Unclassified 2539
50 Ga0070680_100130229 3300005336 Unclassified 2104
51 Ga0070682_100043648 3300005337 Bacteria 2773
52 Ga0070682_100253186 3300005337 Bacteria 1271
53 Ga0068868_100016312 3300005338 Bacteria 5513
54 Ga0068868_100073117 3300005338 Bacteria 2737
55 Ga0068868_100103924 3300005338 Bacteria 2302
56 Ga0068868_100189036 3300005338 Unclassified 1712
57 Ga0070689_100004331 3300005340 Bacteria 9584
58 Ga0070687_100047451 3300005343 Unclassified 2203
59 Ga0070687_100058567 3300005343 Bacteria 2024
60 Ga0070661_100001443 3300005344 Bacteria 16524
61 Ga0070661_100109051 3300005344 Unclassified 2066
62 Ga0070668_100034157 3300005347 Bacteria 3875
63 Ga0070668_100044351 3300005347 Bacteria 3412
64 Ga0070668_100058192 3300005347 Bacteria 2990
65 Ga0070668_100070973 3300005347 Bacteria 2713
66 Ga0070668_100073054 3300005347 Unclassified 2673
67 Ga0070669_100001762 3300005353 Bacteria 15602
68 Ga0070669_100075723 3300005353 Unclassified 2497
69 Ga0070669_100283366 3300005353 Bacteria 1328
70 Ga0070675_100020875 3300005354 Bacteria 5229
71 Ga0070675_100104805 3300005354 Bacteria 2386
72 Ga0070675_100117332 3300005354 Unclassified 2259
73 Ga0070671_100061343 3300005355 Bacteria 3132
74 Ga0070671_100172327 3300005355 Bacteria 1830
75 Ga0070674_100175201 3300005356 Bacteria 1638
76 Ga0070673_100012921 3300005364 Bacteria 5752
77 Ga0070673_100013678 3300005364 Bacteria 5624
78 Ga0070673_100050097 3300005364 Bacteria 3263
79 Ga0070673_100081489 3300005364 Bacteria 2624
80 Ga0070688_100000526 3300005365 Bacteria 19396
81 Ga0070688_100038169 3300005365 Unclassified 2931
82 Ga0070659_100326548 3300005366 Unclassified 1283
83 Ga0070659_100357481 3300005366 Bacteria 1226
84 Ga0070659_100454030 3300005366 Bacteria 1087
85 Ga0070667_100007158 3300005367 Bacteria 9270
86 Ga0070667_100011690 3300005367 Bacteria 7256
87 Ga0070667_100050288 3300005367 Bacteria 3512
88 Ga0070667_100363522 3300005367 Unclassified 1312
89 Ga0070700_100098164 3300005441 Bacteria 1925
90 Ga0070678_100001380 3300005456 Bacteria 12941
91 Ga0070678_100269556 3300005456 Bacteria 1435
92 Ga0070662_100018799 3300005457 Bacteria 4680
93 Ga0070662_100028117 3300005457 Bacteria 3911
94 Ga0070662_100081360 3300005457 Bacteria 2413
95 Ga0070662_100099135 3300005457 Bacteria 2202
96 Ga0070681_10080711 3300005458 Bacteria 3209
97 Ga0070681_10170436 3300005458 Bacteria 2099
98 Ga0068867_100025829 3300005459 Bacteria 4213
99 Ga0068867_100071195 3300005459 Bacteria 2601
100 Ga0068867_100398660 3300005459 Bacteria 1160
101 Ga0070685_10216178 3300005466 Unclassified 1253
102 Ga0070679_100010563 3300005530 Bacteria 8758
103 Ga0070679_100133314 3300005530 Bacteria 2465
104 Ga0070679_100318331 3300005530 Bacteria 1505
105 Ga0070684_100001482 3300005535 Bacteria 16944
106 Ga0070684_100300996 3300005535 Bacteria 1472
107 Ga0068853_100000587 3300005539 Bacteria 24911
108 Ga0068853_100012761 3300005539 Bacteria 6841
109 Ga0068853_100057786 3300005539 Bacteria 3348
110 Ga0068853_100059639 3300005539 Bacteria 3297
111 Ga0068853_100075221 3300005539 Bacteria 2947
112 Ga0068853_100126842 3300005539 Unclassified 2280
113 Ga0070672_100010139 3300005543 Bacteria 6524
114 Ga0070672_100040234 3300005543 Bacteria 3585
115 Ga0070672_100049148 3300005543 Unclassified 3280
116 Ga0070672_100106294 3300005543 Unclassified 2283
117 Ga0070665_100023780 3300005548 Bacteria 6172
118 Ga0070665_100052583 3300005548 Bacteria 4084
119 Ga0070665_100178907 3300005548 Unclassified 2122
120 Ga0068855_100018296 3300005563 Bacteria 8417
121 Ga0068855_100092780 3300005563 Bacteria 3482
122 Ga0068855_100384486 3300005563 Bacteria 1540
123 Ga0068855_100403241 3300005563 Bacteria 1498
124 Ga0070664_100003748 3300005564 Bacteria 12259
125 Ga0070664_100005479 3300005564 Bacteria 10190
126 Ga0070664_100077056 3300005564 Bacteria 2866
127 Ga0070664_100128718 3300005564 Bacteria 2223
128 Ga0070664_100158950 3300005564 Bacteria 1998
129 Ga0070664_100342459 3300005564 Bacteria 1358
130 Ga0070664_100708261 3300005564 Unclassified 938
131 Ga0068857_100009648 3300005577 Bacteria 8386
132 Ga0068857_100023808 3300005577 Bacteria 5392
133 Ga0068857_100085901 3300005577 Bacteria 2813
134 Ga0068857_100160026 3300005577 Bacteria 2043
135 Ga0068854_100023224 3300005578 Bacteria 4234
136 Ga0068854_100142896 3300005578 Bacteria 1838
137 Ga0068854_100152399 3300005578 Bacteria 1784
138 Ga0068856_100011868 3300005614 Bacteria 8439
139 Ga0068856_100102227 3300005614 Bacteria 2859
140 Ga0068856_100659637 3300005614 Bacteria 1067
141 Ga0068852_100077801 3300005616 Unclassified 2933
142 Ga0068852_100119730 3300005616 Bacteria 2407
143 Ga0068852_100200363 3300005616 Bacteria 1889
144 Ga0068852_100319652 3300005616 Bacteria 1507
145 Ga0068859_100002592 3300005617 Bacteria 18396
146 Ga0068859_100013846 3300005617 Bacteria 8087
147 Ga0068859_100024694 3300005617 Bacteria 6031
148 Ga0068859_100084604 3300005617 Unclassified 3217
149 Ga0068859_100224814 3300005617 Bacteria 1965
150 Ga0068864_100002829 3300005618 Bacteria 14322
151 Ga0068864_100005927 3300005618 Bacteria 10018
152 Ga0068866_10084562 3300005718 Bacteria 1712
153 Ga0068861_100003231 3300005719 Bacteria 10780
154 Ga0068861_100067221 3300005719 Unclassified 2765
155 Ga0068861_100147103 3300005719 Bacteria 1929
156 Ga0068851_10007239 3300005834 Bacteria 5086
