F462285

General Info

Members Datasets Scaffolds Average Seq Length
548 424 1096 270

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0112043|Ga0501032_0112043_700_1590
Length 296
Sequence MDAAGFHNRPACATTQPSQRRSEIEMDGKLILVGCGNMGFAMLSGWLKAGRLEPGDVRVVEPGEALRRRVRDLKVEAVADASALPQALRPDLVMFAVKPQVIRAVVPAYRRFAASGATFLSIAAGTRIALFEELLGGNVPVMRCMPNTPAAIGKGMMVLVSNGRVAPAMDAFIEALMSASGRVARIGSEDLMDAVTAVSGSGPAYIFHFIECLAAAAEKAGLPAETAKLLAMQTVHGATCLAAESGEEPGILREQVTSPNGTTAAALGVLMGGNRLRDLLVEAVEAARKRSVELGG

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
34 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
35 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
36 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
37 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
39 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
40 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
52 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
64 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
65 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
66 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
67 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
68 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
69 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
70 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
71 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
72 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
73 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
74 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
75 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
76 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
77 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
78 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
79 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
80 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
81 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
82 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
83 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
84 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
85 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
112 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
113 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
114 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
115 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
118 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
119 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
124 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
125 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
126 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
127 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
128 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
129 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
130 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
131 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
132 2512875024
133 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
134 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
135 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
136 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
137 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
138 2534681786 Brucella suis 92/29 Isolate Unclassified
139 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
140 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
141 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
142 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
143 2643221557 Ensifer sp. Root558 Isolate Unclassified
144 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
145 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
146 2643221618 Ensifer sp. Root231 Isolate Unclassified
147 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
148 2643221626 Ensifer sp. Root31 Isolate Unclassified
149 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
150 2643221655 Ensifer sp. Root1252 Isolate Unclassified
151 2643221659 Ensifer sp. Root127 Isolate Unclassified
152 2643221698 Ensifer sp. Root142 Isolate Unclassified
153 2643221712 Ensifer sp. Root258 Isolate Unclassified
154 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
155 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
156 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
157 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
158 2738543024 Aminobacter sp. AP02 Isolate Unclassified
159 2751185800 Brucella pituitosa AA2 Isolate Unclassified
160 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
161 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
162 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
163 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
164 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
165 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
166 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
167 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
168 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
169 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
170 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
171 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
172 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
173 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
174 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
175 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
176 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
177 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
178 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
179 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
180 2854911287 Brucella lupini LUP21 Isolate Unclassified
181 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
182 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
183 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
