F462265

General Info

Members Datasets Scaffolds Average Seq Length
548 359 1096 181

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0060431|Ga0451576_0060431_2960_3601
Length 213
Sequence MIVGIPGAHAPGEYLAFDAIRSCMQYAHDSHGGDRMSVDDTLVRWHAEEQEIRAKLAGASGVAREEQVRGRTGMQMFQAIFDGELPRPPIGDTLDFVPIRIEPGFAVFQGRPRAKHYNPLGTVHGGWFATLLDSAVGCAVHSTLPADKAYTTLELKLNIVRALTEAVPVVRAEGRLIHGGRQVATAEGRLVGPDGKLYAHATTTCLIFDRPPR

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
100 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
157 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
163 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
164 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
165 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
166 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
167 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
186 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
187 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
200 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
201 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
202 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
203 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
204 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
205 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
206 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
207 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
208 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
209 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
210 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
211 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
212 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
213 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
214 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
215 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
216 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
217 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
218 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
219 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
222 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
223 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
226 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
227 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
235 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
236 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
256 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
257 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
258 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
271 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
280 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
281 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
292 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
293 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
294 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
295 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
296 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
297 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
301 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
305 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
315 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
316 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
317 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
318 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
319 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
320 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
321 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
322 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
323 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
324 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
325 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
326 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
327 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
328 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
329 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
330 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
331 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
332 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
333 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
334 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
335 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
336 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
337 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
338 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
339 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
340 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
341 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
342 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
343 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
344 2643221585 Pelomonas sp. Root662 Isolate Unclassified
345 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
346 2643221656 Pelomonas sp. Root405 Isolate Unclassified
347 2643221717 Acidovorax sp. Root267 Isolate Unclassified
348 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
349 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
350 2831864461 Roseateles noduli HZ7 Isolate Nodule
351 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
352 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
353 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
354 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
355 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
356 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