157 Ga0068851_10010917 3300005834 Bacteria 4248
158 Ga0068870_10005825 3300005840 Bacteria 5406
159 Ga0068863_100042397 3300005841 Bacteria 4324
160 Ga0068863_100532060 3300005841 Unclassified 1159
161 Ga0068858_100004728 3300005842 Bacteria 13335
162 Ga0068860_100004018 3300005843 Bacteria 15106
163 Ga0068860_100044454 3300005843 Bacteria 4233
164 Ga0068860_100051086 3300005843 Bacteria 3934
165 Ga0068860_100091649 3300005843 Bacteria 2896
166 Ga0068860_100250971 3300005843 Bacteria 1723
167 Ga0068860_100391313 3300005843 Unclassified 1374
168 Ga0068862_100008604 3300005844 Bacteria 8444
169 Ga0068862_100037071 3300005844 Bacteria 4132
170 Ga0068862_100074544 3300005844 Bacteria 2934
171 Ga0068862_100176661 3300005844 Bacteria 1914
172 Ga0068862_100202015 3300005844 Unclassified 1792
173 Ga0068862_100530614 3300005844 Bacteria 1121
174 Ga0075366_10003622 3300006195 Bacteria 8184
175 Ga0075366_10028431 3300006195 Bacteria 3281
176 Ga0097621_100007509 3300006237 Bacteria 7804
177 Ga0097621_100013054 3300006237 Bacteria 6177
178 Ga0097621_100128098 3300006237 Unclassified 2157
179 Ga0068871_100027770 3300006358 Bacteria 4429
180 Ga0068871_100054619 3300006358 Unclassified 3241
181 Ga0068871_100214123 3300006358 Bacteria 1667
182 Ga0068865_100028645 3300006881 Unclassified 3689
183 Ga0068865_100042365 3300006881 Bacteria 3104
184 Ga0068865_100063758 3300006881 Unclassified 2592
185 Ga0097620_100002592 3300006931 Bacteria 18396
186 Ga0097620_100013847 3300006931 Bacteria 8087
187 Ga0097620_100024691 3300006931 Bacteria 6031
188 Ga0097620_100084604 3300006931 Unclassified 3217
189 Ga0097620_100224809 3300006931 Bacteria 1965
190 Ga0105240_10000833 3300009093 Bacteria 55556
191 Ga0105240_10064996 3300009093 Bacteria 4530
192 Ga0105240_10379970 3300009093 Bacteria 1595
193 Ga0111539_10009518 3300009094 Bacteria 12264
194 Ga0111539_10042295 3300009094 Bacteria 5474
195 Ga0111539_10141865 3300009094 Unclassified 2812
196 Ga0114129_10004170 3300009147 Bacteria 20413
197 Ga0105241_10027639 3300009174 Bacteria 4225
198 Ga0105241_10316313 3300009174 Bacteria 1344
199 Ga0105242_10025813 3300009176 Bacteria 4653
200 Ga0105242_10029644 3300009176 Bacteria 4364
201 Ga0105248_10006702 3300009177 Bacteria 12632
202 Ga0105237_10002503 3300009545 Bacteria 22768
203 Ga0105237_10029490 3300009545 Bacteria 5577
204 Ga0105237_10219385 3300009545 Bacteria 1902
205 Ga0105237_10222704 3300009545 Bacteria 1887
206 Ga0105237_10249766 3300009545 Bacteria 1776
207 Ga0105238_10031339 3300009551 Bacteria 5412
208 Ga0105249_10004433 3300009553 Bacteria 12145
209 Ga0105249_10064698 3300009553 Bacteria 3363
210 Ga0105249_10069678 3300009553 Bacteria 3246
211 Ga0105239_10001651 3300010375 Bacteria 29415
212 Ga0105239_10022970 3300010375 Bacteria 6877
213 Ga0105239_10025119 3300010375 Bacteria 6562
214 Ga0105239_10038549 3300010375 Bacteria 5237
215 Ga0105239_10058799 3300010375 Bacteria 4219
216 Ga0105239_10228926 3300010375 Bacteria 2085
217 Ga0105239_10308049 3300010375 Bacteria 1784
218 Ga0105246_10023882 3300011119 Bacteria 3962
219 Ga0105246_10130164 3300011119 Unclassified 1878
220 Ga0157371_10013687 3300013102 Bacteria 6154
221 Ga0157371_10015038 3300013102 Bacteria 5818
222 Ga0157371_10029151 3300013102 Bacteria 3995
223 Ga0157371_10053410 3300013102 Bacteria 2869
224 Ga0157371_10072673 3300013102 Bacteria 2435
225 Ga0157371_10077589 3300013102 Bacteria 2352
226 Ga0157371_10095895 3300013102 Bacteria 2102
227 Ga0157371_10197695 3300013102 Bacteria 1441
228 Ga0157371_10236194 3300013102 Unclassified 1314
229 Ga0157370_10001675 3300013104 Bacteria 27295
230 Ga0157370_10013227 3300013104 Bacteria 8504
231 Ga0157369_10157382 3300013105 Bacteria 2399
232 Ga0157369_10180242 3300013105 Bacteria 2223
233 Ga0157374_10000003 3300013296 Bacteria 854471
234 Ga0157374_10000332 3300013296 Bacteria 43569
235 Ga0157374_10055701 3300013296 Unclassified 3691
236 Ga0157374_10084384 3300013296 Bacteria 3019
237 Ga0157374_10401769 3300013296 Bacteria 1367
238 Ga0157374_10499047 3300013296 Bacteria 1221
239 Ga0157374_10560953 3300013296 Bacteria 1150
240 Ga0157378_10010915 3300013297 Bacteria 7945
241 Ga0157378_10041607 3300013297 Bacteria 4076
242 Ga0157378_10138670 3300013297 Bacteria 2257
243 Ga0157378_10287004 3300013297 Bacteria 1588
244 Ga0157378_10531096 3300013297 Bacteria 1179
245 Ga0163162_10016960 3300013306 Bacteria 7124
246 Ga0163162_10020880 3300013306 Bacteria 6441
247 Ga0157372_10014553 3300013307 Bacteria 8416
248 Ga0157372_10022408 3300013307 Bacteria 6835
249 Ga0157372_10043112 3300013307 Bacteria 4994
250 Ga0157372_10084862 3300013307 Bacteria 3591
251 Ga0157372_10104187 3300013307 Bacteria 3242
252 Ga0157372_10165526 3300013307 Bacteria 2557
253 Ga0157372_10166471 3300013307 Bacteria 2549
254 Ga0157372_10215604 3300013307 Bacteria 2225
255 Ga0157372_10258535 3300013307 Bacteria 2022
256 Ga0157372_10278648 3300013307 Bacteria 1944
257 Ga0157372_10284765 3300013307 Unclassified 1922
258 Ga0157372_10507971 3300013307 Bacteria 1405
259 Ga0157372_10557754 3300013307 Unclassified 1335
260 Ga0157375_10002052 3300013308 Bacteria 17382
261 Ga0157375_10016577 3300013308 Bacteria 6624
262 Ga0157375_10046366 3300013308 Unclassified 4237
263 Ga0163163_10000057 3300014325 Bacteria 124939
264 Ga0163163_10008368 3300014325 Bacteria 9185