184 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
185 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
186 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
187 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
188 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
189 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
190 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
191 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
192 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
193 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
194 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
195 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
196 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
197 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
198 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
199 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
200 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
201 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
202 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
203 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
204 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
205 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
206 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
207 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
208 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
209 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
210 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
211 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
212 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
213 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
214 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
215 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
216 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
217 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
218 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
219 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
220 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
221 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
222 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
223 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
224 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
225 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
226 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
227 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
228 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
229 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
230 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
231 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
232 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
233 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
234 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
235 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
236 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
237 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
238 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
239 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
240 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
241 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
242 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
243 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
244 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
245 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
246 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
247 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
248 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
249 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
250 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
251 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
252 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
253 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
254 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
255 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
256 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
257 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
258 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
259 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
260 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
261 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
262 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
263 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
264 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
265 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
266 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
267 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
268 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
269 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
270 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
271 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
272 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
273 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
274 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
275 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
276 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
277 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
278 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
279 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
280 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
281 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
282 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
283 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
284 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
285 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
286 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
287 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
288 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
289 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
290 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
291 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
292 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
293 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
294 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
295 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
296 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
297 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
298 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
299 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
300 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
301 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
302 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
303 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
304 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
305 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
306 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
307 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
308 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
309 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
310 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
311 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
312 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
313 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
314 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
315 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
316 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
317 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
318 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
319 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
320 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
321 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
322 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
323 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
324 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
325 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
326 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
327 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
328 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
329 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
330 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
331 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
332 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
333 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
334 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
335 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
336 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
337 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
338 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
339 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
340 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
341 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
342 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
343 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
344 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
345 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
346 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
347 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
348 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
349 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
350 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
351 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
352 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
353 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
354 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
355 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
356 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
357 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
358 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
359 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
360 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
361 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
362 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
363 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
364 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
365 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
366 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
367 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
368 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
369 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
370 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
371 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
372 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
373 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
374 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
375 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
376 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
377 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
378 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
379 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
380 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
381 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
382 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
383 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
384 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
385 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
386 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
387 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
388 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
389 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
390 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