357 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
358 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
359 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.88
Metatranscriptomes 1.64
Isolates 5.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.64
Nodule 0.18
Rhizoplane 4.56
Rhizosphere 62.23
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0060431 3300045051 Bacteria 3954
2 SwRhRL2b_contig_1996222 2162886007 Bacteria 7535
3 JGI25156J39149_1000191 3300002705 Bacteria 44047
4 JGI25154J39366_1000195 3300002738 Bacteria 44047
5 JGI25157J39369_1000227 3300002741 Bacteria 44047
6 JGI25150J39212_1009217 3300002774 Bacteria 1893
7 JGI25159J45721_1000359 3300002987 Bacteria 21140
8 JGI25159J45721_1002098 3300002987 Bacteria 7823
9 JGI25151J46595_10002668 3300003187 Bacteria 10460
10 JGI25151J46595_10004904 3300003187 Bacteria 6989
11 JGI25151J46595_10010133 3300003187 Bacteria 4403
12 JGI25153J46596_10073421 3300003215 Bacteria 877
13 rootH2_10048751 3300003320 Bacteria 2678
14 rootL2_10004239 3300003322 Bacteria 31814
15 rootL2_10066457 3300003322 Bacteria 5006
16 rootH1_10060373 3300003323 Bacteria 4068
17 JGI25160J50197_1000158 3300003354 Bacteria 58363
18 JGI25161J50226_1000040 3300003374 Bacteria 124804
19 Ga0055527_1002588 3300003760 Bacteria 2984
20 Ga0055535_1002380 3300003761 Bacteria 6716
21 Ga0055542_1000764 3300003762 Bacteria 24368
22 Ga0055529_1000613 3300003763 Bacteria 26951
23 Ga0055526_1001296 3300003771 Bacteria 17937
24 Ga0055526_1008981 3300003771 Bacteria 4888
25 Ga0055537_1000257 3300003773 Bacteria 38816
26 Ga0055524_1000077 3300003775 Bacteria 121584
27 Ga0055536_1001365 3300003781 Bacteria 14843
28 Ga0055536_1054421 3300003781 Bacteria 861
29 Ga0055534_1002936 3300003784 Bacteria 5650
30 Ga0055534_1019862 3300003784 Bacteria 1145
31 Ga0055528_1002253 3300003790 Bacteria 10499
32 Ga0055530_10000002 3300003791 Bacteria 300466
33 Ga0055530_10000354 3300003791 Bacteria 41444
34 Ga0055540_1000009 3300003792 Bacteria 300466
35 Ga0055540_1000010 3300003792 Bacteria 290865
36 Ga0055531_10000025 3300003794 Bacteria 161475
37 Ga0055531_10000298 3300003794 Bacteria 49437
38 Ga0055531_10000405 3300003794 Bacteria 41493
39 Ga0058692_1000035 3300003856 Bacteria 152983
40 Ga0055543_1000167 3300004625 Bacteria 54995
41 Ga0055543_1003847 3300004625 Bacteria 4257
42 Ga0065165_1000092 3300005262 Bacteria 148435
43 Ga0065165_1003807 3300005262 Bacteria 10071
44 Ga0065165_1014393 3300005262 Bacteria 3074
45 Ga0065165_1050698 3300005262 Bacteria 1181
46 Ga0065714_10137346 3300005288 Bacteria 1197
47 Ga0065704_10071461 3300005289 Bacteria 11051
48 Ga0065704_10086867 3300005289 Bacteria 3077
49 Ga0070680_100525439 3300005336 Unclassified 1013
50 Ga0070682_100186464 3300005337 Bacteria 1453
51 Ga0070687_100346208 3300005343 Bacteria 958
52 Ga0070661_100231079 3300005344 Bacteria 1421
53 Ga0070668_100470341 3300005347 Bacteria 1084
54 Ga0070671_100010623 3300005355 Bacteria 7389
55 Ga0070688_100631784 3300005365 Bacteria 823
56 Ga0070659_100003231 3300005366 Bacteria 11600
57 Ga0070713_100047670 3300005436 Bacteria 3523
58 Ga0070705_100031114 3300005440 Bacteria 2952
59 Ga0070700_100196556 3300005441 Bacteria 1414
60 Ga0070708_100418881 3300005445 Bacteria 1263
61 Ga0070708_100433567 3300005445 Bacteria 1240
62 Ga0070708_101666388 3300005445 Bacteria 593
63 Ga0070678_100063839 3300005456 Bacteria 2727
64 Ga0068867_100719087 3300005459 Bacteria 883
65 Ga0070706_100006365 3300005467 Bacteria 11149
66 Ga0070706_100037792 3300005467 Bacteria 4458
67 Ga0070698_100473587 3300005471 Bacteria 1189
68 Ga0070699_100504550 3300005518 Bacteria 1099
69 Ga0070699_100650569 3300005518 Bacteria 962
70 Ga0070684_100419494 3300005535 Unclassified 1235
71 Ga0070697_100059876 3300005536 Bacteria 3102
72 Ga0070697_100087291 3300005536 Bacteria 2575
73 Ga0068853_100017678 3300005539 Bacteria 5885
74 Ga0068853_100050690 3300005539 Bacteria 3572
75 Ga0068853_100123397 3300005539 Bacteria 2313
76 Ga0070696_100020348 3300005546 Bacteria 4498
77 Ga0070665_100000220 3300005548 Bacteria 95539
78 Ga0070665_100381402 3300005548 Bacteria 1417
79 Ga0070665_100763750 3300005548 Bacteria 980
80 Ga0070704_100024496 3300005549 Bacteria 3960
81 Ga0070704_100126249 3300005549 Bacteria 1975
82 Ga0068855_100909632 3300005563 Bacteria 929
83 Ga0070664_100009716 3300005564 Bacteria 7800
84 Ga0068857_100140232 3300005577 Bacteria 2185
85 Ga0068857_100827725 3300005577 Bacteria 885
86 Ga0068856_100092179 3300005614 Bacteria 3014
87 Ga0068856_100235929 3300005614 Bacteria 1844
88 Ga0068856_100249829 3300005614 Bacteria 1789
89 Ga0068852_100184793 3300005616 Bacteria 1962
90 Ga0068852_100716874 3300005616 Bacteria 1011
91 Ga0068864_100194010 3300005618 Bacteria 1863
92 Ga0068860_100304651 3300005843 Bacteria 1562
93 Ga0070717_10146448 3300006028 Unclassified 2040
94 Ga0075365_10336033 3300006038 Bacteria 1064
95 Ga0075363_100197719 3300006048 Bacteria 1148
96 Ga0075364_10010401 3300006051 Bacteria 5620
97 Ga0075364_10010436 3300006051 Bacteria 5611
98 Ga0075364_10014925 3300006051 Bacteria 4809
99 Ga0075432_10165268 3300006058 Bacteria 858
100 Ga0070712_100091671 3300006175 Bacteria 2227
101 Ga0075362_10005736 3300006177 Bacteria 4569
102 Ga0075362_10100888 3300006177 Bacteria 1349
103 Ga0075362_10152634 3300006177 Bacteria 1109
104 Ga0075362_10196546 3300006177 Bacteria 981
105 Ga0075366_10003591 3300006195 Bacteria 8214
106 Ga0075366_10135149 3300006195 Bacteria 1489
107 Ga0075366_10234041 3300006195 Bacteria 1120
108 Ga0075370_10187033 3300006353 Bacteria 1220
109 Ga0075370_10215077 3300006353 Bacteria 1135
110 Ga0075370_10292275 3300006353 Bacteria 968
111 Ga0075430_100067726 3300006846 Bacteria 2996
112 Ga0075431_100012997 3300006847 Bacteria 8406