265 Ga0163163_10043321 3300014325 Bacteria 4412
266 Ga0157380_10003774 3300014326 Bacteria 10414
267 Ga0157380_10003783 3300014326 Bacteria 10406
268 Ga0157380_10236916 3300014326 Unclassified 1643
269 Ga0157377_10002028 3300014745 Bacteria 8873
270 Ga0157377_10035642 3300014745 Bacteria 2730
271 Ga0157379_10002403 3300014968 Bacteria 15642
272 Ga0157379_10029795 3300014968 Bacteria 4853
273 Ga0157376_10000580 3300014969 Bacteria 23607
274 Ga0157376_10035642 3300014969 Bacteria 4025
275 Ga0157376_10313339 3300014969 Bacteria 1489
276 Ga0157376_10741159 3300014969 Bacteria 991
277 Ga0182005_1000200 3300015265 Bacteria 40796
278 Ga0163161_10204953 3300017792 Bacteria 1521
279 Ga0213876_10002322 3300021384 Bacteria 11223
280 Ga0209436_100727 3300025208 Bacteria 13737
281 Ga0209436_100843 3300025208 Bacteria 12365
282 Ga0209646_1000003 3300025246 Bacteria 1160860
283 Ga0209646_1001541 3300025246 Bacteria 6079
284 Ga0209026_1000202 3300025250 Bacteria 82517
285 Ga0209130_1001462 3300025284 Bacteria 15516
286 Ga0207426_1000288 3300025302 Bacteria 100477
287 Ga0207426_1000364 3300025302 Bacteria 80671
288 Ga0207426_1001181 3300025302 Bacteria 23338
289 Ga0207426_1011763 3300025302 Bacteria 3314
290 Ga0209257_1000025 3300025304 Bacteria 724838
291 Ga0207697_10041978 3300025315 Bacteria 1879
292 Ga0207656_10003984 3300025321 Bacteria 5119
293 Ga0207656_10024680 3300025321 Bacteria 2434
294 Ga0207680_10031543 3300025903 Bacteria 3002
295 Ga0207680_10032953 3300025903 Unclassified 2950
296 Ga0207647_10000064 3300025904 Bacteria 82970
297 Ga0207647_10142341 3300025904 Bacteria 1405
298 Ga0207647_10189583 3300025904 Bacteria 1192
299 Ga0207645_10000723 3300025907 Bacteria 27486
300 Ga0207645_10015325 3300025907 Bacteria 5097
301 Ga0207643_10004129 3300025908 Bacteria 7822
302 Ga0207643_10005470 3300025908 Bacteria 6792
303 Ga0207705_10024772 3300025909 Bacteria 4282
304 Ga0207705_10071166 3300025909 Unclassified 2521
305 Ga0207654_10110630 3300025911 Bacteria 1709
306 Ga0207707_10169772 3300025912 Bacteria 1907
307 Ga0207695_10000184 3300025913 Bacteria 181201
308 Ga0207695_10021088 3300025913 Bacteria 7442
309 Ga0207695_10523895 3300025913 Bacteria 1067
310 Ga0207671_10001942 3300025914 Bacteria 22821
311 Ga0207671_10170587 3300025914 Bacteria 1689
312 Ga0207671_10193164 3300025914 Bacteria 1588
313 Ga0207671_10456659 3300025914 Bacteria 1018
314 Ga0207660_10398557 3300025917 Unclassified 1108
315 Ga0207662_10073097 3300025918 Bacteria 2079
316 Ga0207657_10012983 3300025919 Bacteria 8187
317 Ga0207652_10010197 3300025921 Bacteria 7563
318 Ga0207652_10013779 3300025921 Bacteria 6539
319 Ga0207652_10183351 3300025921 Bacteria 1882
320 Ga0207681_10018475 3300025923 Bacteria 4392
321 Ga0207681_10091674 3300025923 Bacteria 2171
322 Ga0207650_10002096 3300025925 Bacteria 13946
323 Ga0207650_10186238 3300025925 Bacteria 1656
324 Ga0207650_10441175 3300025925 Bacteria 1082
325 Ga0207659_10216852 3300025926 Bacteria 1536
326 Ga0207644_10388378 3300025931 Bacteria 1139
327 Ga0207690_10103506 3300025932 Unclassified 2038
328 Ga0207690_10404694 3300025932 Bacteria 1089
329 Ga0207706_10038540 3300025933 Bacteria 4239
330 Ga0207706_10108774 3300025933 Bacteria 2439
331 Ga0207706_10113581 3300025933 Unclassified 2382
332 Ga0207706_10327988 3300025933 Bacteria 1332
333 Ga0207686_10044334 3300025934 Bacteria 2730
334 Ga0207704_10004363 3300025938 Bacteria 6469
335 Ga0207704_10030316 3300025938 Bacteria 3031
336 Ga0207691_10000596 3300025940 Bacteria 36065
337 Ga0207691_10073276 3300025940 Unclassified 3088
338 Ga0207691_10079708 3300025940 Unclassified 2947
339 Ga0207691_10219259 3300025940 Bacteria 1650
340 Ga0207691_10493310 3300025940 Bacteria 1040
341 Ga0207711_10052344 3300025941 Bacteria 3499
342 Ga0207689_10002983 3300025942 Bacteria 15619
343 Ga0207689_10006434 3300025942 Bacteria 10387
344 Ga0207689_10030775 3300025942 Bacteria 4472
345 Ga0207661_10007070 3300025944 Bacteria 7968
346 Ga0207661_10169159 3300025944 Bacteria 1902
347 Ga0207679_10050488 3300025945 Bacteria 3040
348 Ga0207679_10103466 3300025945 Bacteria 2231
349 Ga0207679_10128352 3300025945 Unclassified 2030
350 Ga0207679_10217753 3300025945 Bacteria 1605
351 Ga0207679_10252359 3300025945 Bacteria 1500
352 Ga0207679_10286113 3300025945 Bacteria 1415
353 Ga0207679_10373750 3300025945 Bacteria 1248
354 Ga0207667_10161535 3300025949 Bacteria 2304
355 Ga0207667_10204043 3300025949 Bacteria 2028
356 Ga0207667_10342416 3300025949 Bacteria 1526
357 Ga0207651_10041220 3300025960 Bacteria 3063
358 Ga0207651_10072565 3300025960 Bacteria 2444
359 Ga0207651_10144672 3300025960 Bacteria 1841
360 Ga0207651_10173572 3300025960 Bacteria 1703
361 Ga0207712_10052693 3300025961 Bacteria 2851
362 Ga0207712_10331965 3300025961 Bacteria 1258
363 Ga0207668_10020118 3300025972 Unclassified 4233
364 Ga0207668_10029696 3300025972 Unclassified 3586
365 Ga0207668_10167804 3300025972 Bacteria 1718
366 Ga0207668_10319301 3300025972 Unclassified 1288
367 Ga0207640_10129418 3300025981 Bacteria 1822
368 Ga0207640_10134798 3300025981 Bacteria 1791
369 Ga0207640_10520719 3300025981 Bacteria 994
370 Ga0207658_10040189 3300025986 Bacteria 3379
371 Ga0207658_10059218 3300025986 Unclassified 2853
372 Ga0207658_10119271 3300025986 Bacteria 2100
