F462279

General Info

Members Datasets Scaffolds Average Seq Length
548 334 1096 262

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0358676|Ga0496100_0358676_151_1053
Length 300
Sequence MCSETAGMGGVYEIGSPGDSARRVVELSQANLVPEAAMNGLEGRTAAVTGGSTLIGQAVVRELHRHGMAVAIADVDDPPGEALAEELGERVLYRHTDITRDDEVAAFVEEAVGRFGGLDGLVNLACTYLDEGFASPRADWLAALDVNVVSAVVVSQAAHPHLKASESGAIVNFASISANVAQTGRWLYPVSKAALVQLTRNMAMDLAADGIRVNAVSPGWTWSKVMVELTGDDRAKTDRVAAPFHLLGRVGDAEEVARVVAFLLSDDASFVTGATWAVDGGYSAMGPEGAVPAIPKLMEE

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
128 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
154 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
155 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
156 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
264 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
265 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
270 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
275 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
276 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
277 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
278 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
279 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
280 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
281 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
282 2643221609 Acidovorax sp. Root217 Isolate Unclassified
283 2643221611 Acidovorax sp. Root219 Isolate Unclassified
284 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
285 2643221658 Variovorax sp. Root411 Isolate Unclassified
286 2643221672 Variovorax sp. Root434 Isolate Unclassified
287 2643221683 Variovorax sp. Root473 Isolate Unclassified
288 2721755523 Delftia sp. HK171 Isolate Unclassified
289 2738541277 Variovorax sp. GV051 Isolate Unclassified
290 2738541307 Variovorax sp. GV008 Isolate Unclassified
291 2738543012 Acidovorax sp. CF301 Isolate Unclassified
292 2738543019 Variovorax sp. GV040 Isolate Unclassified
293 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
294 2816332133 Acidovorax radicis 2721A Isolate Unclassified
295 2818991446 Variovorax sp. 1180 Isolate Unclassified
296 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
297 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
298 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
299 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
300 2858950400 Achromobacter sp. K91 Isolate Unclassified
301 2885198086 Variovorax sp. 679 Isolate Unclassified
302 2885211737 Variovorax sp. 553 Isolate Unclassified
303 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
304 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
305 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
306 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
307 2899924645 Variovorax sp. 369 Isolate Unclassified
308 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
309 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
310 2904456579 Variovorax sp. 2002 Isolate Unclassified
311 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
312 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
313 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
314 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
315 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
316 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
317 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
318 2928037797 Variovorax sp. 1126 Isolate Unclassified
319 2928044640 Variovorax sp. 1128 Isolate Unclassified
320 2928051484 Variovorax sp. 1133 Isolate Unclassified
321 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
322 2928070936 Variovorax gossypii 1167 Isolate Unclassified
323 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
324 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
325 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
326 2929520902 Variovorax beijingensis 502 Isolate Unclassified
327 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
328 2941479691
329 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
330 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
331 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
332 639633007 Azoarcus olearius BH72 Isolate Unclassified
333 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
334 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.5
Metatranscriptomes 0.55
Isolates 10.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 23.91
Nodule 1.46
Rhizoplane 6.2
Rhizosphere 53.1
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0358676 3300048903 Bacteria 1103
2 JGI25152J39213_1001152 3300002773 Bacteria 12269
3 JGI25152J39213_1004850 3300002773 Bacteria 4111
4 JGI25150J39212_1000629 3300002774 Bacteria 13373
5 JGI25159J45721_1001540 3300002987 Bacteria 9445
6 JGI25159J45721_1002520 3300002987 Bacteria 6897
7 JGI25159J45721_1019277 3300002987 Bacteria 1347
8 JGI25151J46595_10001171 3300003187 Bacteria 18873
9 JGI25151J46595_10002144 3300003187 Bacteria 12269
10 JGI25151J46595_10012957 3300003187 Bacteria 3768
11 JGI25151J46595_10017190 3300003187 Bacteria 3143
12 JGI25153J46596_10001941 3300003215 Bacteria 12269
13 JGI25153J46596_10012061 3300003215 Bacteria 3768
14 rootH2_10096586 3300003320 Bacteria 4284
15 rootH1_10006638 3300003323 Bacteria 4640
16 JGI25160J50197_1002114 3300003354 Bacteria 9445
17 JGI25160J50197_1008892 3300003354 Bacteria 3778
18 JGI25161J50226_1000849 3300003374 Bacteria 11359
19 JGI25161J50226_1004835 3300003374 Bacteria 2750
20 Ga0006562J51391_1065136 3300003578 Bacteria 5125
21 Ga0006562J51391_1065137 3300003578 Bacteria 2850
22 Ga0055535_1000750 3300003761 Bacteria 24203
23 Ga0055542_1000583 3300003762 Bacteria 31637
24 Ga0055526_1001020 3300003771 Bacteria 20496
25 Ga0055526_1003328 3300003771 Bacteria 10278
26 Ga0055526_1006457 3300003771 Bacteria 6359
27 Ga0055537_1000575 3300003773 Bacteria 20496
28 Ga0055537_1019415 3300003773 Bacteria 1056
29 Ga0055524_1000825 3300003775 Bacteria 20496
30 Ga0055524_1005418 3300003775 Bacteria 5701
31 Ga0055536_1000296 3300003781 Bacteria 37428