113 Ga0075429_100002759 3300006880 Bacteria 14847
114 Ga0075429_100009488 3300006880 Bacteria 8443
115 Ga0075436_100051907 3300006914 Bacteria 2829
116 Ga0075436_100105190 3300006914 Bacteria 1968
117 Ga0075435_100213189 3300007076 Bacteria 1639
118 Ga0105240_10001373 3300009093 Bacteria 41833
119 Ga0105240_10015568 3300009093 Bacteria 10336
120 Ga0105240_10036629 3300009093 Bacteria 6308
121 Ga0105240_11277077 3300009093 Bacteria 775
122 Ga0111539_10046333 3300009094 Bacteria 5200
123 Ga0114129_10000710 3300009147 Bacteria 42045
124 Ga0114129_10032951 3300009147 Bacteria 7322
125 Ga0114129_10582175 3300009147 Bacteria 1452
126 Ga0105241_10173731 3300009174 Bacteria 1781
127 Ga0105241_10630075 3300009174 Bacteria 972
128 Ga0105241_10643121 3300009174 Unclassified 962
129 Ga0105248_10032211 3300009177 Bacteria 5860
130 Ga0105237_10002287 3300009545 Bacteria 23805
131 Ga0105237_10008414 3300009545 Bacteria 11176
132 Ga0105237_10020678 3300009545 Bacteria 6778
133 Ga0105238_10001855 3300009551 Bacteria 21183
134 Ga0105238_10003995 3300009551 Bacteria 14639
135 Ga0105238_10037159 3300009551 Bacteria 4952
136 Ga0105238_10328168 3300009551 Bacteria 1517
137 Ga0105249_10031041 3300009553 Bacteria 4831
138 Ga0105239_10000531 3300010375 Bacteria 55121
139 Ga0105239_10091015 3300010375 Bacteria 3366
140 Ga0105239_10145777 3300010375 Bacteria 2640
141 Ga0105239_10519635 3300010375 Bacteria 1354
142 Ga0157371_10000196 3300013102 Bacteria 89174
143 Ga0157371_10209702 3300013102 Bacteria 1398
144 Ga0157370_10005671 3300013104 Bacteria 13955
145 Ga0157369_11243799 3300013105 Unclassified 759
146 Ga0157374_10229076 3300013296 Bacteria 1825
147 Ga0157378_11308471 3300013297 Bacteria 766
148 Ga0163162_10196808 3300013306 Bacteria 2144
149 Ga0157372_10217860 3300013307 Bacteria 2213
150 Ga0182008_10027139 3300014497 Bacteria 2903
151 Ga0182008_10041550 3300014497 Bacteria 2294
152 Ga0182008_10258529 3300014497 Bacteria 900
153 Ga0157379_10072587 3300014968 Bacteria 3079
154 Ga0182007_10000206 3300015262 Bacteria 39567
155 Ga0182007_10006301 3300015262 Bacteria 5103
156 Ga0182007_10042937 3300015262 Bacteria 1504
157 Ga0182005_1000902 3300015265 Bacteria 12991
158 Ga0163161_10563341 3300017792 Bacteria 935
159 Ga0213872_10027450 3300021361 Bacteria 2613
160 Ga0209435_100010 3300025206 Bacteria 475373
161 Ga0209436_100621 3300025208 Bacteria 15167
162 Ga0209672_100058 3300025228 Bacteria 211992
163 Ga0209258_100164 3300025242 Bacteria 148838
164 Ga0207425_1004808 3300025245 Bacteria 3972
165 Ga0207425_1006370 3300025245 Bacteria 3235
166 Ga0209646_1000001 3300025246 Bacteria 3092932
167 Ga0209646_1000546 3300025246 Bacteria 16100
168 Ga0209026_1000001 3300025250 Bacteria 1228671
169 Ga0209026_1002727 3300025250 Bacteria 6341
170 Ga0209148_1000039 3300025254 Bacteria 482479
171 Ga0209759_1000001 3300025256 Bacteria 2799452
172 Ga0209759_1007103 3300025256 Bacteria 3655
173 Ga0209129_1006543 3300025258 Bacteria 3727
174 Ga0209129_1008240 3300025258 Bacteria 2932
175 Ga0209233_1005033 3300025261 Bacteria 4431
176 Ga0209565_1000036 3300025263 Bacteria 293334
177 Ga0209565_1000655 3300025263 Bacteria 22236
178 Ga0209455_1000034 3300025272 Bacteria 483129
179 Ga0209673_1000008 3300025273 Bacteria 626013
180 Ga0209130_1000042 3300025284 Bacteria 257581
181 Ga0209130_1002895 3300025284 Bacteria 7907
182 Ga0209675_1000106 3300025291 Bacteria 120459
183 Ga0209675_1000969 3300025291 Bacteria 18144
184 Ga0209675_1028633 3300025291 Bacteria 1352
185 Ga0209676_1000007 3300025292 Bacteria 1029371
186 Ga0209676_1000218 3300025292 Bacteria 125460
187 Ga0209676_1001896 3300025292 Bacteria 17054
188 Ga0209025_1001557 3300025294 Bacteria 29150
189 Ga0209025_1002157 3300025294 Bacteria 21934
190 Ga0209025_1002304 3300025294 Bacteria 20701
191 Ga0209025_1003224 3300025294 Bacteria 15791
192 Ga0209025_1010607 3300025294 Bacteria 6217
193 Ga0209564_1000005 3300025295 Bacteria 1147192
194 Ga0209564_1000487 3300025295 Bacteria 65983
195 Ga0209564_1001215 3300025295 Bacteria 29254
196 Ga0209758_1005683 3300025297 Bacteria 9428
197 Ga0209050_1000003 3300025298 Bacteria 1609245
198 Ga0209050_1000009 3300025298 Bacteria 1047265
199 Ga0209050_1001188 3300025298 Bacteria 30604
200 Ga0209050_1004842 3300025298 Bacteria 8836
201 Ga0209256_1000001 3300025299 Bacteria 2166974
202 Ga0207426_1000097 3300025302 Bacteria 265930
203 Ga0207426_1000988 3300025302 Bacteria 27876
204 Ga0209051_1000003 3300025303 Bacteria 1609245
205 Ga0209051_1000008 3300025303 Bacteria 706935
206 Ga0209051_1018720 3300025303 Bacteria 3053
207 Ga0209257_1000020 3300025304 Bacteria 773356
208 Ga0209257_1000032 3300025304 Bacteria 680354
209 Ga0209257_1007445 3300025304 Bacteria 6603
210 Ga0209257_1013149 3300025304 Bacteria 3719
211 Ga0207684_10126229 3300025910 Bacteria 2196
212 Ga0207654_10533192 3300025911 Bacteria 832
213 Ga0207695_10001246 3300025913 Bacteria 43517
214 Ga0207695_10007941 3300025913 Bacteria 13392
215 Ga0207695_10061370 3300025913 Bacteria 3885
216 Ga0207695_10104516 3300025913 Bacteria 2821
217 Ga0207671_10002068 3300025914 Bacteria 21960
218 Ga0207671_10005943 3300025914 Bacteria 11059
219 Ga0207671_10213922 3300025914 Bacteria 1509
220 Ga0207693_10178949 3300025915 Bacteria 1669
221 Ga0207660_10170042 3300025917 Bacteria 1686
222 Ga0207662_10042444 3300025918 Bacteria 2681
223 Ga0207657_10225112 3300025919 Bacteria 1501
224 Ga0207649_10113966 3300025920 Bacteria 1811
225 Ga0207646_10195404 3300025922 Bacteria 1827
226 Ga0207694_10000364 3300025924 Bacteria 42625
227 Ga0207694_10059546 3300025924 Bacteria 2970
228 Ga0207694_10228863 3300025924 Bacteria 1518
229 Ga0207659_10401329 3300025926 Bacteria 1147
230 Ga0207700_10049085 3300025928 Bacteria 3138
231 Ga0207700_10113943 3300025928 Unclassified 2181