391 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
392 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
393 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
394 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
395 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
396 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
397 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
398 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
399 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
400 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
401 3004167301 Mesorhizobium loti 582 Isolate Unclassified
402 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
403 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
404 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
405 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
406 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
407 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
408 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
409 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
410 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
411 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
412 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
413 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
414 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
415 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
416 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
417 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
418 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
419 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
420 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
421 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
422 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
423 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
424 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.98
Metatranscriptomes 0
Isolates 56.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.93
Nodule 44.71
Rhizoplane 1.09
Rhizosphere 34.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0112043 3300049569 Bacteria 1805
2 JGI24739J22299_10046465 3300001989 Bacteria 1421
3 JGI24735J21928_10050302 3300002067 Bacteria 1203
4 JGI25165J46597_1000020 3300003214 Bacteria 370477
5 Ga0055542_1000549 3300003762 Bacteria 33335
6 Ga0055529_1002315 3300003763 Bacteria 3800
7 Ga0065165_1005336 3300005262 Bacteria 7304
8 Ga0070660_100313473 3300005339 Bacteria 1287
9 Ga0070663_100006263 3300005455 Bacteria 7137
10 Ga0068867_100285443 3300005459 Bacteria 1355
11 Ga0068853_100002399 3300005539 Bacteria 14011
12 Ga0068853_100400981 3300005539 Bacteria 1284
13 Ga0070665_100221440 3300005548 Bacteria 1893
14 Ga0068854_100412564 3300005578 Bacteria 1120
15 Ga0068856_100101391 3300005614 Bacteria 2871
16 Ga0081540_1011720 3300005983 Bacteria 5835
17 Ga0081539_10000646 3300005985 Bacteria 70179
18 Ga0075365_10003273 3300006038 Bacteria 8304
19 Ga0075365_10006906 3300006038 Bacteria 6300
20 Ga0075368_10043453 3300006042 Bacteria 1771
21 Ga0075363_100001186 3300006048 Bacteria 9612
22 Ga0075364_10036295 3300006051 Bacteria 3186
23 Ga0075367_10000725 3300006178 Bacteria 12789
24 Ga0075367_10031565 3300006178 Bacteria 3042
25 Ga0075367_10214210 3300006178 Bacteria 1205
26 Ga0075370_10064664 3300006353 Bacteria 2086
27 Ga0079104_1004645 3300006946 Bacteria 5771
28 Ga0105240_10214696 3300009093 Bacteria 2245
29 Ga0105245_10397557 3300009098 Bacteria 1376
30 Ga0105237_10014190 3300009545 Bacteria 8342
31 Ga0105238_10008979 3300009551 Bacteria 10005
32 Ga0105238_10136133 3300009551 Bacteria 2434
33 Ga0105239_10012345 3300010375 Bacteria 9514
34 Ga0105239_10050525 3300010375 Bacteria 4560
35 Ga0105239_10066607 3300010375 Bacteria 3956
36 Ga0157370_10065420 3300013104 Bacteria 3440
37 Ga0157369_10241800 3300013105 Bacteria 1885
38 Ga0157369_10345304 3300013105 Bacteria 1546
39 Ga0157374_10138084 3300013296 Bacteria 2364
40 Ga0182008_10045704 3300014497 Bacteria 2177
41 Ga0182007_10099729 3300015262 Bacteria 961
42 Ga0214542_1001787 3300021321 Bacteria 44536
43 Ga0214543_1001073 3300021327 Bacteria 51004
44 Ga0209026_1000116 3300025250 Bacteria 133228
45 Ga0209148_1000256 3300025254 Bacteria 83479
46 Ga0209759_1000153 3300025256 Bacteria 119494
47 Ga0209233_1000047 3300025261 Bacteria 459614
48 Ga0209233_1019626 3300025261 Bacteria 1793
49 Ga0209455_1000314 3300025272 Bacteria 48752
50 Ga0209130_1004638 3300025284 Bacteria 5112
51 Ga0209025_1041256 3300025294 Bacteria 1980
52 Ga0209758_1006672 3300025297 Bacteria 8153
53 Ga0207647_10055829 3300025904 Bacteria 2425
54 Ga0207645_10178341 3300025907 Bacteria 1394
55 Ga0207695_10084812 3300025913 Bacteria 3197
56 Ga0207695_10288455 3300025913 Bacteria 1534
57 Ga0207640_10344755 3300025981 Bacteria 1195
58 Ga0207639_10399623 3300026041 Bacteria 1238
59 Ga0207639_10590669 3300026041 Bacteria 1023
60 Ga0207678_10029993 3300026067 Bacteria 4748
61 Ga0207648_10282757 3300026089 Bacteria 1484
62 Ga0209281_1003047 3300027111 Bacteria 5905
63 Ga0209813_10055331 3300027866 Bacteria 1253
64 Ga0268266_10045003 3300028379 Bacteria 3774
65 Ga0268266_10454431 3300028379 Bacteria 1218
66 Ga0307515_10060057 3300028794 Bacteria 5435
67 Ga0307513_10119136 3300031456 Bacteria 2612
68 Ga0307412_10045455 3300031911 Bacteria 2871
69 Ga0307412_10110486 3300031911 Bacteria 1962
70 Ga0307416_100145713 3300032002 Bacteria 2162
71 Ga0395899_0336453 3300037312 Bacteria 1013
72 Ga0395900_0008427 3300037418 Bacteria 10606
73 Ga0395900_0492124 3300037418 Bacteria 1178
74 Ga0395900_0509888 3300037418 Bacteria 1152
75 Ga0395898_0326272 3300037466 Bacteria 1464
76 Ga0395905_0012419 3300037471 Bacteria 8198
77 Ga0395905_0055287 3300037471 Bacteria 3715
78 Ga0395901_0016751 3300038443 Bacteria 7468
79 Ga0395901_0081590 3300038443 Bacteria 3378
80 Ga0395901_0144938 3300038443 Bacteria 2497
81 Ga0395901_0372097 3300038443 Bacteria 1472