32 Ga0055536_1000955 3300003781 Bacteria 18500
33 Ga0055536_1001692 3300003781 Bacteria 13048
34 Ga0055536_1007355 3300003781 Bacteria 4947
35 Ga0055534_1000379 3300003784 Bacteria 27759
36 Ga0055534_1000533 3300003784 Bacteria 20496
37 Ga0055534_1002835 3300003784 Bacteria 5775
38 Ga0055534_1003380 3300003784 Bacteria 5028
39 Ga0055528_1000661 3300003790 Bacteria 25015
40 Ga0055528_1000868 3300003790 Bacteria 20496
41 Ga0055528_1017004 3300003790 Bacteria 2541
42 Ga0055528_1041043 3300003790 Bacteria 1036
43 Ga0055530_10000318 3300003791 Bacteria 43641
44 Ga0055540_1000194 3300003792 Bacteria 58565
45 Ga0055540_1000747 3300003792 Bacteria 22059
46 Ga0055540_1001928 3300003792 Bacteria 11588
47 Ga0055540_1005685 3300003792 Bacteria 5159
48 Ga0055540_1011959 3300003792 Bacteria 2756
49 Ga0055531_10001032 3300003794 Bacteria 22059
50 Ga0055531_10002357 3300003794 Bacteria 12698
51 Ga0055531_10010815 3300003794 Bacteria 4487
52 Ga0055543_1001683 3300004625 Bacteria 8370
53 Ga0065165_1004070 3300005262 Bacteria 9483
54 Ga0065165_1036228 3300005262 Bacteria 1507
55 Ga0065714_10003524 3300005288 Bacteria 8451
56 Ga0070680_100309258 3300005336 Unclassified 1341
57 Ga0070674_100566934 3300005356 Bacteria 955
58 Ga0070667_100105311 3300005367 Bacteria 2441
59 Ga0070713_100015560 3300005436 Bacteria 5695
60 Ga0070713_100160004 3300005436 Bacteria 2009
61 Ga0070713_100229074 3300005436 Bacteria 1688
62 Ga0070708_100015229 3300005445 Bacteria 6343
63 Ga0070708_100411890 3300005445 Bacteria 1275
64 Ga0070662_100232260 3300005457 Bacteria 1476
65 Ga0070706_100013100 3300005467 Bacteria 7672
66 Ga0070706_100132115 3300005467 Bacteria 2330
67 Ga0070706_100145177 3300005467 Bacteria 2216
68 Ga0070707_100019130 3300005468 Bacteria 6449
69 Ga0070707_100023098 3300005468 Bacteria 5883
70 Ga0070707_100029519 3300005468 Bacteria 5221
71 Ga0070698_100229018 3300005471 Bacteria 1792
72 Ga0070699_100244282 3300005518 Bacteria 1603
73 Ga0070699_100463358 3300005518 Bacteria 1149
74 Ga0070697_100000085 3300005536 Bacteria 77098
75 Ga0070697_100038142 3300005536 Bacteria 3882
76 Ga0070697_100038419 3300005536 Bacteria 3868
77 Ga0070697_100069008 3300005536 Bacteria 2895
78 Ga0070697_100105375 3300005536 Bacteria 2346
79 Ga0070697_100106803 3300005536 Bacteria 2329
80 Ga0070697_100173777 3300005536 Bacteria 1824
81 Ga0068853_100106182 3300005539 Bacteria 2488
82 Ga0068853_100530270 3300005539 Bacteria 1114
83 Ga0070672_100173545 3300005543 Bacteria 1794
84 Ga0068855_100001171 3300005563 Bacteria 32532
85 Ga0068855_100025390 3300005563 Bacteria 7090
86 Ga0068855_100281445 3300005563 Bacteria 1847
87 Ga0070664_100053005 3300005564 Bacteria 3437
88 Ga0068857_100051266 3300005577 Bacteria 3661
89 Ga0068854_100001144 3300005578 Bacteria 15938
90 Ga0068856_100199525 3300005614 Bacteria 2015
91 Ga0068852_100432701 3300005616 Bacteria 1299
92 Ga0068864_100087139 3300005618 Bacteria 2748
93 Ga0068851_10300636 3300005834 Bacteria 923
94 Ga0068863_100002749 3300005841 Bacteria 17410
95 Ga0068863_100464370 3300005841 Bacteria 1243
96 Ga0068858_100855510 3300005842 Bacteria 888
97 Ga0070717_10007019 3300006028 Bacteria 8335
98 Ga0070717_10028839 3300006028 Bacteria 4447
99 Ga0075432_10039255 3300006058 Bacteria 1651
100 Ga0075362_10009608 3300006177 Bacteria 3747
101 Ga0075362_10174977 3300006177 Bacteria 1038
102 Ga0075367_10226400 3300006178 Bacteria 1171
103 Ga0075366_10171192 3300006195 Bacteria 1317
104 Ga0075370_10108541 3300006353 Bacteria 1610
105 Ga0075370_10163784 3300006353 Bacteria 1306
106 Ga0075436_100042009 3300006914 Bacteria 3153
107 Ga0075436_100043812 3300006914 Bacteria 3085
108 Ga0079104_1000072 3300006946 Bacteria 152567
109 Ga0079104_1024106 3300006946 Bacteria 1607
110 Ga0099826_10015498 3300006948 Bacteria 5757
111 Ga0075435_100032153 3300007076 Bacteria 4142
112 Ga0075435_100136678 3300007076 Bacteria 2054
113 Ga0105244_10004531 3300009036 Bacteria 9527
114 Ga0105250_10002441 3300009092 Bacteria 9341
115 Ga0105240_10018080 3300009093 Bacteria 9478
116 Ga0105240_10059967 3300009093 Bacteria 4745
117 Ga0105240_10659871 3300009093 Bacteria 1145
118 Ga0105243_10000626 3300009148 Bacteria 35234
119 Ga0105243_10001087 3300009148 Bacteria 24856
120 Ga0105243_10395966 3300009148 Bacteria 1282
121 Ga0105242_10002680 3300009176 Bacteria 13929
122 Ga0105248_10450726 3300009177 Bacteria 1450
123 Ga0105237_10013469 3300009545 Bacteria 8573
124 Ga0105237_10115969 3300009545 Bacteria 2672
125 Ga0105238_10000031 3300009551 Bacteria 179497
126 Ga0105238_10045813 3300009551 Unclassified 4417
127 Ga0105238_10167907 3300009551 Bacteria 2170
128 Ga0105239_10004190 3300010375 Bacteria 17328
129 Ga0105239_10140218 3300010375 Unclassified 2693
130 Ga0105239_10379625 3300010375 Bacteria 1598
131 Ga0105246_10116856 3300011119 Bacteria 1970
132 Ga0157373_10010507 3300013100 Bacteria 6811
133 Ga0157371_10136823 3300013102 Bacteria 1745
134 Ga0157370_10005132 3300013104 Bacteria 14768
135 Ga0157370_10038136 3300013104 Bacteria 4650
136 Ga0157370_10184823 3300013104 Bacteria 1936
137 Ga0157369_10011614 3300013105 Bacteria 10000
138 Ga0157369_10093851 3300013105 Unclassified 3203
139 Ga0157374_10022489 3300013296 Bacteria 5624
140 Ga0157372_10030940 3300013307 Bacteria 5858
141 Ga0157372_10032723 3300013307 Bacteria 5704
142 Ga0182008_10008979 3300014497 Bacteria 5416
143 Ga0182008_10014778 3300014497 Bacteria 4083
144 Ga0182008_10049945 3300014497 Bacteria 2076
145 Ga0182008_10165910 3300014497 Bacteria 1113
146 Ga0157379_10009044 3300014968 Bacteria 8679
147 Ga0182006_1001869 3300015261 Bacteria 12046
148 Ga0182006_1003998 3300015261 Bacteria 7366
149 Ga0182006_1021085 3300015261 Bacteria 2721
150 Ga0182006_1046961 3300015261 Bacteria 1676
151 Ga0182007_10032152 3300015262 Bacteria 1783
152 Ga0183362_10010 3300015683 Bacteria 106392
153 Ga0163161_10000099 3300017792 Bacteria 83318
154 Ga0163161_10024771 3300017792 Bacteria 4242
155 Ga0213872_10006511 3300021361 Bacteria 5847
156 Ga0213875_10139718 3300021388 Unclassified 1133
157 Ga0209436_108075 3300025208 Bacteria 2133
158 Ga0209672_100425 3300025228 Bacteria 24733