232 Ga0207664_10117273 3300025929 Bacteria 2223
233 Ga0207664_10293252 3300025929 Bacteria 1430
234 Ga0207664_10328600 3300025929 Bacteria 1350
235 Ga0207690_10174731 3300025932 Bacteria 1612
236 Ga0207711_10043485 3300025941 Bacteria 3832
237 Ga0207661_10217084 3300025944 Bacteria 1689
238 Ga0207679_10000536 3300025945 Bacteria 25661
239 Ga0207667_10009150 3300025949 Bacteria 11698
240 Ga0207712_10295166 3300025961 Bacteria 1328
241 Ga0207658_10152568 3300025986 Bacteria 1884
242 Ga0207639_10065365 3300026041 Archaea 2823
243 Ga0207639_10144795 3300026041 Bacteria 1984
244 Ga0207639_10317765 3300026041 Bacteria 1382
245 Ga0207708_10161572 3300026075 Bacteria 1769
246 Ga0207702_10130273 3300026078 Bacteria 2263
247 Ga0207702_10201034 3300026078 Bacteria 1847
248 Ga0207702_10236367 3300026078 Bacteria 1710
249 Ga0207676_10253885 3300026095 Bacteria 1584
250 Ga0207674_10104320 3300026116 Bacteria 2813
251 Ga0207675_101269156 3300026118 Bacteria 757
252 Ga0207683_10102351 3300026121 Bacteria 2557
253 Ga0207698_10041658 3300026142 Bacteria 3424
254 Ga0207698_10285468 3300026142 Bacteria 1529
255 Ga0209371_1000043 3300027312 Bacteria 331009
256 Ga0209588_1034041 3300027671 Bacteria 1635
257 Ga0209966_1018760 3300027695 Bacteria 1327
258 Ga0265354_1000564 3300028016 Bacteria 6346
259 Ga0265355_1000063 3300028036 Unclassified 3625
260 Ga0268266_10000008 3300028379 Bacteria 1161875
261 Ga0268266_10472626 3300028379 Bacteria 1194
262 Ga0268266_11248391 3300028379 Bacteria 718
263 Ga0268264_10329950 3300028381 Bacteria 1445
264 Ga0307515_10038311 3300028794 Bacteria 7673
265 Ga0265338_10000385 3300028800 Bacteria 79013
266 Ga0268256_1000044 3300030500 Bacteria 330997
267 Ga0316177_1033583 3300030731 Bacteria 3161
268 Ga0316177_1141893 3300030731 Bacteria 1857
269 Ga0316178_1074596 3300030735 Bacteria 766
270 Ga0316180_1036468 3300030736 Bacteria 6141
271 Ga0316182_1010807 3300030745 Bacteria 1877
272 Ga0316182_1085890 3300030745 Bacteria 2063
273 Ga0265770_1001012 3300030878 Bacteria 3891
274 Ga0265760_10002417 3300031090 Bacteria 5454
275 Ga0265330_10000054 3300031235 Bacteria 101420
276 Ga0265332_10000002 3300031238 Bacteria 709510
277 Ga0265325_10003978 3300031241 Bacteria 9458
278 Ga0265340_10061033 3300031247 Bacteria 1804
279 Ga0307513_10000011 3300031456 Bacteria 354929
280 Ga0307513_10288756 3300031456 Bacteria 1413
281 Ga0307509_10090324 3300031507 Bacteria 3139
282 Ga0307408_100000026 3300031548 Bacteria 261688
283 Ga0307408_100022055 3300031548 Bacteria 4320
284 Ga0307408_100212023 3300031548 Bacteria 1575
285 Ga0307514_10180157 3300031649 Unclassified 1364
286 Ga0265314_10000012 3300031711 Bacteria 415184
287 Ga0265314_10035136 3300031711 Bacteria 3655
288 Ga0307516_10003842 3300031730 Bacteria 19022
289 Ga0307516_10186447 3300031730 Bacteria 1804
290 Ga0307405_10746807 3300031731 Bacteria 815
291 Ga0307406_10168531 3300031901 Bacteria 1582
292 Ga0307412_10145042 3300031911 Bacteria 1744
293 Ga0307412_10162518 3300031911 Bacteria 1661
294 Ga0307414_10036047 3300032004 Bacteria 3298
295 Ga0307414_10599955 3300032004 Bacteria 987
296 Ga0307411_10000108 3300032005 Bacteria 25840
297 Ga0307411_10572782 3300032005 Bacteria 967
298 Ga0307411_10622500 3300032005 Bacteria 931
299 Ga0307510_10008871 3300033180 Bacteria 11985
300 Ga0373948_0001942 3300034817 Bacteria 2974
301 Ga0373950_0029139 3300034818 Bacteria 1014
302 Ga0373958_0046282 3300034819 Bacteria 906
303 Ga0373940_0010829 3300035088 Bacteria 2153
304 Ga0373939_0000016 3300035114 Bacteria 62934
305 Ga0373960_0003894 3300035121 Bacteria 3402
306 Ga0373962_0136899 3300035242 Bacteria 792
307 Ga0373931_0001055 3300035691 Bacteria 11663
308 Ga0373937_0034845 3300036401 Bacteria 4579
309 Ga0395899_0002129 3300037312 Bacteria 16272
310 Ga0395899_0008558 3300037312 Bacteria 7883
311 Ga0395900_0017749 3300037418 Bacteria 7262
312 Ga0395900_0522318 3300037418 Bacteria 1135
313 Ga0395898_0010948 3300037466 Bacteria 9459
314 Ga0395898_0694401 3300037466 Bacteria 959
315 Ga0395905_0000065 3300037471 Bacteria 184928
316 Ga0395905_0002010 3300037471 Bacteria 23225
317 Ga0395905_0028955 3300037471 Bacteria 5220
318 Ga0395905_0043683 3300037471 Bacteria 4204
319 Ga0395905_0200826 3300037471 Bacteria 1869
320 Ga0395905_0539066 3300037471 Bacteria 1068
321 Ga0395905_0972794 3300037471 Bacteria 752
322 Ga0395901_0082281 3300038443 Bacteria 3363
323 Ga0439438_000801 3300041405 Bacteria 14038
324 Ga0439447_015940 3300041407 Bacteria 2073
325 Ga0439461_0134169 3300041410 Bacteria 628
326 Ga0439466_0023365 3300041411 Bacteria 2175
327 Ga0439466_0049321 3300041411 Bacteria 1382
328 Ga0451800_0114535 3300041459 Bacteria 801
329 Ga0451833_1010680 3300041491 Bacteria 1352
330 Ga0451853_2180615 3300041512 Bacteria 882
331 Ga0439431_0000116 3300041997 Bacteria 13851
332 Ga0439445_0009703 3300042004 Bacteria 2270
333 Ga0439432_000593 3300042006 Bacteria 13693
334 Ga0439451_003517 3300042009 Bacteria 3177
335 Ga0439452_005477 3300042010 Bacteria 4083
336 Ga0439456_005833 3300042013 Bacteria 2505
337 Ga0439462_0025326 3300042015 Bacteria 1562
338 Ga0450913_020599 3300042117 Unclassified 603
339 Ga0450888_004027 3300042126 Bacteria 1517
340 Ga0450891_000450 3300042129 Bacteria 4296
341 Ga0450892_000670 3300042130 Bacteria 3866
342 Ga0450900_006551 3300042136 Bacteria 1412
343 Ga0450903_003819 3300042138 Bacteria 2595
344 Ga0450910_000555 3300042147 Bacteria 4423
345 Ga0439446_0249746 3300042156 Bacteria 611
346 Ga0450909_030403 3300042185 Bacteria 819
347 Ga0439460_0000011 3300042461 Bacteria 26157
348 Ga0450893_0000459 3300042532 Bacteria 5762
349 Ga0450893_0011907 3300042532 Bacteria 1441
350 Ga0451577_0000237 3300042876 Bacteria 109473
351 Ga0451577_0009724 3300042876 Bacteria 9220
352 Ga0451577_0018286 3300042876 Bacteria 6458