373 Ga0207677_10012236 3300026023 Bacteria 4924
374 Ga0207677_10275127 3300026023 Bacteria 1379
375 Ga0207677_10305329 3300026023 Bacteria 1316
376 Ga0207703_10090756 3300026035 Unclassified 2568
377 Ga0207639_10021474 3300026041 Bacteria 4638
378 Ga0207639_10076318 3300026041 Bacteria 2638
379 Ga0207639_10092702 3300026041 Unclassified 2421
380 Ga0207639_10180607 3300026041 Bacteria 1795
381 Ga0207639_10185237 3300026041 Unclassified 1774
382 Ga0207639_10242799 3300026041 Bacteria 1567
383 Ga0207678_10125977 3300026067 Bacteria 2185
384 Ga0207708_10130901 3300026075 Unclassified 1961
385 Ga0207708_10518592 3300026075 Unclassified 1001
386 Ga0207702_10008170 3300026078 Bacteria 8848
387 Ga0207702_10213888 3300026078 Bacteria 1793
388 Ga0207702_10541006 3300026078 Bacteria 1138
389 Ga0207641_10016996 3300026088 Bacteria 5956
390 Ga0207641_10121421 3300026088 Bacteria 2332
391 Ga0207641_10453379 3300026088 Bacteria 1240
392 Ga0207648_10001434 3300026089 Bacteria 26245
393 Ga0207648_10001885 3300026089 Bacteria 22909
394 Ga0207648_10017340 3300026089 Bacteria 6557
395 Ga0207648_10055241 3300026089 Bacteria 3467
396 Ga0207648_10059177 3300026089 Bacteria 3341
397 Ga0207648_10089167 3300026089 Bacteria 2694
398 Ga0207676_10000567 3300026095 Bacteria 30636
399 Ga0207676_10004151 3300026095 Bacteria 10229
400 Ga0207676_10179881 3300026095 Bacteria 1851
401 Ga0207674_10003147 3300026116 Bacteria 20340
402 Ga0207674_10077242 3300026116 Bacteria 3336
403 Ga0207674_10078738 3300026116 Bacteria 3301
404 Ga0207674_10126499 3300026116 Bacteria 2521
405 Ga0207674_10146701 3300026116 Bacteria 2318
406 Ga0207674_10205265 3300026116 Unclassified 1920
407 Ga0207674_10730416 3300026116 Unclassified 956
408 Ga0207675_100000820 3300026118 Bacteria 30929
409 Ga0207675_100046429 3300026118 Bacteria 4058
410 Ga0207675_100092089 3300026118 Bacteria 2851
411 Ga0207683_10001858 3300026121 Bacteria 18672
412 Ga0207683_10264623 3300026121 Bacteria 1570
413 Ga0207698_10011370 3300026142 Bacteria 5769
414 Ga0207698_10193636 3300026142 Bacteria 1814
415 Ga0207698_10469360 3300026142 Bacteria 1218
416 Ga0207698_10501013 3300026142 Bacteria 1182
417 Ga0268266_10101315 3300028379 Unclassified 2538
418 Ga0268266_10113276 3300028379 Unclassified 2405
419 Ga0268266_10142243 3300028379 Unclassified 2154
420 Ga0268265_10065736 3300028380 Bacteria 2800
421 Ga0268265_10207162 3300028380 Bacteria 1706
422 Ga0268265_10264088 3300028380 Bacteria 1532
423 Ga0268265_10409219 3300028380 Bacteria 1256
424 Ga0268264_10002838 3300028381 Bacteria 15116
425 Ga0268264_10008169 3300028381 Bacteria 8691
426 Ga0268264_10034453 3300028381 Bacteria 4165
427 Ga0268264_10053777 3300028381 Unclassified 3360
428 Ga0268264_10149426 3300028381 Bacteria 2093
429 Ga0268264_10371400 3300028381 Bacteria 1367
430 Ga0265323_10002899 3300028653 Bacteria 7693
431 Ga0265323_10005347 3300028653 Bacteria 5460
432 Ga0307517_10014647 3300028786 Bacteria 10505
433 Ga0307515_10000016 3300028794 Bacteria 554870
434 Ga0307515_10029218 3300028794 Bacteria 9330
435 Ga0307515_10221308 3300028794 Unclassified 1710
436 Ga0307515_10324595 3300028794 Bacteria 1203
437 Ga0265338_10052243 3300028800 Unclassified 3670
438 Ga0265324_10012898 3300029957 Unclassified 3135
439 Ga0307511_10000367 3300030521 Bacteria 48024
440 Ga0265327_10091941 3300031251 Bacteria 1478
441 Ga0265316_10051565 3300031344 Bacteria 3232
442 Ga0265316_10102954 3300031344 Unclassified 2168
443 Ga0307513_10153004 3300031456 Bacteria 2212
444 Ga0307513_10245027 3300031456 Bacteria 1594
445 Ga0307513_10247887 3300031456 Bacteria 1580
446 Ga0265342_10117680 3300031712 Bacteria 1499
447 Ga0307516_10000956 3300031730 Bacteria 39870
448 Ga0316577_10096403 3300031733 Unclassified 1657
449 Ga0307406_10042565 3300031901 Bacteria 2836
450 Ga0307406_10264667 3300031901 Bacteria 1303
451 Ga0307416_100189486 3300032002 Bacteria 1938
452 Ga0307414_10232181 3300032004 Unclassified 1522
453 Ga0307510_10001340 3300033180 Bacteria 26855
454 Ga0307510_10295876 3300033180 Bacteria 1083
455 Ga0373945_0082478 3300035116 Bacteria 1234
456 Ga0316584_0060279 3300036712 Bacteria 2842
457 Ga0395899_0000001 3300037312 Bacteria 1750322
458 Ga0395899_0025727 3300037312 Bacteria 4442
459 Ga0395899_0037753 3300037312 Bacteria 3620
460 Ga0395899_0052135 3300037312 Bacteria 3034
461 Ga0395900_0003968 3300037418 Bacteria 15792
462 Ga0395900_0054439 3300037418 Bacteria 4120
463 Ga0395900_0382984 3300037418 Bacteria 1374
464 Ga0395898_0003014 3300037466 Bacteria 19101
465 Ga0395901_0002287 3300038443 Bacteria 19537
466 Ga0395901_0183547 3300038443 Bacteria 2194
467 Ga0436365_1583419 3300039437 Bacteria 23084
468 Ga0451791_0291527 3300041451 Bacteria 1017
469 Ga0451800_0821011 3300041459 Bacteria 1020
470 Ga0451853_1731719 3300041512 Bacteria 2302
471 Ga0439431_0004005 3300041997 Bacteria 3242
472 Ga0439445_0007823 3300042004 Bacteria 2490
473 Ga0439449_0008015 3300042007 Bacteria 4012
474 Ga0439457_005695 3300042014 Bacteria 3101
475 Ga0439462_0025904 3300042015 Bacteria 1544
476 Ga0451577_0025056 3300042876 Bacteria 5415
477 Ga0466969_0000030 3300044656 Bacteria 90368
478 Ga0466972_0000139 3300044658 Bacteria 59557
479 Ga0466972_0028069 3300044658 Bacteria 2780
480 Ga0466966_0000293 3300044684 Bacteria 32754
481 Ga0453684_0096014 3300044712 Bacteria 3643