159 Ga0209672_100477 3300025228 Bacteria 22499
160 Ga0209147_102731 3300025229 Bacteria 4010
161 Ga0209258_100568 3300025242 Bacteria 31666
162 Ga0207425_1000273 3300025245 Bacteria 37954
163 Ga0207425_1000614 3300025245 Bacteria 20548
164 Ga0209148_1000033 3300025254 Bacteria 555508
165 Ga0209129_1000247 3300025258 Bacteria 56623
166 Ga0209129_1003218 3300025258 Bacteria 7285
167 Ga0209129_1005512 3300025258 Bacteria 4446
168 Ga0209565_1000042 3300025263 Bacteria 239712
169 Ga0209565_1000256 3300025263 Bacteria 56528
170 Ga0209565_1002503 3300025263 Bacteria 6558
171 Ga0209673_1000071 3300025273 Bacteria 239966
172 Ga0209673_1000592 3300025273 Bacteria 56577
173 Ga0209673_1000731 3300025273 Bacteria 45565
174 Ga0209673_1001396 3300025273 Bacteria 23530
175 Ga0209130_1000366 3300025284 Bacteria 51201
176 Ga0209130_1000496 3300025284 Bacteria 40068
177 Ga0209130_1020141 3300025284 Bacteria 1532
178 Ga0209675_1000041 3300025291 Bacteria 239712
179 Ga0209675_1000814 3300025291 Bacteria 20539
180 Ga0209675_1003241 3300025291 Bacteria 7851
181 Ga0209675_1003436 3300025291 Bacteria 7534
182 Ga0209675_1004718 3300025291 Bacteria 5962
183 Ga0209676_1000048 3300025292 Bacteria 403716
184 Ga0209676_1000287 3300025292 Bacteria 103263
185 Ga0209676_1000331 3300025292 Bacteria 90857
186 Ga0209676_1000573 3300025292 Bacteria 55423
187 Ga0209676_1003204 3300025292 Bacteria 10363
188 Ga0209025_1000088 3300025294 Bacteria 255087
189 Ga0209025_1000104 3300025294 Bacteria 226895
190 Ga0209025_1000113 3300025294 Bacteria 218943
191 Ga0209025_1000710 3300025294 Bacteria 56623
192 Ga0209025_1011186 3300025294 Bacteria 5958
193 Ga0209025_1013215 3300025294 Bacteria 5210
194 Ga0209564_1000596 3300025295 Bacteria 56623
195 Ga0209564_1002077 3300025295 Bacteria 17219
196 Ga0209564_1007220 3300025295 Bacteria 5781
197 Ga0209758_1000909 3300025297 Bacteria 40123
198 Ga0209758_1008662 3300025297 Bacteria 6528
199 Ga0209050_1000012 3300025298 Bacteria 813717
200 Ga0209050_1000460 3300025298 Bacteria 72933
201 Ga0209256_1000516 3300025299 Bacteria 56623
202 Ga0209256_1000679 3300025299 Bacteria 45927
203 Ga0207426_1000058 3300025302 Bacteria 363857
204 Ga0207426_1001624 3300025302 Bacteria 17738
205 Ga0209051_1000019 3300025303 Bacteria 511268
206 Ga0209051_1000307 3300025303 Bacteria 76668
207 Ga0209051_1000441 3300025303 Bacteria 56405
208 Ga0209051_1001689 3300025303 Bacteria 17720
209 Ga0209051_1012591 3300025303 Bacteria 4084
210 Ga0209257_1000024 3300025304 Bacteria 726068
211 Ga0209257_1000057 3300025304 Bacteria 396985
212 Ga0209257_1002859 3300025304 Bacteria 16123
213 Ga0209257_1023399 3300025304 Bacteria 2173
214 Ga0207696_1003669 3300025711 Bacteria 6895
215 Ga0207655_1015566 3300025728 Bacteria 4217
216 Ga0207684_10018323 3300025910 Bacteria 5993
217 Ga0207684_10125450 3300025910 Bacteria 2203
218 Ga0207695_10000480 3300025913 Bacteria 85456
219 Ga0207695_10409384 3300025913 Bacteria 1240
220 Ga0207671_10005593 3300025914 Bacteria 11543
221 Ga0207657_10003161 3300025919 Bacteria 17613
222 Ga0207652_10020943 3300025921 Bacteria 5392
223 Ga0207646_10026591 3300025922 Bacteria 5279
224 Ga0207646_10061580 3300025922 Bacteria 3349
225 Ga0207694_10000062 3300025924 Bacteria 140156
226 Ga0207694_10125034 3300025924 Bacteria 2057
227 Ga0207694_10132921 3300025924 Bacteria 1995
228 Ga0207700_10007917 3300025928 Bacteria 6540
229 Ga0207664_10067181 3300025929 Bacteria 2876
230 Ga0207706_10017645 3300025933 Bacteria 6430
231 Ga0207709_10000104 3300025935 Bacteria 130964
232 Ga0207709_10000168 3300025935 Bacteria 88059
233 Ga0207709_10009625 3300025935 Bacteria 5322
234 Ga0207709_10189995 3300025935 Bacteria 1458
235 Ga0207669_10240713 3300025937 Bacteria 1341
236 Ga0207679_10213058 3300025945 Bacteria 1621
237 Ga0207667_10000044 3300025949 Bacteria 248251
238 Ga0207667_10084588 3300025949 Bacteria 3284
239 Ga0207667_10234597 3300025949 Bacteria 1878
240 Ga0207667_10280997 3300025949 Bacteria 1701
241 Ga0207651_10356181 3300025960 Bacteria 1234
242 Ga0207640_10336683 3300025981 Bacteria 1207
243 Ga0207658_10644855 3300025986 Bacteria 954
244 Ga0207639_10162898 3300026041 Bacteria 1881
245 Ga0207702_10200848 3300026078 Unclassified 1848
246 Ga0207641_10002977 3300026088 Bacteria 15329
247 Ga0207641_10270048 3300026088 Unclassified 1596
248 Ga0207641_10538469 3300026088 Bacteria 1137
249 Ga0207648_10125118 3300026089 Bacteria 2261
250 Ga0207674_10067045 3300026116 Bacteria 3614
251 Ga0207674_10655345 3300026116 Bacteria 1014
252 Ga0209281_1000002 3300027111 Bacteria 1924012
253 Ga0209281_1017379 3300027111 Bacteria 1459
254 Ga0209282_1003079 3300027666 Bacteria 9816
255 Ga0265318_10120773 3300028577 Bacteria 963
256 Ga0307515_10000014 3300028794 Bacteria 562358
257 Ga0265338_10000705 3300028800 Bacteria 57138
258 Ga0265762_1005907 3300030760 Bacteria 2192
259 Ga0265320_10040180 3300031240 Bacteria 2334
260 Ga0265329_10092504 3300031242 Bacteria 960
261 Ga0265331_10062388 3300031250 Bacteria 1758
262 Ga0265327_10003729 3300031251 Bacteria 14174
263 Ga0307513_10233976 3300031456 Bacteria 1648
264 Ga0307408_100107725 3300031548 Bacteria 2134
265 Ga0307405_10035737 3300031731 Bacteria 2970
266 Ga0307412_10457037 3300031911 Bacteria 1053
267 Ga0307411_10376356 3300032005 Bacteria 1166
268 Ga0316583_10022715 3300032133 Bacteria 2245
269 Ga0373956_0036493 3300035119 Bacteria 2170
270 Ga0373957_0092297 3300035120 Bacteria 1205
271 Ga0373955_0137695 3300035172 Bacteria 1429
272 Ga0373933_0111601 3300035724 Bacteria 1706
273 Ga0395900_0413361 3300037418 Bacteria 1311
274 Ga0395905_0000658 3300037471 Bacteria 45924
275 Ga0395905_0036861 3300037471 Bacteria 4592
276 Ga0395905_0060925 3300037471 Bacteria 3529
277 Ga0436364_1089698 3300037853 Unclassified 3004
278 Ga0395901_0176124 3300038443 Bacteria 2244
279 Ga0395901_0376850 3300038443 Bacteria 1461
280 Ga0436361_1190221 3300039447 Bacteria 43680
281 Ga0436363_0693963 3300039450 Bacteria 10215
282 Ga0439465_0005707 3300041413 Bacteria 3962
283 Ga0439448_0010328 3300042005 Bacteria 2767
284 Ga0439449_0000724 3300042007 Bacteria 12645