353 Ga0451577_0054498 3300042876 Bacteria 3569
354 Ga0451577_0247138 3300042876 Bacteria 1615
355 Ga0466969_0123529 3300044656 Bacteria 1204
356 Ga0466977_0012463 3300044666 Bacteria 4958
357 Ga0453683_0450237 3300044673 Bacteria 833
358 Ga0466963_0282331 3300044694 Bacteria 1167
359 Ga0466964_0185200 3300044706 Bacteria 990
360 Ga0453684_0000121 3300044712 Bacteria 341067
361 Ga0453684_0009706 3300044712 Bacteria 16749
362 Ga0453684_0207074 3300044712 Bacteria 2282
363 Ga0453684_0312059 3300044712 Bacteria 1784
364 Ga0453684_0466110 3300044712 Bacteria 1404
365 Ga0453684_1009225 3300044712 Bacteria 884
366 Ga0451576_0086764 3300045051 Bacteria 3255
367 Ga0451576_0123934 3300045051 Bacteria 2692
368 Ga0451576_0152773 3300045051 Bacteria 2408
369 Ga0451576_0405508 3300045051 Bacteria 1429
370 Ga0451576_0951181 3300045051 Bacteria 901
371 Ga0495638_0037248 3300046460 Bacteria 3095
372 Ga0495638_0122734 3300046460 Bacteria 1533
373 Ga0495650_0000529 3300046471 Bacteria 55633
374 Ga0495650_0005914 3300046471 Bacteria 7773
375 Ga0495639_0357520 3300046475 Bacteria 734
376 Ga0495607_0003291 3300046501 Bacteria 12411
377 Ga0495583_0000515 3300046506 Bacteria 55250
378 Ga0495583_0001488 3300046506 Bacteria 23397
379 Ga0495583_0003211 3300046506 Bacteria 12794
380 Ga0495606_0000882 3300046507 Bacteria 44865
381 Ga0495606_0001038 3300046507 Bacteria 40221
382 Ga0495606_0008297 3300046507 Bacteria 9058
383 Ga0495610_0004958 3300046512 Bacteria 9641
384 Ga0495610_0119397 3300046512 Bacteria 1157
385 Ga0495616_0000042 3300046513 Bacteria 120923
386 Ga0495643_0000282 3300046522 Bacteria 72496
387 Ga0495643_0001604 3300046522 Bacteria 20016
388 Ga0495648_0036284 3300046524 Bacteria 3183
389 Ga0495648_0095502 3300046524 Bacteria 1654
390 Ga0495648_0119520 3300046524 Bacteria 1419
391 Ga0495642_0021710 3300046528 Bacteria 2526
392 Ga0495654_0042499 3300046530 Bacteria 2256
393 Ga0495586_0036604 3300046535 Bacteria 2635
394 Ga0495609_0079707 3300046538 Bacteria 1432
395 Ga0495597_0016916 3300046542 Bacteria 3439
396 Ga0495622_0000068 3300046557 Bacteria 90633
397 Ga0495668_0006479 3300046616 Bacteria 7661
398 Ga0495625_0032716 3300046660 Bacteria 3853
399 Ga0495625_0284708 3300046660 Bacteria 1062
400 Ga0495661_0004974 3300046665 Bacteria 9492
401 Ga0495588_0215749 3300046674 Bacteria 1013
402 Ga0495671_0111008 3300046692 Bacteria 1339
403 Ga0495649_0303712 3300046694 Bacteria 812
404 Ga0495672_0000187 3300047320 Bacteria 89789
405 Ga0495672_0120159 3300047320 Bacteria 1398
406 Ga0495687_017610 3300047443 Bacteria 3557
407 Ga0495677_0074979 3300047445 Bacteria 1263
408 Ga0495685_132101 3300047447 Bacteria 816
409 Ga0495673_0000097 3300047469 Bacteria 182247
410 Ga0495681_0006255 3300047470 Bacteria 7847
411 Ga0495686_0004901 3300047472 Bacteria 10786
412 Ga0496102_0006907 3300048905 Bacteria 9682
413 Ga0496103_0238875 3300048906 Bacteria 1169
414 Ga0496103_0355564 3300048906 Bacteria 942
415 Ga0496104_0022451 3300048907 Bacteria 5798
416 Ga0496104_0051477 3300048907 Bacteria 3887
417 Ga0496105_0187725 3300048908 Bacteria 1691
418 Ga0496108_0012798 3300048911 Bacteria 6832
419 Ga0496108_0410748 3300048911 Bacteria 1182
420 Ga0496109_0064236 3300048912 Bacteria 3359
421 Ga0496113_0204380 3300048916 Bacteria 1570
422 Ga0496114_0262711 3300048917 Bacteria 1520
423 Ga0496117_0048759 3300048920 Bacteria 3020
424 Ga0496118_0013564 3300048921 Bacteria 7693
425 Ga0496122_0008879 3300048925 Bacteria 10717
426 Ga0496122_0019993 3300048925 Bacteria 6085
427 Ga0496123_0004705 3300048926 Bacteria 14129
428 Ga0496123_0019136 3300048926 Bacteria 5406
429 Ga0496124_0000460 3300048927 Bacteria 70590
430 Ga0496125_0002473 3300048928 Bacteria 23971
431 Ga0496125_0104493 3300048928 Bacteria 2074
432 Ga0496125_0476082 3300048928 Bacteria 709
433 Ga0496126_0207037 3300048929 Bacteria 1653
434 Ga0496126_0316670 3300048929 Bacteria 1283
435 Ga0501308_005902 3300049128 Bacteria 1238
436 Ga0501309_001573 3300049129 Bacteria 2283
437 Ga0501310_003499 3300049130 Bacteria 1535
438 Ga0501305_009866 3300049161 Bacteria 1264
439 Ga0495678_003246 3300049459 Bacteria 10180
440 Ga0501300_004699 3300049523 Bacteria 2020
441 Ga0501311_009812 3300049527 Bacteria 1150
442 Ga0501314_003402 3300049530 Bacteria 1283
443 Ga0501317_006843 3300049533 Bacteria 1269
444 Ga0501036_1048948 3300049572 Bacteria 666
445 Ga0501038_0989953 3300049574 Bacteria 618
446 Ga0501046_0648954 3300049580 Bacteria 746
447 Ga0501068_0298315 3300049584 Bacteria 1031
448 Ga0501070_0132074 3300049586 Bacteria 2062
449 Ga0501073_0010100 3300049589 Bacteria 6941
450 Ga0501073_0336370 3300049589 Bacteria 1042
451 Ga0501074_0002083 3300049590 Bacteria 13823
452 Ga0501199_004106 3300049650 Bacteria 1425
453 Ga0501211_006952 3300049658 Bacteria 1116
454 Ga0501222_004414 3300049662 Bacteria 1910
455 Ga0501222_011108 3300049662 Bacteria 1188
456 Ga0501233_012455 3300049668 Bacteria 1708
457 Ga0501236_020809 3300049670 Bacteria 968
458 Ga0501249_064376 3300049679 Bacteria 852
459 Ga0501229_001224 3300049706 Bacteria 2983
460 Ga0501080_0379097 3300049742 Bacteria 1274
461 Ga0501080_0472692 3300049742 Bacteria 1122
462 Ga0501083_0006184 3300049744 Bacteria 8493
463 Ga0501262_006587 3300049759 Bacteria 1392
464 Ga0501267_000612 3300049764 Bacteria 2831
465 Ga0501035_0916542 3300049822 Bacteria 693
466 Ga0501044_0488707 3300049823 Bacteria 1133
467 nmdc:mga03683_35794_c1 3300050489 Bacteria 2016
468 nmdc:mga03683_7214_c1 3300050489 Bacteria 3849
469 nmdc:mga03n38_122219_c1 3300050490 Bacteria 1281
470 nmdc:mga00v17_105258_c1 3300050491 Bacteria 1785
471 nmdc:mga00v17_120937_c1 3300050491 Unclassified 1667
472 nmdc:mga00v17_471512_c1 3300050491 Bacteria 814
473 nmdc:mga00v17_96307_c1 3300050491 Bacteria 1864
474 nmdc:mga0yw44_356578_c1 3300050492 Bacteria 985