82 Ga0395901_0375469 3300038443 Bacteria 1464
83 Ga0451837_0912053 3300041494 Bacteria 7206
84 Ga0451851_0285867 3300041507 Bacteria 2585
85 Ga0466972_0150434 3300044658 Bacteria 1094
86 Ga0466965_0082554 3300044683 Bacteria 1626
87 Ga0466960_0075950 3300044901 Bacteria 1682
88 Ga0466960_0079591 3300044901 Bacteria 1648
89 Ga0495650_0041780 3300046471 Bacteria 1958
90 Ga0495620_0060194 3300046515 Bacteria 1584
91 Ga0495632_0050459 3300046519 Bacteria 2052
92 Ga0495643_0094432 3300046522 Bacteria 1539
93 Ga0495625_0115587 3300046660 Bacteria 1831
94 Ga0495649_0121380 3300046694 Bacteria 1382
95 Ga0495687_043039 3300047443 Bacteria 1970
96 Ga0495686_0098196 3300047472 Bacteria 1770
97 Ga0496102_0500128 3300048905 Bacteria 1138
98 Ga0496109_0139147 3300048912 Bacteria 2270
99 Ga0496115_0123595 3300048918 Bacteria 2131
100 Ga0496118_0147284 3300048921 Bacteria 1480
101 Ga0496119_0069547 3300048922 Bacteria 2068
102 Ga0496119_0089404 3300048922 Bacteria 1754
103 Ga0496121_0201558 3300048924 Bacteria 1418
104 Ga0496122_0016638 3300048925 Bacteria 6938
105 Ga0496122_0047970 3300048925 Bacteria 3290
106 Ga0496123_0033661 3300048926 Bacteria 3683
107 Ga0496124_0097582 3300048927 Bacteria 2386
108 Ga0496124_0169041 3300048927 Bacteria 1696
109 Ga0496125_0000083 3300048928 Bacteria 227168
110 Ga0496125_0030508 3300048928 Bacteria 4822
111 Ga0496125_0125987 3300048928 Bacteria 1815
112 Ga0496125_0165036 3300048928 Bacteria 1498
113 Ga0496126_0034002 3300048929 Bacteria 4793
114 Ga0496126_0133641 3300048929 Bacteria 2142
115 Ga0501031_0006747 3300049568 Bacteria 7485
116 Ga0501032_0000010 3300049569 Bacteria 206795
117 Ga0501032_0000234 3300049569 Bacteria 46284
118 Ga0501032_0004110 3300049569 Bacteria 11027
119 Ga0501032_0007130 3300049569 Bacteria 8185
120 Ga0501032_0067596 3300049569 Bacteria 2387
121 Ga0501033_0000017 3300049570 Bacteria 206819
122 Ga0501033_0000076 3300049570 Bacteria 93921
123 Ga0501033_0000461 3300049570 Bacteria 38633
124 Ga0501033_0007956 3300049570 Bacteria 8211
125 Ga0501033_0077545 3300049570 Bacteria 2438
126 Ga0501033_0086576 3300049570 Bacteria 2294
127 Ga0501033_0187227 3300049570 Bacteria 1482
128 Ga0501033_0221087 3300049570 Bacteria 1348
129 Ga0501034_0000053 3300049571 Bacteria 206821
130 Ga0501034_0000408 3300049571 Bacteria 72244
131 Ga0501034_0001177 3300049571 Bacteria 36220
132 Ga0501034_0048296 3300049571 Bacteria 4295
133 Ga0501034_0136179 3300049571 Bacteria 2437
134 Ga0501034_0473854 3300049571 Bacteria 1168
135 Ga0501034_0497936 3300049571 Bacteria 1132
136 Ga0501036_0000009 3300049572 Bacteria 206821
137 Ga0501036_0001942 3300049572 Bacteria 16039
138 Ga0501036_0016587 3300049572 Bacteria 6151
139 Ga0501037_0000008 3300049573 Bacteria 206812
140 Ga0501037_0000533 3300049573 Bacteria 30360
141 Ga0501037_0001129 3300049573 Bacteria 19768
142 Ga0501037_0027954 3300049573 Bacteria 4167
143 Ga0501037_0117317 3300049573 Bacteria 1915
144 Ga0501037_0222732 3300049573 Bacteria 1327
145 Ga0501038_0000008 3300049574 Bacteria 206821
146 Ga0501038_0000241 3300049574 Bacteria 46177
147 Ga0501038_0010826 3300049574 Bacteria 8335
148 Ga0501038_0021029 3300049574 Bacteria 5863
149 Ga0501039_0000021 3300049575 Bacteria 162552
150 Ga0501039_0000196 3300049575 Bacteria 43498
151 Ga0501039_0042311 3300049575 Bacteria 3519
152 Ga0501040_0004759 3300049576 Bacteria 8801
153 Ga0501042_0022378 3300049578 Bacteria 4416
154 Ga0501043_0000007 3300049579 Bacteria 224595
155 Ga0501043_0000043 3300049579 Bacteria 115410
156 Ga0501043_0001135 3300049579 Bacteria 23377
157 Ga0501043_0004389 3300049579 Bacteria 11468
158 Ga0501043_0017234 3300049579 Bacteria 5666
159 Ga0501043_0105434 3300049579 Bacteria 2215
160 Ga0501043_0117483 3300049579 Bacteria 2087
161 Ga0501043_0171071 3300049579 Bacteria 1695
162 Ga0501043_0295923 3300049579 Bacteria 1238
163 Ga0501043_0313743 3300049579 Bacteria 1196
164 Ga0501043_0491573 3300049579 Bacteria 918
165 Ga0501046_0013416 3300049580 Bacteria 6936
166 Ga0501046_0041755 3300049580 Bacteria 3659
167 Ga0501046_0277510 3300049580 Bacteria 1228
168 Ga0501047_0000126 3300049581 Bacteria 93841
169 Ga0501047_0006630 3300049581 Bacteria 10888
170 Ga0501047_0009959 3300049581 Bacteria 8984
171 Ga0501047_0185570 3300049581 Bacteria 1945
172 Ga0501047_0342464 3300049581 Bacteria 1332
173 Ga0501048_0013189 3300049582 Bacteria 6133
174 Ga0501048_0235086 3300049582 Bacteria 1300
175 Ga0501068_0038128 3300049584 Bacteria 2878
176 Ga0501068_0061604 3300049584 Bacteria 2280
177 Ga0501069_0000027 3300049585 Bacteria 106217
178 Ga0501069_0005501 3300049585 Bacteria 6594
179 Ga0501070_0000231 3300049586 Bacteria 52768
180 Ga0501070_0000747 3300049586 Bacteria 29640
181 Ga0501070_0006630 3300049586 Bacteria 9854
182 Ga0501070_0008567 3300049586 Bacteria 8646
183 Ga0501070_0010600 3300049586 Bacteria 7790
184 Ga0501070_0037237 3300049586 Bacteria 4061
185 Ga0501070_0078066 3300049586 Bacteria 2740
186 Ga0501070_0239140 3300049586 Bacteria 1486
187 Ga0501071_0002085 3300049587 Bacteria 11996
188 Ga0501071_0043158 3300049587 Bacteria 3232
189 Ga0501071_0274417 3300049587 Bacteria 1275
190 Ga0501071_0281042 3300049587 Bacteria 1260
191 Ga0501073_0006075 3300049589 Bacteria 9008
192 Ga0501073_0089193 3300049589 Bacteria 2144
193 Ga0501074_0000023 3300049590 Bacteria 68925
194 Ga0501074_0027258 3300049590 Bacteria 4142
195 Ga0501074_0075346 3300049590 Bacteria 2422
196 Ga0501074_0128056 3300049590 Bacteria 1817
197 Ga0501080_0000300 3300049742 Bacteria 37703
198 Ga0501080_0011089 3300049742 Bacteria 8246
199 Ga0501080_0029890 3300049742 Bacteria 5072
200 Ga0501080_0233572 3300049742 Bacteria 1680
201 Ga0501083_0000012 3300049744 Bacteria 178668
202 Ga0501083_0263482 3300049744 Bacteria 1121
203 Ga0501035_0000023 3300049822 Bacteria 206821
204 Ga0501035_0000073 3300049822 Bacteria 122603
205 Ga0501035_0000449 3300049822 Bacteria 46083
206 Ga0501035_0003478 3300049822 Bacteria 15066
207 Ga0501035_0006830 3300049822 Bacteria 10665
208 Ga0501035_0018236 3300049822 Bacteria 6465