285 Ga0439462_0013531 3300042015 Bacteria 2091
286 Ga0439446_0037885 3300042156 Bacteria 1413
287 Ga0450908_005034 3300042184 Bacteria 2536
288 Ga0466969_0058000 3300044656 Bacteria 1886
289 Ga0466972_0008663 3300044658 Bacteria 5102
290 Ga0466965_0057218 3300044683 Bacteria 1943
291 Ga0466965_0062419 3300044683 Bacteria 1864
292 Ga0466965_0078434 3300044683 Bacteria 1668
293 Ga0466966_0000043 3300044684 Bacteria 93998
294 Ga0466966_0009182 3300044684 Bacteria 6546
295 Ga0466966_0160190 3300044684 Bacteria 1370
296 Ga0466961_0000072 3300044693 Bacteria 62185
297 Ga0466961_0002650 3300044693 Bacteria 11103
298 Ga0466961_0006057 3300044693 Bacteria 7667
299 Ga0466961_0022796 3300044693 Bacteria 4027
300 Ga0466961_0154449 3300044693 Bacteria 1432
301 Ga0466961_0213718 3300044693 Bacteria 1190
302 Ga0466963_0005422 3300044694 Bacteria 7469
303 Ga0466963_0019923 3300044694 Bacteria 4214
304 Ga0466963_0074923 3300044694 Bacteria 2283
305 Ga0466964_0012414 3300044706 Bacteria 3223
306 Ga0466964_0013091 3300044706 Bacteria 3144
307 Ga0466971_0015174 3300044719 Bacteria 3390
308 Ga0466968_0002467 3300044735 Bacteria 6791
309 Ga0466968_0033611 3300044735 Bacteria 2137
310 Ga0466970_0121772 3300044765 Bacteria 1429
311 Ga0466957_0015288 3300044842 Bacteria 4482
312 Ga0466957_0027732 3300044842 Bacteria 3367
313 Ga0466960_0031086 3300044901 Bacteria 2461
314 Ga0466959_0003418 3300045049 Bacteria 10380
315 Ga0466959_0007476 3300045049 Bacteria 7669
316 Ga0466959_0040408 3300045049 Bacteria 3445
317 Ga0466959_0269928 3300045049 Bacteria 1169
318 Ga0451576_0449487 3300045051 Unclassified 1353
319 Ga0466958_0004757 3300045836 Bacteria 7218
320 Ga0466958_0004945 3300045836 Bacteria 7110
321 Ga0466958_0006727 3300045836 Bacteria 6276
322 Ga0466967_0000968 3300045976 Bacteria 15576
323 Ga0466967_0017169 3300045976 Bacteria 5736
324 Ga0466967_0148957 3300045976 Bacteria 2185
325 Ga0466967_0211738 3300045976 Bacteria 1838
326 Ga0495627_003666 3300046453 Bacteria 6666
327 Ga0495629_0187325 3300046459 Bacteria 1433
328 Ga0495651_0035889 3300046462 Bacteria 3859
329 Ga0495580_0017565 3300046472 Bacteria 5347
330 Ga0495580_0035282 3300046472 Bacteria 3597
331 Ga0495610_0005191 3300046512 Bacteria 9327
332 Ga0495616_0009658 3300046513 Bacteria 5624
333 Ga0495620_0000768 3300046515 Bacteria 19677
334 Ga0495628_0186826 3300046516 Bacteria 1566
335 Ga0495631_0005042 3300046518 Bacteria 6956
336 Ga0495652_0428265 3300046529 Bacteria 931
337 Ga0495654_0026723 3300046530 Bacteria 2965
338 Ga0495587_0149047 3300046536 Bacteria 1333
339 Ga0495645_0129618 3300046543 Bacteria 1769
340 Ga0495668_0119236 3300046616 Bacteria 1443
341 Ga0495634_0108762 3300046642 Bacteria 1784
342 Ga0495625_0074301 3300046660 Bacteria 2381
343 Ga0495657_0058921 3300046675 Bacteria 2548
344 Ga0495658_0050937 3300046683 Bacteria 2344
345 Ga0495613_0221705 3300046689 Bacteria 1327
346 Ga0495671_0001568 3300046692 Bacteria 15149
347 Ga0495676_0028286 3300047321 Bacteria 4789
348 Ga0495680_0031154 3300047322 Bacteria 4345
349 Ga0495675_0163746 3300047444 Bacteria 1369
350 Ga0495684_0048713 3300047471 Bacteria 3239
351 Ga0495593_0001026 3300047673 Bacteria 16386
352 Ga0495602_0379077 3300048088 Bacteria 1014
353 Ga0496100_0000473 3300048903 Bacteria 19248
354 Ga0496100_0018514 3300048903 Unclassified 4133
355 Ga0496101_0040540 3300048904 Bacteria 3316
356 Ga0496101_0044245 3300048904 Bacteria 3185
357 Ga0496102_0000224 3300048905 Bacteria 74893
358 Ga0496102_0025152 3300048905 Bacteria 5296
359 Ga0496102_0046888 3300048905 Bacteria 3926
360 Ga0496102_0130095 3300048905 Bacteria 2355
361 Ga0496102_0140622 3300048905 Bacteria 2263
362 Ga0496103_0000019 3300048906 Bacteria 234311
363 Ga0496103_0224344 3300048906 Unclassified 1208
364 Ga0496104_0024985 3300048907 Bacteria 5504
365 Ga0496104_0027789 3300048907 Bacteria 5237
366 Ga0496105_0185067 3300048908 Bacteria 1704
367 Ga0496108_0029060 3300048911 Bacteria 4576
368 Ga0496108_0058834 3300048911 Bacteria 3231
369 Ga0496108_0099793 3300048911 Bacteria 2475
370 Ga0496109_0120025 3300048912 Bacteria 2449
371 Ga0496109_0151999 3300048912 Bacteria 2167
372 Ga0496109_0602930 3300048912 Bacteria 1034
373 Ga0496110_0310159 3300048913 Bacteria 1437
374 Ga0496110_0363725 3300048913 Bacteria 1318
375 Ga0496110_0368638 3300048913 Bacteria 1309
376 Ga0496111_0073909 3300048914 Bacteria 2482
377 Ga0496111_0096560 3300048914 Bacteria 2169
378 Ga0496111_0153711 3300048914 Bacteria 1707
379 Ga0496112_0082196 3300048915 Bacteria 3186
380 Ga0496112_0157045 3300048915 Bacteria 2241
381 Ga0496112_0341376 3300048915 Bacteria 1441
382 Ga0496115_0410014 3300048918 Bacteria 1099
383 Ga0496116_0000339 3300048919 Bacteria 74892
384 Ga0496116_0013262 3300048919 Bacteria 6662
385 Ga0496116_0038488 3300048919 Bacteria 3319
386 Ga0496116_0109901 3300048919 Bacteria 1623
387 Ga0496117_0000101 3300048920 Bacteria 191796
388 Ga0496117_0007447 3300048920 Bacteria 10692
389 Ga0496117_0102492 3300048920 Bacteria 1806
390 Ga0496118_0000377 3300048921 Bacteria 74911
391 Ga0496118_0005503 3300048921 Bacteria 14373
392 Ga0496118_0022859 3300048921 Bacteria 5452
393 Ga0496118_0070906 3300048921 Bacteria 2512
394 Ga0496118_0100189 3300048921 Bacteria 1961
395 Ga0496119_0001183 3300048922 Bacteria 32722
396 Ga0496119_0025340 3300048922 Bacteria 4145
397 Ga0496119_0105510 3300048922 Bacteria 1574
398 Ga0496120_0002848 3300048923 Bacteria 16664
399 Ga0496121_0000601 3300048924 Bacteria 67662
400 Ga0496121_0002686 3300048924 Bacteria 26596
401 Ga0496121_0048676 3300048924 Bacteria 3604
402 Ga0496121_0072794 3300048924 Bacteria 2757
403 Ga0496121_0082705 3300048924 Bacteria 2537
404 Ga0496122_0000033 3300048925 Bacteria 324104
405 Ga0496123_0000301 3300048926 Bacteria 96158
406 Ga0496123_0033241 3300048926 Bacteria 3714
407 Ga0496123_0101457 3300048926 Bacteria 1673
408 Ga0496124_0016849 3300048927 Bacteria 6926
409 Ga0496124_0057449 3300048927 Bacteria 3278
410 Ga0496124_0101100 3300048927 Bacteria 2336
411 Ga0496124_0120230 3300048927 Bacteria 2100
412 Ga0496124_0151594 3300048927 Bacteria 1817
413 Ga0496125_0004456 3300048928 Bacteria 16168