475 nmdc:mga0k408_100132_c1 3300050493 Bacteria 1708
476 nmdc:mga0k408_128929_c1 3300050493 Bacteria 1501
477 nmdc:mga0k408_145204_c1 3300050493 Bacteria 1412
478 nmdc:mga0k408_27046_c1 3300050493 Bacteria 2541
479 nmdc:mga0k408_3041_c1 3300050493 Bacteria 8902
480 nmdc:mga0k408_54352_c1 3300050493 Bacteria 1893
481 nmdc:mga0k408_589753_c1 3300050493 Bacteria 656
482 nmdc:mga0k408_89828_c1 3300050493 Bacteria 1804
483 nmdc:mga07m45_128013_c2 3300050496 Bacteria 1273
484 nmdc:mga07m45_21644_c1 3300050496 Bacteria 3503
485 nmdc:mga07m45_228688_c1 3300050496 Bacteria 1082
486 nmdc:mga07m45_248541_c1 3300050496 Bacteria 1035
487 nmdc:mga07m45_410508_c1 3300050496 Bacteria 786
488 nmdc:mga07m45_472531_c1 3300050496 Bacteria 727
489 nmdc:mga05p37_2235_c1 3300050507 Bacteria 22561
490 nmdc:mga09592_142_c1 3300050508 Bacteria 24140
491 nmdc:mga09592_3290_c1 3300050508 Bacteria 13083
492 nmdc:mga0qj67_19416_c1 3300050509 Bacteria 5192
493 nmdc:mga0qj67_830739_c1 3300050509 Bacteria 730
494 nmdc:mga06r32_7017_c1 3300050510 Bacteria 10130
495 nmdc:mga0rr50_777381_c1 3300050513 Bacteria 817
496 nmdc:mga08x19_21720_c1 3300050514 Bacteria 3966
497 nmdc:mga08x19_22162_c1 3300050514 Bacteria 3931
498 nmdc:mga08x19_234492_c1 3300050514 Unclassified 1264
499 nmdc:mga08x19_83653_c1 3300050514 Bacteria 2098
500 nmdc:mga0sz30_23318_c1 3300050516 Bacteria 2516
501 Ga0500644_0001498 3300053088 Bacteria 6141
502 Ga0500644_0092984 3300053088 Bacteria 1132
503 Ga0500646_0065077 3300053090 Bacteria 1082
504 Ga0500651_0000354 3300053093 Bacteria 25764
505 Ga0500651_0023247 3300053093 Bacteria 3881
506 Ga0500566_0038443 3300053094 Bacteria 2769
507 Ga0500566_0167918 3300053094 Bacteria 1137
508 Ga0500562_005267 3300053108 Bacteria 3251
509 Ga0500593_000484 3300053117 Bacteria 15697
510 Ga0500628_003648 3300053129 Bacteria 2544
511 Ga0500604_0094314 3300053151 Bacteria 981
512 Ga0500616_0047751 3300053153 Bacteria 2272
513 Ga0500622_0001100 3300053156 Bacteria 22485
514 Ga0500627_0152449 3300053158 Bacteria 1044
515 Ga0500645_000114 3300053730 Bacteria 64351
516 Ga0500645_001331 3300053730 Bacteria 12791
517 Ga0500645_038135 3300053730 Bacteria 1426
518 Ga0500661_000830 3300055283 Bacteria 5760
519 2511243271 2511231002 Bacteria 5042903
520 2599501817 2599185188 Bacteria 6164180
521 2599614281 2599185212 Bacteria 6765997
522 2599768710 2599185248 Bacteria 6696816
523 2599884464 2599185289 Bacteria 6778765
524 2599896357 2599185291 Bacteria 6775623
525 2599958259 2599185305 Bacteria 6748700
526 2600003671 2599185313 Bacteria 6658188
527 2600015966 2599185315 Bacteria 6771107
528 2600036166 2599185318 Bacteria 6961590
529 2600051172 2599185321 Bacteria 6764560
530 2600059631 2599185322 Bacteria 6763055
531 2600069278 2599185324 Bacteria 6590677
532 2643745081 2643221544 Bacteria 5886209
533 2643935768 2643221585 Bacteria 5812563
534 2644260082 2643221646 Bacteria 6433402
535 2644317551 2643221656 Bacteria 5809961
536 2644646328 2643221717 Bacteria 5676132
537 2671089051 2667528170 Bacteria 6786960
538 2812366749 2811994881 Bacteria 6298475
539 2831869783 2831864461 Bacteria 6502356
540 2901312629 2901300506 Bacteria 8463898
541 2913039048 2913036834 Bacteria 6704877
542 2919483622 2919481497 Bacteria 6907839
543 2923520783 2923519811 Bacteria 6298479
544 2923586730 2923586266 Bacteria 6565975
545 2931369954 2931369376 Bacteria 6847892
546 2939631793 2939631187 Bacteria 6118131
547 2974323528 2974320154 Bacteria 4571377
548 8019781510 8019775933 Bacteria 6858656
549 Ga0451576_0060431
550 SwRhRL2b_contig_1996222
551 JGI25156J39149_1000191
552 JGI25154J39366_1000195
553 JGI25157J39369_1000227
554 JGI25150J39212_1009217
555 JGI25159J45721_1000359
556 JGI25159J45721_1002098
557 JGI25151J46595_10002668
558 JGI25151J46595_10004904
559 JGI25151J46595_10010133
560 JGI25153J46596_10073421
561 rootH2_10048751
562 rootL2_10004239
563 rootL2_10066457
564 rootH1_10060373
565 JGI25160J50197_1000158
566 JGI25161J50226_1000040
567 Ga0055527_1002588
568 Ga0055535_1002380
569 Ga0055542_1000764
570 Ga0055529_1000613
571 Ga0055526_1001296
572 Ga0055526_1008981
573 Ga0055537_1000257
574 Ga0055524_1000077
575 Ga0055536_1001365
576 Ga0055536_1054421
577 Ga0055534_1002936
578 Ga0055534_1019862
579 Ga0055528_1002253
580 Ga0055530_10000002
581 Ga0055530_10000354
582 Ga0055540_1000009
583 Ga0055540_1000010
584 Ga0055531_10000025
585 Ga0055531_10000298
586 Ga0055531_10000405
587 Ga0058692_1000035
588 Ga0055543_1000167
589 Ga0055543_1003847
590 Ga0065165_1000092
591 Ga0065165_1003807
592 Ga0065165_1014393
593 Ga0065165_1050698
594 Ga0065714_10137346
595 Ga0065704_10071461
596 Ga0065704_10086867
597 Ga0070680_100525439
598 Ga0070682_100186464
599 Ga0070687_100346208
600 Ga0070661_100231079
601 Ga0070668_100470341
602 Ga0070671_100010623
603 Ga0070688_100631784
604 Ga0070659_100003231
605 Ga0070713_100047670
606 Ga0070705_100031114
607 Ga0070700_100196556
608 Ga0070708_100418881
609 Ga0070708_100433567
610 Ga0070708_101666388
611 Ga0070678_100063839
612 Ga0068867_100719087
613 Ga0070706_100006365
614 Ga0070706_100037792
615 Ga0070698_100473587
616 Ga0070699_100504550
617 Ga0070699_100650569
618 Ga0070684_100419494
619 Ga0070697_100059876
620 Ga0070697_100087291
621 Ga0068853_100017678
622 Ga0068853_100050690
623 Ga0068853_100123397
624 Ga0070696_100020348
625 Ga0070665_100000220
626 Ga0070665_100381402
627 Ga0070665_100763750
628 Ga0070704_100024496
629 Ga0070704_100126249
630 Ga0068855_100909632
631 Ga0070664_100009716
632 Ga0068857_100140232
633 Ga0068857_100827725
634 Ga0068856_100092179
635 Ga0068856_100235929
636 Ga0068856_100249829
637 Ga0068852_100184793
638 Ga0068852_100716874
639 Ga0068864_100194010
640 Ga0068860_100304651
641 Ga0070717_10146448
642 Ga0075365_10336033