209 Ga0501035_0056609 3300049822 Bacteria 3497
210 Ga0501035_0077141 3300049822 Bacteria 2945
211 Ga0501035_0174827 3300049822 Bacteria 1853
212 Ga0501044_0000021 3300049823 Bacteria 206821
213 Ga0501044_0000118 3300049823 Bacteria 95218
214 Ga0501044_0003690 3300049823 Bacteria 17210
215 Ga0501044_0004843 3300049823 Bacteria 15052
216 Ga0501044_0013071 3300049823 Bacteria 8983
217 Ga0501044_0018675 3300049823 Bacteria 7427
218 Ga0501044_0018976 3300049823 Bacteria 7363
219 Ga0501044_0124833 3300049823 Bacteria 2572
220 Ga0501044_0132842 3300049823 Bacteria 2482
221 Ga0501044_0430288 3300049823 Bacteria 1229
222 Ga0501045_0005515 3300049824 Bacteria 8753
223 nmdc:mga03683_74380_c1 3300050489 Bacteria 1457
224 nmdc:mga03n38_136080_c1 3300050490 Bacteria 1223
225 nmdc:mga03n38_29487_c1 3300050490 Bacteria 2297
226 nmdc:mga00v17_6957_c1 3300050491 Bacteria 6018
227 nmdc:mga0yw44_121471_c1 3300050492 Bacteria 1683
228 nmdc:mga0yw44_242899_c1 3300050492 Bacteria 1197
229 nmdc:mga0yw44_33244_c1 3300050492 Bacteria 3012
230 nmdc:mga0yw44_43714_c1 3300050492 Bacteria 2676
231 nmdc:mga0yw44_53961_c1 3300050492 Bacteria 2442
232 nmdc:mga06z11_16687_c1 3300050494 Bacteria 3314
233 nmdc:mga07m45_16813_c1 3300050496 Bacteria 3919
234 Ga0500610_0085773 3300053079 Bacteria 1639
235 Ga0500568_0000489 3300053139 Bacteria 29208
236 Ga0500604_0029544 3300053151 Bacteria 1599
237 Ga0500604_0076985 3300053151 Bacteria 1072
238 Ga0500616_0189818 3300053153 Bacteria 918
239 Ga0500620_000055 3300053155 Bacteria 20744
240 Ga0501082_0011238 3300060353 Bacteria 7694
241 Ga0501082_0190419 3300060353 Bacteria 1785
242 2503200559 2503198000 Bacteria 6884444
243 2509112571 2508501122 Bacteria 6292184
244 2509116858 2508501123 Bacteria 6283661
245 2509145607 2508501127 Bacteria 7037543
246 2509372637 2509276018 Bacteria 6910194
247 2509395346 2509276022 Bacteria 6200534
248 2510316367 2510065059 Bacteria 6847884
249 2511389317 2511231027 Bacteria 5013807
250 2512928766 2512875016 Bacteria 6529530
251 2512963503 2512875024 Bacteria 7195110
252 2513612393 2513237090 Bacteria 7096802
253 2514002558 2513237159 Bacteria 6810126
254 2514039388 2513237164 Bacteria 7563725
255 2514419623 2513237305 Bacteria 7293571
256 2514590735 2513237351 Bacteria 6968952
257 2535486730 2534681786 Bacteria 3308809
258 2588514310 2588253730 Bacteria 6881675
259 2597811218 2597489875 Bacteria 7010078
260 2599940606 2599185301 Bacteria 6161860
261 2643773187 2643221550 Bacteria 4619371
262 2643806517 2643221557 Bacteria 7184309
263 2643840367 2643221564 Bacteria 4193379
264 2643989881 2643221595 Bacteria 6565519
265 2644108256 2643221618 Bacteria 7717186
266 2644132462 2643221623 Bacteria 5239945
267 2644145816 2643221626 Bacteria 8069654
268 2644153533 2643221627 Bacteria 6761570
269 2644307295 2643221655 Bacteria 7722067
270 2644331311 2643221659 Bacteria 7890716
271 2644541327 2643221698 Bacteria 7756764
272 2644613384 2643221712 Bacteria 7729434
273 2688597726 2687453392 Bacteria 6880454
274 2694629181 2693429783 Bacteria 7019804
275 2694636905 2693429784 Bacteria 7241525
276 2723578274 2721755686 Bacteria 7343952
277 2739309644 2738543024 Bacteria 5603683
278 2753357991 2751185800 Bacteria 5467370
279 2756676377 2756170246 Bacteria 7451806
280 2757572435 2757320392 Bacteria 3737298
281 2758638799 2758568016 Bacteria 5645291
282 2765464289 2765235802 Bacteria 5618596
283 2770194627 2767802442 Bacteria 5747986
284 2776272579 2775506902 Bacteria 6208009
285 2776284520 2775506904 Bacteria 5954060
286 2792750149 2791355123 Bacteria 8049106
287 2838699506 2838694306 Bacteria 6853137
288 2839994213 2839993093 Bacteria 5512535
289 2840769396 2840764183 Bacteria 6358399
290 2841735654 2841734538 Bacteria 6784580
291 2842124620 2842118031 Bacteria 7033875
292 2842384248 2842377471 Bacteria 7140707
293 2842389618 2842384541 Bacteria 7057858
294 2842873075 2842871566 Bacteria 4827117
295 2844004324 2844002411 Bacteria 7168230
296 2844009882 2844009547 Bacteria 6728125
297 2847672647 2847670302 Bacteria 6165597
298 2847691789 2847686936 Bacteria 6278406
299 2854916211 2854911287 Bacteria 5582813
300 2856315127 2856314179 Bacteria 6477897
301 2856328193 2856320880 Bacteria 7263508
302 2856332250 2856328259 Bacteria 6528202
303 2856338798 2856334872 Bacteria 7037011
304 2856344832 2856342000 Bacteria 7176905
305 2856365902 2856364286 Bacteria 6939991
306 2857353681 2857349434 Bacteria 7926032
307 2857369528 2857367948 Bacteria 6965560
308 2869167306 2869162929 Bacteria 6399702
309 2869240338 2869234852 Bacteria 6654993
310 2869250770 2869249662 Bacteria 6868783
311 2869259812 2869256925 Bacteria 6981691
312 2869269583 2869264136 Bacteria 6880765
313 2869272638 2869271264 Bacteria 6908218
314 2869284272 2869278585 Bacteria 7077053
315 2869286789 2869285874 Bacteria 6901219
316 2871434053 2871429161 Bacteria 6547891
317 2871439177 2871435913 Bacteria 6880295
318 2871445032 2871444079 Bacteria 6423508
319 2871458948 2871451962 Bacteria 7336357
320 2871459703 2871459585 Bacteria 6866887
321 2871473923 2871466892 Bacteria 6923287
322 2871484165 2871481445 Bacteria 6700002
323 2871490108 2871488783 Bacteria 6929816
324 2871502017 2871495908 Bacteria 6935695
325 2874104634 2874102143 Bacteria 6342645
326 2874112398 2874109183 Bacteria 6517025
327 2874121255 2874116593 Bacteria 6674494
328 2874125287 2874123672 Bacteria 7238285
329 2874138423 2874131515 Bacteria 6820270
330 2874139265 2874139085 Bacteria 7021506
331 2874147711 2874146452 Bacteria 7533118
332 2874156629 2874155637 Bacteria 6724144
333 2874167538 2874162495 Bacteria 6174670
334 2874170923 2874168670 Bacteria 8062617
335 2876369191 2876363079 Bacteria 6544991
336 2876374243 2876369609 Bacteria 6807521
337 2876383745 2876377896 Bacteria 6565995
338 2876393757 2876392853 Bacteria 6660880
339 2876404424 2876399893 Bacteria 6927900
340 2876410643 2876406927 Bacteria 6191900
341 2876414797 2876413966 Bacteria 6831344
342 2876424771 2876420981 Bacteria 6687741