414 Ga0496125_0032250 3300048928 Bacteria 4656
415 Ga0496125_0068002 3300048928 Bacteria 2804
416 Ga0496125_0192489 3300048928 Bacteria 1345
417 Ga0496126_0000523 3300048929 Bacteria 74906
418 Ga0496126_0030831 3300048929 Bacteria 5076
419 Ga0501031_0023847 3300049568 Bacteria 3989
420 Ga0501032_0037789 3300049569 Bacteria 3290
421 Ga0501032_0151934 3300049569 Bacteria 1522
422 Ga0501033_0011386 3300049570 Bacteria 6807
423 Ga0501036_0092988 3300049572 Bacteria 2548
424 Ga0501036_0109885 3300049572 Bacteria 2329
425 Ga0501037_0004916 3300049573 Bacteria 9726
426 Ga0501038_0021133 3300049574 Bacteria 5846
427 Ga0501039_0198712 3300049575 Bacteria 1576
428 Ga0501040_0023245 3300049576 Bacteria 4155
429 Ga0501040_0057765 3300049576 Bacteria 2664
430 Ga0501041_0023746 3300049577 Bacteria 3676
431 Ga0501041_0236559 3300049577 Bacteria 1147
432 Ga0501042_0056382 3300049578 Bacteria 2804
433 Ga0501043_0026761 3300049579 Bacteria 4525
434 Ga0501046_0009792 3300049580 Bacteria 8265
435 Ga0501046_0392642 3300049580 Bacteria 1003
436 Ga0501047_0511714 3300049581 Bacteria 1027
437 Ga0501048_0043709 3300049582 Bacteria 3206
438 Ga0501048_0065223 3300049582 Bacteria 2575
439 Ga0501067_0146363 3300049583 Bacteria 1316
440 Ga0501068_0011867 3300049584 Bacteria 4925
441 Ga0501069_0001557 3300049585 Bacteria 11340
442 Ga0501070_0087579 3300049586 Bacteria 2577
443 Ga0501071_0002515 3300049587 Bacteria 11157
444 Ga0501072_0079655 3300049588 Bacteria 2594
445 Ga0501073_0002955 3300049589 Bacteria 12752
446 Ga0501075_0330071 3300049591 Bacteria 1162
447 Ga0501076_0062751 3300049592 Bacteria 2960
448 Ga0501076_0120429 3300049592 Bacteria 2125
449 Ga0501077_0016006 3300049593 Bacteria 4724
450 Ga0501079_0077288 3300049741 Bacteria 2575
451 Ga0501080_0103134 3300049742 Bacteria 2645
452 Ga0501080_0428880 3300049742 Bacteria 1187
453 Ga0501081_0097328 3300049743 Bacteria 2076
454 Ga0501081_0259383 3300049743 Bacteria 1270
455 Ga0501083_0026517 3300049744 Bacteria 4004
456 Ga0501035_0021769 3300049822 Bacteria 5893
457 Ga0501044_0052197 3300049823 Bacteria 4214
458 Ga0501044_0553726 3300049823 Bacteria 1047
459 Ga0501045_0120825 3300049824 Bacteria 1945
460 nmdc:mga03683_2333_c1 3300050489 Bacteria 5873
461 nmdc:mga03683_66855_c1 3300050489 Bacteria 1529
462 nmdc:mga0yw44_4066_c1 3300050492 Bacteria 6626
463 nmdc:mga0k408_4257_c1 3300050493 Bacteria 7595
464 nmdc:mga0k408_4556_c1 3300050493 Bacteria 7360
465 nmdc:mga07m45_129185_c1 3300050496 Bacteria 1462
466 nmdc:mga07m45_1725_c1 3300050496 Bacteria 10074
467 nmdc:mga0n895_412136_c1 3300050512 Bacteria 1366
468 nmdc:mga0n895_774136_c1 3300050512 Bacteria 951
469 nmdc:mga0rr50_71159_c1 3300050513 Bacteria 2653
470 nmdc:mga08x19_4775_c1 3300050514 Bacteria 8035
471 nmdc:mga08x19_4925_c1 3300050514 Bacteria 7884
472 Ga0500610_0001908 3300053079 Bacteria 7408
473 Ga0500651_0000158 3300053093 Bacteria 43443
474 Ga0500571_000077 3300053110 Bacteria 30794
475 Ga0500593_007845 3300053117 Bacteria 4364
476 Ga0500658_0000053 3300053134 Bacteria 61630
477 Ga0500658_0000058 3300053134 Bacteria 55299
478 Ga0500568_0004374 3300053139 Bacteria 7562
479 Ga0500574_000584 3300053141 Bacteria 4702
480 Ga0500616_0044355 3300053153 Bacteria 2372
481 Ga0500624_003264 3300053157 Bacteria 2131
482 Ga0500627_0004592 3300053158 Bacteria 4463
483 Ga0501084_0008854 3300054114 Bacteria 8332
484 Ga0501084_0305993 3300054114 Bacteria 1342
485 Ga0501084_0611407 3300054114 Bacteria 921
486 Ga0501082_0121639 3300060353 Bacteria 2262
487 Ga0466962_0003381 3300061719 Bacteria 7592
488 Ga0530510_0215420 3300061734 Bacteria 1427
489 2513230471 2513020051 Bacteria 6053213
490 2574433054 2574179768 Bacteria 4907129
491 2599627553 2599185214 Bacteria 8209958
492 2599677624 2599185226 Bacteria 8233575
493 2599685279 2599185227 Bacteria 8246414
494 2599697072 2599185229 Bacteria 8216126
495 2600815069 2600255067 Bacteria 6795583
496 2644061142 2643221609 Bacteria 6756331
497 2644071852 2643221611 Bacteria 6820941
498 2644159793 2643221628 Bacteria 5745828
499 2644325411 2643221658 Bacteria 6064537
500 2644399145 2643221672 Bacteria 6322190
501 2644467316 2643221683 Bacteria 5749203
502 2722885472 2721755523 Bacteria 6430384
503 2738718471 2738541277 Bacteria 7458140
504 2738882930 2738541307 Bacteria 8606193
505 2739243483 2738543012 Bacteria 7115078
506 2739281658 2738543019 Bacteria 7459457
507 2774391674 2773857762 Bacteria 5971770
508 2816475725 2816332133 Bacteria 7249298
509 2819600663 2818991446 Bacteria 7757362
510 2831268045 2831265667 Bacteria 7184833
511 2838061215 2838054893 Bacteria 7451788
512 2839140328 2839138175 Bacteria 6549354
513 2858690878 2858688981 Bacteria 8184122
514 2858952525 2858950400 Bacteria 6783797
515 2885203186 2885198086 Bacteria 7212419
516 2885216417 2885211737 Bacteria 7212420
517 2891374050 2891373044 Bacteria 5202277
518 2891971271 2891968417 Bacteria 5821697
519 2894025354 2894023352 Bacteria 5167372
520 2895515191 2895511927 Bacteria 6802080
521 2899928190 2899924645 Bacteria 7487985
522 2904442683 2904439833 Bacteria 5931679
523 2904453492 2904449895 Bacteria 6927402
524 2904463068 2904456579 Bacteria 6819253
525 2904535108 2904530477 Bacteria 5876334
526 2904548309 2904541872 Bacteria 8915136
527 2904588550 2904584206 Bacteria 6028872
528 2904594376 2904589729 Bacteria 6113573
529 2904604791 2904601388 Bacteria 5884906
530 2904772454 2904770941 Bacteria 5580202
531 2919083019 2919079590 Bacteria 5946433
532 2928041140 2928037797 Bacteria 7273642
533 2928047982 2928044640 Bacteria 7271509
534 2928055822 2928051484 Bacteria 7773759
535 2928066704 2928064002 Bacteria 7419480
536 2928075197 2928070936 Bacteria 8062541
537 2928088380 2928084124 Bacteria 7159212
538 2928132896 2928130867 Bacteria 5467269
539 2929163299 2929160207 Bacteria 9075316
540 2929525082 2929520902 Bacteria 6765052
541 2939632085 2939631187 Bacteria 6118131
542 2941480797
543 2945909996 2945909444 Bacteria 7065066
544 2945987983 2945984333 Bacteria 7358892
545 2990257009 2990256926 Bacteria 4252839
546 639787085 639633007 Bacteria 4376040
547 8002747212 8002745576 Bacteria 4840272