482 Ga0466957_0014862 3300044842 Bacteria 4539
483 Ga0466959_0000021 3300045049 Bacteria 132387
484 Ga0495627_004166 3300046453 Bacteria 6131
485 Ga0495638_0057385 3300046460 Bacteria 2415
486 Ga0495585_0000167 3300046492 Bacteria 70874
487 Ga0495633_0000154 3300046558 Bacteria 90209
488 Ga0495611_0000057 3300046648 Bacteria 80239
489 Ga0495670_0065337 3300046691 Bacteria 1834
490 Ga0495672_0064372 3300047320 Bacteria 2100
491 Ga0495686_0000041 3300047472 Bacteria 297599
492 Ga0495686_0067760 3300047472 Bacteria 2203
493 Ga0496101_0369923 3300048904 Bacteria 1127
494 Ga0496109_0085535 3300048912 Bacteria 2911
495 Ga0496109_0110904 3300048912 Unclassified 2551
496 Ga0496115_0003204 3300048918 Bacteria 11755
497 Ga0496126_0014195 3300048929 Bacteria 8061
498 Ga0501290_008537 3300049513 Bacteria 1297
499 Ga0501034_0000007 3300049571 Bacteria 357805
500 Ga0501034_0003274 3300049571 Bacteria 18491
501 Ga0501034_0066739 3300049571 Bacteria 3611
502 Ga0501034_0090734 3300049571 Bacteria 3053
503 Ga0501034_0105221 3300049571 Bacteria 2815
504 Ga0501034_0166846 3300049571 Bacteria 2170
505 Ga0501037_0249506 3300049573 Bacteria 1242
506 Ga0501047_0064799 3300049581 Bacteria 3524
507 Ga0501047_0112390 3300049581 Bacteria 2606
508 Ga0501048_0158415 3300049582 Bacteria 1602
509 Ga0501070_0339318 3300049586 Unclassified 1221
510 Ga0501071_0466577 3300049587 Bacteria 967
511 Ga0501073_0010702 3300049589 Bacteria 6719
512 Ga0501249_009822 3300049679 Unclassified 1993
513 Ga0501257_028616 3300049686 Bacteria 1337
514 Ga0501225_0002249 3300049705 Bacteria 5969
515 Ga0501080_0167626 3300049742 Bacteria 2026
516 Ga0501044_0020929 3300049823 Bacteria 6985
517 Ga0501044_0128661 3300049823 Bacteria 2528
518 Ga0501044_0305492 3300049823 Bacteria 1519
519 nmdc:mga05p37_4275_c1 3300050507 Bacteria 16686
520 nmdc:mga08y16_15548_c1 3300050511 Bacteria 8002
521 nmdc:mga08y16_421465_c1 3300050511 Unclassified 1364
522 Ga0500578_0000012 3300053086 Bacteria 188658
523 Ga0500578_0167083 3300053086 Bacteria 1362
524 Ga0500644_0038280 3300053088 Bacteria 1573
525 Ga0500583_0000022 3300053092 Bacteria 124636
526 Ga0500583_0000455 3300053092 Bacteria 12801
527 Ga0500650_0101358 3300053098 Bacteria 1347
528 Ga0500562_000007 3300053108 Bacteria 241755
529 Ga0500559_0031882 3300053136 Bacteria 2262
530 Ga0500568_0004670 3300053139 Bacteria 7281
531 Ga0500588_0013582 3300053146 Bacteria 2046
532 Ga0500616_0019104 3300053153 Bacteria 3867
533 Ga0500616_0104923 3300053153 Unclassified 1375
534 Ga0500622_0000575 3300053156 Bacteria 33359
535 Ga0500636_0038747 3300053177 Bacteria 2819
536 Ga0500611_000002 3300053727 Bacteria 345991
537 Ga0500645_006849 3300053730 Bacteria 4026
538 Ga0501084_0035403 3300054114 Bacteria 4173
539 Ga0501082_0196592 3300060353 Bacteria 1754
540 2522553000 2522125168 Bacteria 7376607
541 2738728538 2738541278 Bacteria 9755573
542 2819577678 2818991442 Bacteria 8318214
543 2819590004 2818991444 Bacteria 6968812
544 2821142651 2821136567 Bacteria 8080116
545 2884793460 2884791551 Bacteria 8511252
546 2904470181 2904467357 Bacteria 8057758
547 2929155792 2929154850 Bacteria 6753285
548 Ga0466957_0000474
549 SwRhRL2b_contig_1663050
550 MBSR1b_contig_8395545
551 JGI24740J21852_10000881
552 JGI24739J22299_10001910
553 JGI24737J22298_10001399
554 JGI24735J21928_10000004
555 JGI25157J39369_1002312
556 rootH1_10008782
557 rootH1_10175978
558 rootH2_10001201
559 rootH2_10010515
560 rootH2_10071179
561 rootL2_10037652
562 rootL2_10204145
563 rootL2_10267457
564 rootL2_10311072
565 rootH1_10022382
566 rootH1_10083748
567 rootH1_10290119
568 rootH1_10378186
569 JGI25160J50197_1001714
570 JGI25160J50197_1006092
571 Ga0055531_10000139
572 Ga0065165_1022796
573 Ga0065714_10008835
574 Ga0065704_10070140
575 Ga0065712_10026012
576 Ga0065712_10088050
577 Ga0070658_10007677
578 Ga0070658_10226304
579 Ga0070676_10034971
580 Ga0070676_10064093
581 Ga0070683_100001570
582 Ga0070683_100006866
583 Ga0070683_100533591
584 Ga0070690_100130653
585 Ga0070670_100035814
586 Ga0070670_100049990
587 Ga0070670_100423388
588 Ga0070670_100433409
589 Ga0068869_100000952
590 Ga0068869_100008047
591 Ga0068869_100022140
592 Ga0068869_100082668
593 Ga0070666_10002979
594 Ga0070666_10026914
595 Ga0070680_100029806
596 Ga0070680_100090073
597 Ga0070680_100130229
598 Ga0070682_100043648
599 Ga0070682_100253186
600 Ga0068868_100016312
601 Ga0068868_100073117
602 Ga0068868_100103924
603 Ga0068868_100189036
604 Ga0070689_100004331
605 Ga0070687_100047451
606 Ga0070687_100058567
607 Ga0070661_100001443
608 Ga0070661_100109051
609 Ga0070668_100034157
610 Ga0070668_100044351
611 Ga0070668_100058192
612 Ga0070668_100070973
613 Ga0070668_100073054
614 Ga0070669_100001762
615 Ga0070669_100075723
616 Ga0070669_100283366
617 Ga0070675_100020875
618 Ga0070675_100104805
619 Ga0070675_100117332
620 Ga0070671_100061343
621 Ga0070671_100172327
622 Ga0070674_100175201
623 Ga0070673_100012921
624 Ga0070673_100013678
625 Ga0070673_100050097
626 Ga0070673_100081489
627 Ga0070688_100000526
628 Ga0070688_100038169
629 Ga0070659_100326548
630 Ga0070659_100357481
631 Ga0070659_100454030
632 Ga0070667_100007158
633 Ga0070667_100011690
634 Ga0070667_100050288
635 Ga0070667_100363522
636 Ga0070700_100098164
637 Ga0070678_100001380
638 Ga0070678_100269556
639 Ga0070662_100018799