343 2878042015 2878035449 Bacteria 6555736
344 2878733395 2878730984 Bacteria 6380721
345 2878740112 2878738818 Bacteria 7136951
346 2878746763 2878745973 Bacteria 6867388
347 2878753207 2878753008 Bacteria 6922523
348 2878765746 2878760144 Bacteria 6823465
349 2878772420 2878767105 Bacteria 6898628
350 2878780760 2878774303 Bacteria 6108671
351 2878783866 2878781027 Bacteria 6834456
352 2881154702 2881147464 Bacteria 7779814
353 2881158463 2881155292 Bacteria 6461656
354 2881164113 2881161766 Bacteria 7127907
355 2881848165 2881845957 Bacteria 6611900
356 2881854718 2881853255 Bacteria 6698367
357 2881862740 2881861095 Bacteria 7128710
358 2882634336 2882632389 Bacteria 8154593
359 2882916553 2882912400 Bacteria 6801539
360 2885308790 2885305155 Bacteria 7348390
361 2885318845 2885312484 Bacteria 6415165
362 2885319176 2885318864 Bacteria 6729568
363 2885333445 2885326080 Bacteria 7134805
364 2885335970 2885334103 Bacteria 7216818
365 2885349511 2885342637 Bacteria 7011821
366 2885357676 2885350715 Bacteria 6787678
367 2888342484 2888337043 Bacteria 6629336
368 2888346263 2888343758 Bacteria 6611049
369 2888351832 2888350351 Bacteria 7372807
370 2889013813 2889010040 Bacteria 6749192
371 2889021493 2889016732 Bacteria 6700763
372 2889793895 2889790730 Bacteria 5689708
373 2889916035 2889914905 Bacteria 5702301
374 2894655416 2894652903 Bacteria 4587256
375 2903449399 2903448605 Bacteria 7357801
376 2903498029 2903492973 Bacteria 13473544
377 2903498206 2903492973 Bacteria 13473544
378 2903526341 2903521522 Bacteria 6525694
379 2903529628 2903528002 Bacteria 6586099
380 2903546692 2903540706 Bacteria 7062119
381 2904579119 2904578770 Bacteria 5302906
382 2904660482 2904659560 Bacteria 6685615
383 2906309143 2906308376 Bacteria 6841989
384 2906326750 2906321335 Bacteria 6579571
385 2906328709 2906328253 Bacteria 6585166
386 2906361732 2906354277 Bacteria 6991324
387 2906365369 2906363423 Bacteria 6856682
388 2906371301 2906370794 Bacteria 6881062
389 2906385315 2906378014 Bacteria 6911440
390 2906387449 2906386501 Bacteria 5977019
391 2906394830 2906393657 Bacteria 6790866
392 2906401586 2906401398 Bacteria 6693206
393 2906411418 2906408224 Bacteria 6162342
394 2906415124 2906414383 Bacteria 6580790
395 2915652877 2915650412 Bacteria 4288180
396 2916079228 2916076590 Bacteria 6596108
397 2919122056 2919119836 Bacteria 5208557
398 2921203980 2921201388 Bacteria 6926299
399 2921204730 2921201388 Bacteria 6926299
400 2922134627 2922130491 Bacteria 7173936
401 2922155318 2922151315 Bacteria 6902399
402 2922160767 2922158528 Bacteria 6573167
403 2922175169 2922172374 Bacteria 6167644
404 2922179539 2922178524 Bacteria 6025201
405 2922190397 2922185730 Bacteria 7113964
406 2924728597 2924726620 Bacteria 6271473
407 2924738466 2924733363 Bacteria 7574837
408 2924745383 2924741084 Bacteria 6661321
409 2924749160 2924748358 Bacteria 6154725
410 2924761624 2924754689 Bacteria 6774424
411 2924767152 2924762789 Bacteria 6561353
412 2924777711 2924776078 Bacteria 7492003
413 2924791196 2924784321 Bacteria 7416538
414 2928522003 2928521798 Bacteria 4960112
415 2937108369 2937106411 Bacteria 6947143
416 2937109030 2937106411 Bacteria 6947143
417 2937813998 2937813078 Bacteria 7783518
418 2937828752 2937822353 Bacteria 7290551
419 2937845227 2937843397 Bacteria 5256375
420 2937850855 2937848649 Bacteria 6983481
421 2937868451 2937861824 Bacteria 6660327
422 2937875350 2937868953 Bacteria 6639878
423 2937883929 2937877337 Bacteria 7246526
424 2937893591 2937891427 Bacteria 6357007
425 2937976680 2937972304 Bacteria 7532020
426 2937984349 2937980651 Bacteria 6517427
427 2938000551 2937994558 Bacteria 7036190
428 2941502801 2941499720 Bacteria 7599444
429 2954014638 2954011201 Bacteria 4762601
430 2958038370 2958034702 Bacteria 6989922
431 2958049284 2958041894 Bacteria 13082850
432 2958055980 2958041894 Bacteria 13082850
433 2958066479 2958064165 Bacteria 7158582
434 2958091207 2958084443 Bacteria 7312792
435 2958101534 2958100919 Bacteria 6800575
436 2958121425 2958115193 Bacteria 6923548
437 2958125049 2958122699 Bacteria 7280457
438 2958131193 2958130278 Bacteria 6897202
439 2958139365 2958137437 Bacteria 6050276
440 2958146766 2958144490 Bacteria 6677056
441 2958160300 2958158011 Bacteria 6058449
442 2958170922 2958165035 Bacteria 6906348
443 2958172956 2958172287 Bacteria 6716688
444 2958180592 2958179912 Bacteria 6874908
445 2961078426 2961077736 Bacteria 7079850
446 2961120804 2961114664 Bacteria 6680456
447 2961137143 2961136820 Bacteria 6775228
448 2961169366 2961163497 Bacteria 6901077
449 2961177031 2961170736 Bacteria 7072258
450 2961185542 2961183825 Bacteria 6688536
451 2963650467 2963644680 Bacteria 6530403
452 2965023618 2965018300 Bacteria 6883036
453 2965029057 2965025482 Bacteria 6532201
454 2965034783 2965032056 Bacteria 6887443
455 2965047611 2965040258 Bacteria 6855979
456 2965048714 2965047637 Bacteria 6623551
457 2965063913 2965062239 Bacteria 7412989
458 2965095544 2965089291 Bacteria 6866420
459 2965106884 2965102966 Bacteria 6800987
460 2965115554 2965110997 Bacteria 6693150
461 2965122563 2965119406 Bacteria 6956431
462 2967666915 2967664464 Bacteria 6948836
463 2967667430 2967664464 Bacteria 6948836
464 2967741171 2967735183 Bacteria 6827012
465 2968002843 2967996073 Bacteria 6787468
466 2968005240 2968003550 Bacteria 6929263
467 2968021325 2968016561 Bacteria 7022047
468 2968085640 2968083720 Bacteria 7351627
469 2968095245 2968091066 Bacteria 6052692
470 2968101215 2968097103 Bacteria 6107094
471 2968111541 2968110612 Bacteria 6814636
472 2968120238 2968117919 Bacteria 6536078
473 2968128636 2968128360 Bacteria 6270294
474 2968140288 2968138860 Bacteria 6605449
475 2968177756 2968171901 Bacteria 6894245
476 2970088224 2970082768 Bacteria 6183754
477 2970476430 2970469710 Bacteria 6969209
478 2970493845 2970489779 Bacteria 6517260
479 2970509704 2970503327 Bacteria 7099517
480 2970514426 2970510686 Bacteria 7006402
481 2970527764 2970524798 Bacteria 6840927