643 Ga0075363_100197719
644 Ga0075364_10010401
645 Ga0075364_10010436
646 Ga0075364_10014925
647 Ga0075432_10165268
648 Ga0070712_100091671
649 Ga0075362_10005736
650 Ga0075362_10100888
651 Ga0075362_10152634
652 Ga0075362_10196546
653 Ga0075366_10003591
654 Ga0075366_10135149
655 Ga0075366_10234041
656 Ga0075370_10187033
657 Ga0075370_10215077
658 Ga0075370_10292275
659 Ga0075430_100067726
660 Ga0075431_100012997
661 Ga0075429_100002759
662 Ga0075429_100009488
663 Ga0075436_100051907
664 Ga0075436_100105190
665 Ga0075435_100213189
666 Ga0105240_10001373
667 Ga0105240_10015568
668 Ga0105240_10036629
669 Ga0105240_11277077
670 Ga0111539_10046333
671 Ga0114129_10000710
672 Ga0114129_10032951
673 Ga0114129_10582175
674 Ga0105241_10173731
675 Ga0105241_10630075
676 Ga0105241_10643121
677 Ga0105248_10032211
678 Ga0105237_10002287
679 Ga0105237_10008414
680 Ga0105237_10020678
681 Ga0105238_10001855
682 Ga0105238_10003995
683 Ga0105238_10037159
684 Ga0105238_10328168
685 Ga0105249_10031041
686 Ga0105239_10000531
687 Ga0105239_10091015
688 Ga0105239_10145777
689 Ga0105239_10519635
690 Ga0157371_10000196
691 Ga0157371_10209702
692 Ga0157370_10005671
693 Ga0157369_11243799
694 Ga0157374_10229076
695 Ga0157378_11308471
696 Ga0163162_10196808
697 Ga0157372_10217860
698 Ga0182008_10027139
699 Ga0182008_10041550
700 Ga0182008_10258529
701 Ga0157379_10072587
702 Ga0182007_10000206
703 Ga0182007_10006301
704 Ga0182007_10042937
705 Ga0182005_1000902
706 Ga0163161_10563341
707 Ga0213872_10027450
708 Ga0209435_100010
709 Ga0209436_100621
710 Ga0209672_100058
711 Ga0209258_100164
712 Ga0207425_1004808
713 Ga0207425_1006370
714 Ga0209646_1000001
715 Ga0209646_1000546
716 Ga0209026_1000001
717 Ga0209026_1002727
718 Ga0209148_1000039
719 Ga0209759_1000001
720 Ga0209759_1007103
721 Ga0209129_1006543
722 Ga0209129_1008240
723 Ga0209233_1005033
724 Ga0209565_1000036
725 Ga0209565_1000655
726 Ga0209455_1000034
727 Ga0209673_1000008
728 Ga0209130_1000042
729 Ga0209130_1002895
730 Ga0209675_1000106
731 Ga0209675_1000969
732 Ga0209675_1028633
733 Ga0209676_1000007
734 Ga0209676_1000218
735 Ga0209676_1001896
736 Ga0209025_1001557
737 Ga0209025_1002157
738 Ga0209025_1002304
739 Ga0209025_1003224
740 Ga0209025_1010607
741 Ga0209564_1000005
742 Ga0209564_1000487
743 Ga0209564_1001215
744 Ga0209758_1005683
745 Ga0209050_1000003
746 Ga0209050_1000009
747 Ga0209050_1001188
748 Ga0209050_1004842
749 Ga0209256_1000001
750 Ga0207426_1000097
751 Ga0207426_1000988
752 Ga0209051_1000003
753 Ga0209051_1000008
754 Ga0209051_1018720
755 Ga0209257_1000020
756 Ga0209257_1000032
757 Ga0209257_1007445
758 Ga0209257_1013149
759 Ga0207684_10126229
760 Ga0207654_10533192
761 Ga0207695_10001246
762 Ga0207695_10007941
763 Ga0207695_10061370
764 Ga0207695_10104516
765 Ga0207671_10002068
766 Ga0207671_10005943
767 Ga0207671_10213922
768 Ga0207693_10178949
769 Ga0207660_10170042
770 Ga0207662_10042444
771 Ga0207657_10225112
772 Ga0207649_10113966
773 Ga0207646_10195404
774 Ga0207694_10000364
775 Ga0207694_10059546
776 Ga0207694_10228863
777 Ga0207659_10401329
778 Ga0207700_10049085
779 Ga0207700_10113943
780 Ga0207664_10117273
781 Ga0207664_10293252
782 Ga0207664_10328600
783 Ga0207690_10174731
784 Ga0207711_10043485
785 Ga0207661_10217084
786 Ga0207679_10000536
787 Ga0207667_10009150
788 Ga0207712_10295166
789 Ga0207658_10152568
790 Ga0207639_10065365
791 Ga0207639_10144795
792 Ga0207639_10317765
793 Ga0207708_10161572
794 Ga0207702_10130273
795 Ga0207702_10201034
796 Ga0207702_10236367
797 Ga0207676_10253885
798 Ga0207674_10104320
799 Ga0207675_101269156
800 Ga0207683_10102351
801 Ga0207698_10041658
802 Ga0207698_10285468
803 Ga0209371_1000043
804 Ga0209588_1034041
805 Ga0209966_1018760
806 Ga0265354_1000564
807 Ga0265355_1000063
808 Ga0268266_10000008
809 Ga0268266_10472626
810 Ga0268266_11248391
811 Ga0268264_10329950
812 Ga0307515_10038311
813 Ga0265338_10000385
814 Ga0268256_1000044
815 Ga0316177_1033583
816 Ga0316177_1141893
817 Ga0316178_1074596
818 Ga0316180_1036468
819 Ga0316182_1010807
820 Ga0316182_1085890
821 Ga0265770_1001012
822 Ga0265760_10002417
823 Ga0265330_10000054
824 Ga0265332_10000002
825 Ga0265325_10003978
826 Ga0265340_10061033
827 Ga0307513_10000011
828 Ga0307513_10288756
829 Ga0307509_10090324
830 Ga0307408_100000026
831 Ga0307408_100022055
832 Ga0307408_100212023
833 Ga0307514_10180157
834 Ga0265314_10000012
835 Ga0265314_10035136
836 Ga0307516_10003842
837 Ga0307516_10186447
838 Ga0307405_10746807
839 Ga0307406_10168531
840 Ga0307412_10145042
841 Ga0307412_10162518
842 Ga0307414_10036047
843 Ga0307414_10599955
844 Ga0307411_10000108
845 Ga0307411_10572782
846 Ga0307411_10622500
847 Ga0307510_10008871
848 Ga0373948_0001942
849 Ga0373950_0029139
850 Ga0373958_0046282
851 Ga0373940_0010829
852 Ga0373939_0000016
853 Ga0373960_0003894
854 Ga0373962_0136899
855 Ga0373931_0001055
856 Ga0373937_0034845
857 Ga0395899_0002129
858 Ga0395899_0008558
859 Ga0395900_0017749
860 Ga0395900_0522318
861 Ga0395898_0010948
862 Ga0395898_0694401
863 Ga0395905_0000065
864 Ga0395905_0002010
865 Ga0395905_0028955
866 Ga0395905_0043683
867 Ga0395905_0200826
868 Ga0395905_0539066
869 Ga0395905_0972794
870 Ga0395901_0082281
871 Ga0439438_000801
872 Ga0439447_015940
873 Ga0439461_0134169
874 Ga0439466_0023365
875 Ga0439466_0049321
876 Ga0451800_0114535
877 Ga0451833_1010680
878 Ga0451853_2180615
879 Ga0439431_0000116
880 Ga0439445_0009703
881 Ga0439432_000593
882 Ga0439451_003517
883 Ga0439452_005477
884 Ga0439456_005833
885 Ga0439462_0025326
886 Ga0450913_020599
887 Ga0450888_004027
888 Ga0450891_000450
889 Ga0450892_000670
890 Ga0450900_006551
891 Ga0450903_003819
892 Ga0450910_000555
893 Ga0439446_0249746
894 Ga0450909_030403
895 Ga0439460_0000011
896 Ga0450893_0000459
897 Ga0450893_0011907