640 Ga0070662_100028117
641 Ga0070662_100081360
642 Ga0070662_100099135
643 Ga0070681_10080711
644 Ga0070681_10170436
645 Ga0068867_100025829
646 Ga0068867_100071195
647 Ga0068867_100398660
648 Ga0070685_10216178
649 Ga0070679_100010563
650 Ga0070679_100133314
651 Ga0070679_100318331
652 Ga0070684_100001482
653 Ga0070684_100300996
654 Ga0068853_100000587
655 Ga0068853_100012761
656 Ga0068853_100057786
657 Ga0068853_100059639
658 Ga0068853_100075221
659 Ga0068853_100126842
660 Ga0070672_100010139
661 Ga0070672_100040234
662 Ga0070672_100049148
663 Ga0070672_100106294
664 Ga0070665_100023780
665 Ga0070665_100052583
666 Ga0070665_100178907
667 Ga0068855_100018296
668 Ga0068855_100092780
669 Ga0068855_100384486
670 Ga0068855_100403241
671 Ga0070664_100003748
672 Ga0070664_100005479
673 Ga0070664_100077056
674 Ga0070664_100128718
675 Ga0070664_100158950
676 Ga0070664_100342459
677 Ga0070664_100708261
678 Ga0068857_100009648
679 Ga0068857_100023808
680 Ga0068857_100085901
681 Ga0068857_100160026
682 Ga0068854_100023224
683 Ga0068854_100142896
684 Ga0068854_100152399
685 Ga0068856_100011868
686 Ga0068856_100102227
687 Ga0068856_100659637
688 Ga0068852_100077801
689 Ga0068852_100119730
690 Ga0068852_100200363
691 Ga0068852_100319652
692 Ga0068859_100002592
693 Ga0068859_100013846
694 Ga0068859_100024694
695 Ga0068859_100084604
696 Ga0068859_100224814
697 Ga0068864_100002829
698 Ga0068864_100005927
699 Ga0068866_10084562
700 Ga0068861_100003231
701 Ga0068861_100067221
702 Ga0068861_100147103
703 Ga0068851_10007239
704 Ga0068851_10010917
705 Ga0068870_10005825
706 Ga0068863_100042397
707 Ga0068863_100532060
708 Ga0068858_100004728
709 Ga0068860_100004018
710 Ga0068860_100044454
711 Ga0068860_100051086
712 Ga0068860_100091649
713 Ga0068860_100250971
714 Ga0068860_100391313
715 Ga0068862_100008604
716 Ga0068862_100037071
717 Ga0068862_100074544
718 Ga0068862_100176661
719 Ga0068862_100202015
720 Ga0068862_100530614
721 Ga0075366_10003622
722 Ga0075366_10028431
723 Ga0097621_100007509
724 Ga0097621_100013054
725 Ga0097621_100128098
726 Ga0068871_100027770
727 Ga0068871_100054619
728 Ga0068871_100214123
729 Ga0068865_100028645
730 Ga0068865_100042365
731 Ga0068865_100063758
732 Ga0097620_100002592
733 Ga0097620_100013847
734 Ga0097620_100024691
735 Ga0097620_100084604
736 Ga0097620_100224809
737 Ga0105240_10000833
738 Ga0105240_10064996
739 Ga0105240_10379970
740 Ga0111539_10009518
741 Ga0111539_10042295
742 Ga0111539_10141865
743 Ga0114129_10004170
744 Ga0105241_10027639
745 Ga0105241_10316313
746 Ga0105242_10025813
747 Ga0105242_10029644
748 Ga0105248_10006702
749 Ga0105237_10002503
750 Ga0105237_10029490
751 Ga0105237_10219385
752 Ga0105237_10222704
753 Ga0105237_10249766
754 Ga0105238_10031339
755 Ga0105249_10004433
756 Ga0105249_10064698
757 Ga0105249_10069678
758 Ga0105239_10001651
759 Ga0105239_10022970
760 Ga0105239_10025119
761 Ga0105239_10038549
762 Ga0105239_10058799
763 Ga0105239_10228926
764 Ga0105239_10308049
765 Ga0105246_10023882
766 Ga0105246_10130164
767 Ga0157371_10013687
768 Ga0157371_10015038
769 Ga0157371_10029151
770 Ga0157371_10053410
771 Ga0157371_10072673
772 Ga0157371_10077589
773 Ga0157371_10095895
774 Ga0157371_10197695
775 Ga0157371_10236194
776 Ga0157370_10001675
777 Ga0157370_10013227
778 Ga0157369_10157382
779 Ga0157369_10180242
780 Ga0157374_10000003
781 Ga0157374_10000332
782 Ga0157374_10055701
783 Ga0157374_10084384
784 Ga0157374_10401769
785 Ga0157374_10499047
786 Ga0157374_10560953
787 Ga0157378_10010915
788 Ga0157378_10041607
789 Ga0157378_10138670
790 Ga0157378_10287004
791 Ga0157378_10531096
792 Ga0163162_10016960
793 Ga0163162_10020880
794 Ga0157372_10014553
795 Ga0157372_10022408
796 Ga0157372_10043112
797 Ga0157372_10084862
798 Ga0157372_10104187
799 Ga0157372_10165526
800 Ga0157372_10166471
801 Ga0157372_10215604
802 Ga0157372_10258535
803 Ga0157372_10278648
804 Ga0157372_10284765
805 Ga0157372_10507971
806 Ga0157372_10557754
807 Ga0157375_10002052
808 Ga0157375_10016577
809 Ga0157375_10046366
810 Ga0163163_10000057
811 Ga0163163_10008368
812 Ga0163163_10043321
813 Ga0157380_10003774
814 Ga0157380_10003783
815 Ga0157380_10236916
816 Ga0157377_10002028
817 Ga0157377_10035642
818 Ga0157379_10002403
819 Ga0157379_10029795
820 Ga0157376_10000580
821 Ga0157376_10035642
822 Ga0157376_10313339
823 Ga0157376_10741159
824 Ga0182005_1000200
825 Ga0163161_10204953
826 Ga0213876_10002322
827 Ga0209436_100727
828 Ga0209436_100843
829 Ga0209646_1000003
830 Ga0209646_1001541
831 Ga0209026_1000202
832 Ga0209130_1001462
833 Ga0207426_1000288
834 Ga0207426_1000364
835 Ga0207426_1001181
836 Ga0207426_1011763
837 Ga0209257_1000025
838 Ga0207697_10041978
839 Ga0207656_10003984
840 Ga0207656_10024680
841 Ga0207680_10031543
842 Ga0207680_10032953
843 Ga0207647_10000064
844 Ga0207647_10142341
845 Ga0207647_10189583
846 Ga0207645_10000723
847 Ga0207645_10015325
848 Ga0207643_10004129
849 Ga0207643_10005470
850 Ga0207705_10024772
851 Ga0207705_10071166
852 Ga0207654_10110630
853 Ga0207707_10169772
854 Ga0207695_10000184
855 Ga0207695_10021088
856 Ga0207695_10523895
857 Ga0207671_10001942
858 Ga0207671_10170587
859 Ga0207671_10193164
860 Ga0207671_10456659
861 Ga0207660_10398557
862 Ga0207662_10073097
863 Ga0207657_10012983
864 Ga0207652_10010197
865 Ga0207652_10013779