548 8003315447 8003314358 Bacteria 10575343
549 Ga0496100_0358676
550 JGI25152J39213_1001152
551 JGI25152J39213_1004850
552 JGI25150J39212_1000629
553 JGI25159J45721_1001540
554 JGI25159J45721_1002520
555 JGI25159J45721_1019277
556 JGI25151J46595_10001171
557 JGI25151J46595_10002144
558 JGI25151J46595_10012957
559 JGI25151J46595_10017190
560 JGI25153J46596_10001941
561 JGI25153J46596_10012061
562 rootH2_10096586
563 rootH1_10006638
564 JGI25160J50197_1002114
565 JGI25160J50197_1008892
566 JGI25161J50226_1000849
567 JGI25161J50226_1004835
568 Ga0006562J51391_1065136
569 Ga0006562J51391_1065137
570 Ga0055535_1000750
571 Ga0055542_1000583
572 Ga0055526_1001020
573 Ga0055526_1003328
574 Ga0055526_1006457
575 Ga0055537_1000575
576 Ga0055537_1019415
577 Ga0055524_1000825
578 Ga0055524_1005418
579 Ga0055536_1000296
580 Ga0055536_1000955
581 Ga0055536_1001692
582 Ga0055536_1007355
583 Ga0055534_1000379
584 Ga0055534_1000533
585 Ga0055534_1002835
586 Ga0055534_1003380
587 Ga0055528_1000661
588 Ga0055528_1000868
589 Ga0055528_1017004
590 Ga0055528_1041043
591 Ga0055530_10000318
592 Ga0055540_1000194
593 Ga0055540_1000747
594 Ga0055540_1001928
595 Ga0055540_1005685
596 Ga0055540_1011959
597 Ga0055531_10001032
598 Ga0055531_10002357
599 Ga0055531_10010815
600 Ga0055543_1001683
601 Ga0065165_1004070
602 Ga0065165_1036228
603 Ga0065714_10003524
604 Ga0070680_100309258
605 Ga0070674_100566934
606 Ga0070667_100105311
607 Ga0070713_100015560
608 Ga0070713_100160004
609 Ga0070713_100229074
610 Ga0070708_100015229
611 Ga0070708_100411890
612 Ga0070662_100232260
613 Ga0070706_100013100
614 Ga0070706_100132115
615 Ga0070706_100145177
616 Ga0070707_100019130
617 Ga0070707_100023098
618 Ga0070707_100029519
619 Ga0070698_100229018
620 Ga0070699_100244282
621 Ga0070699_100463358
622 Ga0070697_100000085
623 Ga0070697_100038142
624 Ga0070697_100038419
625 Ga0070697_100069008
626 Ga0070697_100105375
627 Ga0070697_100106803
628 Ga0070697_100173777
629 Ga0068853_100106182
630 Ga0068853_100530270
631 Ga0070672_100173545
632 Ga0068855_100001171
633 Ga0068855_100025390
634 Ga0068855_100281445
635 Ga0070664_100053005
636 Ga0068857_100051266
637 Ga0068854_100001144
638 Ga0068856_100199525
639 Ga0068852_100432701
640 Ga0068864_100087139
641 Ga0068851_10300636
642 Ga0068863_100002749
643 Ga0068863_100464370
644 Ga0068858_100855510
645 Ga0070717_10007019
646 Ga0070717_10028839
647 Ga0075432_10039255
648 Ga0075362_10009608
649 Ga0075362_10174977
650 Ga0075367_10226400
651 Ga0075366_10171192
652 Ga0075370_10108541
653 Ga0075370_10163784
654 Ga0075436_100042009
655 Ga0075436_100043812
656 Ga0079104_1000072
657 Ga0079104_1024106
658 Ga0099826_10015498
659 Ga0075435_100032153
660 Ga0075435_100136678
661 Ga0105244_10004531
662 Ga0105250_10002441
663 Ga0105240_10018080
664 Ga0105240_10059967
665 Ga0105240_10659871
666 Ga0105243_10000626
667 Ga0105243_10001087
668 Ga0105243_10395966
669 Ga0105242_10002680
670 Ga0105248_10450726
671 Ga0105237_10013469
672 Ga0105237_10115969
673 Ga0105238_10000031
674 Ga0105238_10045813
675 Ga0105238_10167907
676 Ga0105239_10004190
677 Ga0105239_10140218
678 Ga0105239_10379625
679 Ga0105246_10116856
680 Ga0157373_10010507
681 Ga0157371_10136823
682 Ga0157370_10005132
683 Ga0157370_10038136
684 Ga0157370_10184823
685 Ga0157369_10011614
686 Ga0157369_10093851
687 Ga0157374_10022489
688 Ga0157372_10030940
689 Ga0157372_10032723
690 Ga0182008_10008979
691 Ga0182008_10014778
692 Ga0182008_10049945
693 Ga0182008_10165910
694 Ga0157379_10009044
695 Ga0182006_1001869
696 Ga0182006_1003998
697 Ga0182006_1021085
698 Ga0182006_1046961
699 Ga0182007_10032152
700 Ga0183362_10010
701 Ga0163161_10000099
702 Ga0163161_10024771
703 Ga0213872_10006511
704 Ga0213875_10139718
705 Ga0209436_108075
706 Ga0209672_100425
707 Ga0209672_100477
708 Ga0209147_102731
709 Ga0209258_100568
710 Ga0207425_1000273
711 Ga0207425_1000614
712 Ga0209148_1000033
713 Ga0209129_1000247
714 Ga0209129_1003218
715 Ga0209129_1005512
716 Ga0209565_1000042
717 Ga0209565_1000256
718 Ga0209565_1002503
719 Ga0209673_1000071
720 Ga0209673_1000592
721 Ga0209673_1000731
722 Ga0209673_1001396
723 Ga0209130_1000366
724 Ga0209130_1000496
725 Ga0209130_1020141
726 Ga0209675_1000041
727 Ga0209675_1000814
728 Ga0209675_1003241
729 Ga0209675_1003436
730 Ga0209675_1004718
731 Ga0209676_1000048
732 Ga0209676_1000287
733 Ga0209676_1000331
734 Ga0209676_1000573
735 Ga0209676_1003204
736 Ga0209025_1000088
737 Ga0209025_1000104
738 Ga0209025_1000113
739 Ga0209025_1000710
740 Ga0209025_1011186
741 Ga0209025_1013215
742 Ga0209564_1000596
743 Ga0209564_1002077
744 Ga0209564_1007220
745 Ga0209758_1000909
746 Ga0209758_1008662
747 Ga0209050_1000012
748 Ga0209050_1000460
749 Ga0209256_1000516
750 Ga0209256_1000679
751 Ga0207426_1000058
752 Ga0207426_1001624
753 Ga0209051_1000019
754 Ga0209051_1000307
755 Ga0209051_1000441
756 Ga0209051_1001689
757 Ga0209051_1012591
758 Ga0209257_1000024
759 Ga0209257_1000057
760 Ga0209257_1002859
761 Ga0209257_1023399
762 Ga0207696_1003669
763 Ga0207655_1015566
764 Ga0207684_10018323
765 Ga0207684_10125450
766 Ga0207695_10000480
767 Ga0207695_10409384
768 Ga0207671_10005593
769 Ga0207657_10003161
770 Ga0207652_10020943
771 Ga0207646_10026591
772 Ga0207646_10061580
773 Ga0207694_10000062
774 Ga0207694_10125034
775 Ga0207694_10132921
776 Ga0207700_10007917
777 Ga0207664_10067181
778 Ga0207706_10017645
779 Ga0207709_10000104
780 Ga0207709_10000168
781 Ga0207709_10009625
782 Ga0207709_10189995
783 Ga0207669_10240713
784 Ga0207679_10213058
785 Ga0207667_10000044
786 Ga0207667_10084588
787 Ga0207667_10234597
788 Ga0207667_10280997
789 Ga0207651_10356181
790 Ga0207640_10336683
791 Ga0207658_10644855
792 Ga0207639_10162898
793 Ga0207702_10200848
794 Ga0207641_10002977
795 Ga0207641_10270048
796 Ga0207641_10538469
797 Ga0207648_10125118
798 Ga0207674_10067045
799 Ga0207674_10655345
800 Ga0209281_1000002
801 Ga0209281_1017379
802 Ga0209282_1003079
803 Ga0265318_10120773
804 Ga0307515_10000014
805 Ga0265338_10000705
806 Ga0265762_1005907
807 Ga0265320_10040180
808 Ga0265329_10092504
809 Ga0265331_10062388
810 Ga0265327_10003729