898 Ga0451577_0000237
899 Ga0451577_0009724
900 Ga0451577_0018286
901 Ga0451577_0054498
902 Ga0451577_0247138
903 Ga0466969_0123529
904 Ga0466977_0012463
905 Ga0453683_0450237
906 Ga0466963_0282331
907 Ga0466964_0185200
908 Ga0453684_0000121
909 Ga0453684_0009706
910 Ga0453684_0207074
911 Ga0453684_0312059
912 Ga0453684_0466110
913 Ga0453684_1009225
914 Ga0451576_0086764
915 Ga0451576_0123934
916 Ga0451576_0152773
917 Ga0451576_0405508
918 Ga0451576_0951181
919 Ga0495638_0037248
920 Ga0495638_0122734
921 Ga0495650_0000529
922 Ga0495650_0005914
923 Ga0495639_0357520
924 Ga0495607_0003291
925 Ga0495583_0000515
926 Ga0495583_0001488
927 Ga0495583_0003211
928 Ga0495606_0000882
929 Ga0495606_0001038
930 Ga0495606_0008297
931 Ga0495610_0004958
932 Ga0495610_0119397
933 Ga0495616_0000042
934 Ga0495643_0000282
935 Ga0495643_0001604
936 Ga0495648_0036284
937 Ga0495648_0095502
938 Ga0495648_0119520
939 Ga0495642_0021710
940 Ga0495654_0042499
941 Ga0495586_0036604
942 Ga0495609_0079707
943 Ga0495597_0016916
944 Ga0495622_0000068
945 Ga0495668_0006479
946 Ga0495625_0032716
947 Ga0495625_0284708
948 Ga0495661_0004974
949 Ga0495588_0215749
950 Ga0495671_0111008
951 Ga0495649_0303712
952 Ga0495672_0000187
953 Ga0495672_0120159
954 Ga0495687_017610
955 Ga0495677_0074979
956 Ga0495685_132101
957 Ga0495673_0000097
958 Ga0495681_0006255
959 Ga0495686_0004901
960 Ga0496102_0006907
961 Ga0496103_0238875
962 Ga0496103_0355564
963 Ga0496104_0022451
964 Ga0496104_0051477
965 Ga0496105_0187725
966 Ga0496108_0012798
967 Ga0496108_0410748
968 Ga0496109_0064236
969 Ga0496113_0204380
970 Ga0496114_0262711
971 Ga0496117_0048759
972 Ga0496118_0013564
973 Ga0496122_0008879
974 Ga0496122_0019993
975 Ga0496123_0004705
976 Ga0496123_0019136
977 Ga0496124_0000460
978 Ga0496125_0002473
979 Ga0496125_0104493
980 Ga0496125_0476082
981 Ga0496126_0207037
982 Ga0496126_0316670
983 Ga0501308_005902
984 Ga0501309_001573
985 Ga0501310_003499
986 Ga0501305_009866
987 Ga0495678_003246
988 Ga0501300_004699
989 Ga0501311_009812
990 Ga0501314_003402
991 Ga0501317_006843
992 Ga0501036_1048948
993 Ga0501038_0989953
994 Ga0501046_0648954
995 Ga0501068_0298315
996 Ga0501070_0132074
997 Ga0501073_0010100
998 Ga0501073_0336370
999 Ga0501074_0002083
1000 Ga0501199_004106
1001 Ga0501211_006952
1002 Ga0501222_004414
1003 Ga0501222_011108
1004 Ga0501233_012455
1005 Ga0501236_020809
1006 Ga0501249_064376
1007 Ga0501229_001224
1008 Ga0501080_0379097
1009 Ga0501080_0472692
1010 Ga0501083_0006184
1011 Ga0501262_006587
1012 Ga0501267_000612
1013 Ga0501035_0916542
1014 Ga0501044_0488707
1015 nmdc:mga03683_35794_c1
1016 nmdc:mga03683_7214_c1
1017 nmdc:mga03n38_122219_c1
1018 nmdc:mga00v17_105258_c1
1019 nmdc:mga00v17_120937_c1
1020 nmdc:mga00v17_471512_c1
1021 nmdc:mga00v17_96307_c1
1022 nmdc:mga0yw44_356578_c1
1023 nmdc:mga0k408_100132_c1
1024 nmdc:mga0k408_128929_c1
1025 nmdc:mga0k408_145204_c1
1026 nmdc:mga0k408_27046_c1
1027 nmdc:mga0k408_3041_c1
1028 nmdc:mga0k408_54352_c1
1029 nmdc:mga0k408_589753_c1
1030 nmdc:mga0k408_89828_c1
1031 nmdc:mga07m45_128013_c2
1032 nmdc:mga07m45_21644_c1
1033 nmdc:mga07m45_228688_c1
1034 nmdc:mga07m45_248541_c1
1035 nmdc:mga07m45_410508_c1
1036 nmdc:mga07m45_472531_c1
1037 nmdc:mga05p37_2235_c1
1038 nmdc:mga09592_142_c1
1039 nmdc:mga09592_3290_c1
1040 nmdc:mga0qj67_19416_c1
1041 nmdc:mga0qj67_830739_c1
1042 nmdc:mga06r32_7017_c1
1043 nmdc:mga0rr50_777381_c1
1044 nmdc:mga08x19_21720_c1
1045 nmdc:mga08x19_22162_c1
1046 nmdc:mga08x19_234492_c1
1047 nmdc:mga08x19_83653_c1
1048 nmdc:mga0sz30_23318_c1
1049 Ga0500644_0001498
1050 Ga0500644_0092984
1051 Ga0500646_0065077
1052 Ga0500651_0000354
1053 Ga0500651_0023247
1054 Ga0500566_0038443
1055 Ga0500566_0167918
1056 Ga0500562_005267
1057 Ga0500593_000484
1058 Ga0500628_003648
1059 Ga0500604_0094314
1060 Ga0500616_0047751
1061 Ga0500622_0001100
1062 Ga0500627_0152449
1063 Ga0500645_000114
1064 Ga0500645_001331
1065 Ga0500645_038135
1066 Ga0500661_000830
1067 2511243271
1068 2599501817
1069 2599614281
1070 2599768710
1071 2599884464
1072 2599896357
1073 2599958259
1074 2600003671
1075 2600015966
1076 2600036166
1077 2600051172
1078 2600059631
1079 2600069278
1080 2643745081
1081 2643935768
1082 2644260082
1083 2644317551
1084 2644646328
1085 2671089051
1086 2812366749
1087 2831869783
1088 2901312629
1089 2913039048
1090 2919483622
1091 2923520783
1092 2923586730
1093 2931369954
1094 2939631793
1095 2974323528
1096 8019781510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

120

199

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.9553 56 175
5hmb-assembly1.cif.gz_A crystal structure of s. sahachiroi azig 0.9545 56 177
3nwz-assembly3.cif.gz_D crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.9469 75 175
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.9424 56 173
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9416 56 173
ID Description Score Start End Superfamily
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9433 56 175 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9424 56 173 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9329 56 174 3.10.129.10
af_Q54GL4_70_197_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9317 59 178 3.10.129.10
3nwzD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9264 75 175 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1F4BJ79-F1-model_v4 Thioesterase domain-containing protein 0.996 64 175 GO:0005829
GO:0061522
AF-A0A6P1KDZ5-F1-model_v4 Hotdog fold thioesterase 0.9942 56 177 GO:0016289
AF-A0A1M3BPM1-F1-model_v4 Phenylacetic acid degradation protein 0.9942 63 176 GO:0047617
AF-A0A651GEF6-F1-model_v4 PaaI family thioesterase 0.9929 38 176 GO:0005829
GO:0061522
AF-A0A4U0S6S1-F1-model_v4 PaaI family thioesterase 0.9924 63 175 GO:0005829
GO:0061522

Map