866 Ga0207652_10183351
867 Ga0207681_10018475
868 Ga0207681_10091674
869 Ga0207650_10002096
870 Ga0207650_10186238
871 Ga0207650_10441175
872 Ga0207659_10216852
873 Ga0207644_10388378
874 Ga0207690_10103506
875 Ga0207690_10404694
876 Ga0207706_10038540
877 Ga0207706_10108774
878 Ga0207706_10113581
879 Ga0207706_10327988
880 Ga0207686_10044334
881 Ga0207704_10004363
882 Ga0207704_10030316
883 Ga0207691_10000596
884 Ga0207691_10073276
885 Ga0207691_10079708
886 Ga0207691_10219259
887 Ga0207691_10493310
888 Ga0207711_10052344
889 Ga0207689_10002983
890 Ga0207689_10006434
891 Ga0207689_10030775
892 Ga0207661_10007070
893 Ga0207661_10169159
894 Ga0207679_10050488
895 Ga0207679_10103466
896 Ga0207679_10128352
897 Ga0207679_10217753
898 Ga0207679_10252359
899 Ga0207679_10286113
900 Ga0207679_10373750
901 Ga0207667_10161535
902 Ga0207667_10204043
903 Ga0207667_10342416
904 Ga0207651_10041220
905 Ga0207651_10072565
906 Ga0207651_10144672
907 Ga0207651_10173572
908 Ga0207712_10052693
909 Ga0207712_10331965
910 Ga0207668_10020118
911 Ga0207668_10029696
912 Ga0207668_10167804
913 Ga0207668_10319301
914 Ga0207640_10129418
915 Ga0207640_10134798
916 Ga0207640_10520719
917 Ga0207658_10040189
918 Ga0207658_10059218
919 Ga0207658_10119271
920 Ga0207677_10012236
921 Ga0207677_10275127
922 Ga0207677_10305329
923 Ga0207703_10090756
924 Ga0207639_10021474
925 Ga0207639_10076318
926 Ga0207639_10092702
927 Ga0207639_10180607
928 Ga0207639_10185237
929 Ga0207639_10242799
930 Ga0207678_10125977
931 Ga0207708_10130901
932 Ga0207708_10518592
933 Ga0207702_10008170
934 Ga0207702_10213888
935 Ga0207702_10541006
936 Ga0207641_10016996
937 Ga0207641_10121421
938 Ga0207641_10453379
939 Ga0207648_10001434
940 Ga0207648_10001885
941 Ga0207648_10017340
942 Ga0207648_10055241
943 Ga0207648_10059177
944 Ga0207648_10089167
945 Ga0207676_10000567
946 Ga0207676_10004151
947 Ga0207676_10179881
948 Ga0207674_10003147
949 Ga0207674_10077242
950 Ga0207674_10078738
951 Ga0207674_10126499
952 Ga0207674_10146701
953 Ga0207674_10205265
954 Ga0207674_10730416
955 Ga0207675_100000820
956 Ga0207675_100046429
957 Ga0207675_100092089
958 Ga0207683_10001858
959 Ga0207683_10264623
960 Ga0207698_10011370
961 Ga0207698_10193636
962 Ga0207698_10469360
963 Ga0207698_10501013
964 Ga0268266_10101315
965 Ga0268266_10113276
966 Ga0268266_10142243
967 Ga0268265_10065736
968 Ga0268265_10207162
969 Ga0268265_10264088
970 Ga0268265_10409219
971 Ga0268264_10002838
972 Ga0268264_10008169
973 Ga0268264_10034453
974 Ga0268264_10053777
975 Ga0268264_10149426
976 Ga0268264_10371400
977 Ga0265323_10002899
978 Ga0265323_10005347
979 Ga0307517_10014647
980 Ga0307515_10000016
981 Ga0307515_10029218
982 Ga0307515_10221308
983 Ga0307515_10324595
984 Ga0265338_10052243
985 Ga0265324_10012898
986 Ga0307511_10000367
987 Ga0265327_10091941
988 Ga0265316_10051565
989 Ga0265316_10102954
990 Ga0307513_10153004
991 Ga0307513_10245027
992 Ga0307513_10247887
993 Ga0265342_10117680
994 Ga0307516_10000956
995 Ga0316577_10096403
996 Ga0307406_10042565
997 Ga0307406_10264667
998 Ga0307416_100189486
999 Ga0307414_10232181
1000 Ga0307510_10001340
1001 Ga0307510_10295876
1002 Ga0373945_0082478
1003 Ga0316584_0060279
1004 Ga0395899_0000001
1005 Ga0395899_0025727
1006 Ga0395899_0037753
1007 Ga0395899_0052135
1008 Ga0395900_0003968
1009 Ga0395900_0054439
1010 Ga0395900_0382984
1011 Ga0395898_0003014
1012 Ga0395901_0002287
1013 Ga0395901_0183547
1014 Ga0436365_1583419
1015 Ga0451791_0291527
1016 Ga0451800_0821011
1017 Ga0451853_1731719
1018 Ga0439431_0004005
1019 Ga0439445_0007823
1020 Ga0439449_0008015
1021 Ga0439457_005695
1022 Ga0439462_0025904
1023 Ga0451577_0025056
1024 Ga0466969_0000030
1025 Ga0466972_0000139
1026 Ga0466972_0028069
1027 Ga0466966_0000293
1028 Ga0453684_0096014
1029 Ga0466957_0014862
1030 Ga0466959_0000021
1031 Ga0495627_004166
1032 Ga0495638_0057385
1033 Ga0495585_0000167
1034 Ga0495633_0000154
1035 Ga0495611_0000057
1036 Ga0495670_0065337
1037 Ga0495672_0064372
1038 Ga0495686_0000041
1039 Ga0495686_0067760
1040 Ga0496101_0369923
1041 Ga0496109_0085535
1042 Ga0496109_0110904
1043 Ga0496115_0003204
1044 Ga0496126_0014195
1045 Ga0501290_008537
1046 Ga0501034_0000007
1047 Ga0501034_0003274
1048 Ga0501034_0066739
1049 Ga0501034_0090734
1050 Ga0501034_0105221
1051 Ga0501034_0166846
1052 Ga0501037_0249506
1053 Ga0501047_0064799
1054 Ga0501047_0112390
1055 Ga0501048_0158415
1056 Ga0501070_0339318
1057 Ga0501071_0466577
1058 Ga0501073_0010702
1059 Ga0501249_009822
1060 Ga0501257_028616
1061 Ga0501225_0002249
1062 Ga0501080_0167626
1063 Ga0501044_0020929
1064 Ga0501044_0128661
1065 Ga0501044_0305492
1066 nmdc:mga05p37_4275_c1
1067 nmdc:mga08y16_15548_c1
1068 nmdc:mga08y16_421465_c1
1069 Ga0500578_0000012
1070 Ga0500578_0167083
1071 Ga0500644_0038280
1072 Ga0500583_0000022
1073 Ga0500583_0000455
1074 Ga0500650_0101358
1075 Ga0500562_000007
1076 Ga0500559_0031882
1077 Ga0500568_0004670
1078 Ga0500588_0013582
1079 Ga0500616_0019104
1080 Ga0500616_0104923
1081 Ga0500622_0000575
1082 Ga0500636_0038747
1083 Ga0500611_000002
1084 Ga0500645_006849
1085 Ga0501084_0035403
1086 Ga0501082_0196592
1087 2522553000
1088 2738728538
1089 2819577678
1090 2819590004
1091 2821142651
1092 2884793460
1093 2904470181
1094 2929155792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13847