811 Ga0307513_10233976
812 Ga0307408_100107725
813 Ga0307405_10035737
814 Ga0307412_10457037
815 Ga0307411_10376356
816 Ga0316583_10022715
817 Ga0373956_0036493
818 Ga0373957_0092297
819 Ga0373955_0137695
820 Ga0373933_0111601
821 Ga0395900_0413361
822 Ga0395905_0000658
823 Ga0395905_0036861
824 Ga0395905_0060925
825 Ga0436364_1089698
826 Ga0395901_0176124
827 Ga0395901_0376850
828 Ga0436361_1190221
829 Ga0436363_0693963
830 Ga0439465_0005707
831 Ga0439448_0010328
832 Ga0439449_0000724
833 Ga0439462_0013531
834 Ga0439446_0037885
835 Ga0450908_005034
836 Ga0466969_0058000
837 Ga0466972_0008663
838 Ga0466965_0057218
839 Ga0466965_0062419
840 Ga0466965_0078434
841 Ga0466966_0000043
842 Ga0466966_0009182
843 Ga0466966_0160190
844 Ga0466961_0000072
845 Ga0466961_0002650
846 Ga0466961_0006057
847 Ga0466961_0022796
848 Ga0466961_0154449
849 Ga0466961_0213718
850 Ga0466963_0005422
851 Ga0466963_0019923
852 Ga0466963_0074923
853 Ga0466964_0012414
854 Ga0466964_0013091
855 Ga0466971_0015174
856 Ga0466968_0002467
857 Ga0466968_0033611
858 Ga0466970_0121772
859 Ga0466957_0015288
860 Ga0466957_0027732
861 Ga0466960_0031086
862 Ga0466959_0003418
863 Ga0466959_0007476
864 Ga0466959_0040408
865 Ga0466959_0269928
866 Ga0451576_0449487
867 Ga0466958_0004757
868 Ga0466958_0004945
869 Ga0466958_0006727
870 Ga0466967_0000968
871 Ga0466967_0017169
872 Ga0466967_0148957
873 Ga0466967_0211738
874 Ga0495627_003666
875 Ga0495629_0187325
876 Ga0495651_0035889
877 Ga0495580_0017565
878 Ga0495580_0035282
879 Ga0495610_0005191
880 Ga0495616_0009658
881 Ga0495620_0000768
882 Ga0495628_0186826
883 Ga0495631_0005042
884 Ga0495652_0428265
885 Ga0495654_0026723
886 Ga0495587_0149047
887 Ga0495645_0129618
888 Ga0495668_0119236
889 Ga0495634_0108762
890 Ga0495625_0074301
891 Ga0495657_0058921
892 Ga0495658_0050937
893 Ga0495613_0221705
894 Ga0495671_0001568
895 Ga0495676_0028286
896 Ga0495680_0031154
897 Ga0495675_0163746
898 Ga0495684_0048713
899 Ga0495593_0001026
900 Ga0495602_0379077
901 Ga0496100_0000473
902 Ga0496100_0018514
903 Ga0496101_0040540
904 Ga0496101_0044245
905 Ga0496102_0000224
906 Ga0496102_0025152
907 Ga0496102_0046888
908 Ga0496102_0130095
909 Ga0496102_0140622
910 Ga0496103_0000019
911 Ga0496103_0224344
912 Ga0496104_0024985
913 Ga0496104_0027789
914 Ga0496105_0185067
915 Ga0496108_0029060
916 Ga0496108_0058834
917 Ga0496108_0099793
918 Ga0496109_0120025
919 Ga0496109_0151999
920 Ga0496109_0602930
921 Ga0496110_0310159
922 Ga0496110_0363725
923 Ga0496110_0368638
924 Ga0496111_0073909
925 Ga0496111_0096560
926 Ga0496111_0153711
927 Ga0496112_0082196
928 Ga0496112_0157045
929 Ga0496112_0341376
930 Ga0496115_0410014
931 Ga0496116_0000339
932 Ga0496116_0013262
933 Ga0496116_0038488
934 Ga0496116_0109901
935 Ga0496117_0000101
936 Ga0496117_0007447
937 Ga0496117_0102492
938 Ga0496118_0000377
939 Ga0496118_0005503
940 Ga0496118_0022859
941 Ga0496118_0070906
942 Ga0496118_0100189
943 Ga0496119_0001183
944 Ga0496119_0025340
945 Ga0496119_0105510
946 Ga0496120_0002848
947 Ga0496121_0000601
948 Ga0496121_0002686
949 Ga0496121_0048676
950 Ga0496121_0072794
951 Ga0496121_0082705
952 Ga0496122_0000033
953 Ga0496123_0000301
954 Ga0496123_0033241
955 Ga0496123_0101457
956 Ga0496124_0016849
957 Ga0496124_0057449
958 Ga0496124_0101100
959 Ga0496124_0120230
960 Ga0496124_0151594
961 Ga0496125_0004456
962 Ga0496125_0032250
963 Ga0496125_0068002
964 Ga0496125_0192489
965 Ga0496126_0000523
966 Ga0496126_0030831
967 Ga0501031_0023847
968 Ga0501032_0037789
969 Ga0501032_0151934
970 Ga0501033_0011386
971 Ga0501036_0092988
972 Ga0501036_0109885
973 Ga0501037_0004916
974 Ga0501038_0021133
975 Ga0501039_0198712
976 Ga0501040_0023245
977 Ga0501040_0057765
978 Ga0501041_0023746
979 Ga0501041_0236559
980 Ga0501042_0056382
981 Ga0501043_0026761
982 Ga0501046_0009792
983 Ga0501046_0392642
984 Ga0501047_0511714
985 Ga0501048_0043709
986 Ga0501048_0065223
987 Ga0501067_0146363
988 Ga0501068_0011867
989 Ga0501069_0001557
990 Ga0501070_0087579
991 Ga0501071_0002515
992 Ga0501072_0079655
993 Ga0501073_0002955
994 Ga0501075_0330071
995 Ga0501076_0062751
996 Ga0501076_0120429
997 Ga0501077_0016006
998 Ga0501079_0077288
999 Ga0501080_0103134
1000 Ga0501080_0428880
1001 Ga0501081_0097328
1002 Ga0501081_0259383
1003 Ga0501083_0026517
1004 Ga0501035_0021769
1005 Ga0501044_0052197
1006 Ga0501044_0553726
1007 Ga0501045_0120825
1008 nmdc:mga03683_2333_c1
1009 nmdc:mga03683_66855_c1
1010 nmdc:mga0yw44_4066_c1
1011 nmdc:mga0k408_4257_c1
1012 nmdc:mga0k408_4556_c1
1013 nmdc:mga07m45_129185_c1
1014 nmdc:mga07m45_1725_c1
1015 nmdc:mga0n895_412136_c1
1016 nmdc:mga0n895_774136_c1
1017 nmdc:mga0rr50_71159_c1
1018 nmdc:mga08x19_4775_c1
1019 nmdc:mga08x19_4925_c1
1020 Ga0500610_0001908
1021 Ga0500651_0000158
1022 Ga0500571_000077
1023 Ga0500593_007845
1024 Ga0500658_0000053
1025 Ga0500658_0000058
1026 Ga0500568_0004374
1027 Ga0500574_000584
1028 Ga0500616_0044355
1029 Ga0500624_003264
1030 Ga0500627_0004592
1031 Ga0501084_0008854
1032 Ga0501084_0305993
1033 Ga0501084_0611407
1034 Ga0501082_0121639
1035 Ga0466962_0003381
1036 Ga0530510_0215420
1037 2513230471
1038 2574433054
1039 2599627553
1040 2599677624
1041 2599685279
1042 2599697072
1043 2600815069
1044 2644061142
1045 2644071852
1046 2644159793
1047 2644325411
1048 2644399145
1049 2644467316
1050 2722885472
1051 2738718471
1052 2738882930
1053 2739243483
1054 2739281658
1055 2774391674
1056 2816475725
1057 2819600663
1058 2831268045
1059 2838061215
1060 2839140328
1061 2858690878
1062 2858952525
1063 2885203186
1064 2885216417
1065 2891374050
1066 2891971271
1067 2894025354
1068 2895515191
1069 2899928190
1070 2904442683
1071 2904453492
1072 2904463068
1073 2904535108
1074 2904548309
1075 2904588550
1076 2904594376
1077 2904604791
1078 2904772454
1079 2919083019
1080 2928041140
1081 2928047982
1082 2928055822
1083 2928066704
1084 2928075197
1085 2928088380
1086 2928132896
1087 2929163299
1088 2929525082
1089 2939632085
1090 2941480797
1091 2945909996
1092 2945987983
1093 2990257009
1094 639787085
1095 8002747212
1096 8003315447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

44

234

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

51

283

0.93

PF08659

KR

KR domain

45

217

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hs9-assembly3.cif.gz_C brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant:i258m/k262t 0.9617 5 244
1nff-assembly1.cif.gz_A crystal structure of rv2002 gene product from mycobacterium tuberculosis 0.9584 5 248
2d1y-assembly1.cif.gz_A crystal structure of tt0321 from thermus thermophilus hb8 0.9548 4 248
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9513 1 248
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9513 6 245
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9688 5 181 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9513 1 248 3.40.50.720
1nfrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9502 5 248 3.40.50.720
af_G5EGA6_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9501 6 246 3.40.50.720
af_Q7K3N4_96_372_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9432 8 183 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A150A8C5-F1-model_v4 Short-chain dehydrogenase 0.9947 5 263 GO:0016491
AF-A0A8B1B5B7-F1-model_v4 deleted 0.9925 3 234
AF-A0A2N2UJS6-F1-model_v4 Short-chain dehydrogenase 0.9916 4 186 GO:0016491
AF-A0A7M2Z1A7-F1-model_v4 Short-chain alcohol dehydrogenase 0.9906 4 173 GO:0016491
AF-A0A6I3CKT4-F1-model_v4 SDR family oxidoreductase 0.9805 5 227 GO:0016491

Map