Methyltransf_31

Methyltransferase domain

100

247

0.96

PF13649

Methyltransf_25

Methyltransferase domain

106

202

0.95

PF08241

Methyltransf_11

Methyltransferase domain

107

206

0.95

PF08242

Methyltransf_12

Methyltransferase domain

107

204

0.9

PF13489

Methyltransf_23

Methyltransferase domain

88

245

0.89

PF01170

UPF0020

RMKL-like, methyltransferase domain

96

179

0.88

PF13679

Methyltransf_32

Methyltransferase domain

93

199

0.88

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

94

245

0.87

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

93

227

0.83

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

88

208

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.8651 69 180
1dl5-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase 0.8404 69 179
6ec3-assembly3.cif.gz_C crystal structure of evdmo1 0.8382 77 267
6ec3-assembly1.cif.gz_A crystal structure of evdmo1 0.8313 77 267
6ec3-assembly2.cif.gz_B crystal structure of evdmo1 0.8287 77 267
ID Description Score Start End Superfamily
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9386 77 138 3.40.50.150
af_C7J169_1_82_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9362 70 129 3.40.50.150
af_Q55DF6_53_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9155 73 134 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9063 72 136 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9051 70 136 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1J1CZD0-F1-model_v4 deleted 0.9777 98 187
AF-J7T967-F1-model_v4 deleted 0.9276 62 201
AF-A0A848UHI9-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9106 75 274 GO:0008168
GO:0032259
AF-J7T967-F1-model_v4 deleted 0.9089 62 201
AF-A0A1J1CZD0-F1-model_v4 deleted 0.908 98 187

Map