482 2970537374 2970532167 Bacteria 6553173
483 2970541773 2970540015 Bacteria 6977556
484 2970554108 2970547951 Bacteria 6931819
485 2970560602 2970554993 Bacteria 6814252
486 2970598888 2970593180 Bacteria 7073582
487 2970620350 2970619444 Bacteria 6986144
488 2970630515 2970627176 Bacteria 6680862
489 2977822139 2977821940 Bacteria 6906439
490 2977836956 2977828996 Bacteria 7007971
491 2977845299 2977843712 Bacteria 6753583
492 2977851590 2977851361 Bacteria 6694324
493 2977862273 2977858184 Bacteria 6215359
494 2977875803 2977872689 Bacteria 7270173
495 2977904481 2977898635 Bacteria 6675551
496 2977913699 2977907340 Bacteria 6577984
497 2977917977 2977915119 Bacteria 6829656
498 2977923831 2977922695 Bacteria 6956781
499 2977940115 2977935797 Bacteria 6252826
500 2977949876 2977942078 Bacteria 7570577
501 2977953486 2977950692 Bacteria 6893264
502 2977961130 2977957713 Bacteria 6877875
503 2977978064 2977971508 Bacteria 7472917
504 2977990012 2977986579 Bacteria 6581278
505 2979717232 2979710463 Bacteria 6785254
506 2979746611 2979742915 Bacteria 7301278
507 2979773892 2979772303 Bacteria 6618277
508 2979780504 2979779861 Bacteria 6219781
509 2979795295 2979793036 Bacteria 6808957
510 2979814491 2979808191 Bacteria 7179355
511 2987642906 2987636660 Bacteria 8088555
512 2987649498 2987645492 Bacteria 6117018
513 2987658533 2987652177 Bacteria 6969023
514 2987665656 2987659509 Bacteria 6966464
515 2987671103 2987666974 Bacteria 6509233
516 2987679944 2987673487 Bacteria 6884027
517 2996312870 2996310559 Bacteria 6357320
518 2996337604 2996336353 Bacteria 5511628
519 2996348015 2996341866 Bacteria 6643098
520 2996356368 2996348954 Bacteria 7239054
521 2996387919 2996386984 Bacteria 6978667
522 3000142405 3000135777 Bacteria 6891109
523 3002142612 3002141150 Bacteria 5254435
524 3003935337 3003930520 Bacteria 5667563
525 3004172329 3004167301 Bacteria 8330599
526 3004194554 3004188549 Bacteria 6952365
527 3004210699 3004203850 Bacteria 7307914
528 3004213269 3004211236 Bacteria 7417683
529 3004221341 3004218560 Bacteria 7421728
530 3004237961 3004232784 Bacteria 6662140
531 3004251059 3004248173 Bacteria 6563236
532 3004271635 3004268573 Bacteria 7043476
533 3004282672 3004275668 Bacteria 7114440
534 3004293434 3004289098 Bacteria 6135450
535 3004338333 3004334049 Bacteria 8449246
536 637078465 637000159 Bacteria 7596297
537 649872268 649633066 Bacteria 6690028
538 8002288336 8002285264 Bacteria 6717907
539 8004307294 8004300914 Bacteria 6132239
540 8004362020 8004361976 Bacteria 6858373
541 8004374778 8004374579 Bacteria 6898112
542 8004388073 8004387939 Bacteria 7049250
543 8004446264 8004445564 Bacteria 6322258
544 8004635718 8004633249 Bacteria 6723080
545 8004644558 8004640170 Bacteria 6723001
546 8004713158 8004703790 Bacteria 8006957
547 8004715400 8004714634 Bacteria 6776161
548 8004734250 8004727605 Bacteria 6643904
549 Ga0501032_0112043
550 JGI24739J22299_10046465
551 JGI24735J21928_10050302
552 JGI25165J46597_1000020
553 Ga0055542_1000549
554 Ga0055529_1002315
555 Ga0065165_1005336
556 Ga0070660_100313473
557 Ga0070663_100006263
558 Ga0068867_100285443
559 Ga0068853_100002399
560 Ga0068853_100400981
561 Ga0070665_100221440
562 Ga0068854_100412564
563 Ga0068856_100101391
564 Ga0081540_1011720
565 Ga0081539_10000646
566 Ga0075365_10003273
567 Ga0075365_10006906
568 Ga0075368_10043453
569 Ga0075363_100001186
570 Ga0075364_10036295
571 Ga0075367_10000725
572 Ga0075367_10031565
573 Ga0075367_10214210
574 Ga0075370_10064664
575 Ga0079104_1004645
576 Ga0105240_10214696
577 Ga0105245_10397557
578 Ga0105237_10014190
579 Ga0105238_10008979
580 Ga0105238_10136133
581 Ga0105239_10012345
582 Ga0105239_10050525
583 Ga0105239_10066607
584 Ga0157370_10065420
585 Ga0157369_10241800
586 Ga0157369_10345304
587 Ga0157374_10138084
588 Ga0182008_10045704
589 Ga0182007_10099729
590 Ga0214542_1001787
591 Ga0214543_1001073
592 Ga0209026_1000116
593 Ga0209148_1000256
594 Ga0209759_1000153
595 Ga0209233_1000047
596 Ga0209233_1019626
597 Ga0209455_1000314
598 Ga0209130_1004638
599 Ga0209025_1041256
600 Ga0209758_1006672
601 Ga0207647_10055829
602 Ga0207645_10178341
603 Ga0207695_10084812
604 Ga0207695_10288455
605 Ga0207640_10344755
606 Ga0207639_10399623
607 Ga0207639_10590669
608 Ga0207678_10029993
609 Ga0207648_10282757
610 Ga0209281_1003047
611 Ga0209813_10055331
612 Ga0268266_10045003
613 Ga0268266_10454431
614 Ga0307515_10060057
615 Ga0307513_10119136
616 Ga0307412_10045455
617 Ga0307412_10110486
618 Ga0307416_100145713
619 Ga0395899_0336453
620 Ga0395900_0008427
621 Ga0395900_0492124
622 Ga0395900_0509888
623 Ga0395898_0326272
624 Ga0395905_0012419
625 Ga0395905_0055287
626 Ga0395901_0016751
627 Ga0395901_0081590
628 Ga0395901_0144938
629 Ga0395901_0372097
630 Ga0395901_0375469
631 Ga0451837_0912053
632 Ga0451851_0285867
633 Ga0466972_0150434
634 Ga0466965_0082554
635 Ga0466960_0075950
636 Ga0466960_0079591
637 Ga0495650_0041780
638 Ga0495620_0060194
639 Ga0495632_0050459
640 Ga0495643_0094432
641 Ga0495625_0115587
642 Ga0495649_0121380
643 Ga0495687_043039
644 Ga0495686_0098196
645 Ga0496102_0500128
646 Ga0496109_0139147
647 Ga0496115_0123595
648 Ga0496118_0147284
649 Ga0496119_0069547
650 Ga0496119_0089404
651 Ga0496121_0201558
652 Ga0496122_0016638
653 Ga0496122_0047970
654 Ga0496123_0033661
655 Ga0496124_0097582
656 Ga0496124_0169041
657 Ga0496125_0000083
658 Ga0496125_0030508
659 Ga0496125_0125987
660 Ga0496125_0165036
661 Ga0496126_0034002
662 Ga0496126_0133641
663 Ga0501031_0006747
664 Ga0501032_0000010
665 Ga0501032_0000234
666 Ga0501032_0004110
667 Ga0501032_0007130
668 Ga0501032_0067596
669 Ga0501033_0000017
670 Ga0501033_0000076
671 Ga0501033_0000461
672 Ga0501033_0007956
673 Ga0501033_0077545
674 Ga0501033_0086576
675 Ga0501033_0187227
676 Ga0501033_0221087
677 Ga0501034_0000053
678 Ga0501034_0000408
679 Ga0501034_0001177
680 Ga0501034_0048296
681 Ga0501034_0136179
682 Ga0501034_0473854
683 Ga0501034_0497936
684 Ga0501036_0000009
685 Ga0501036_0001942
686 Ga0501036_0016587
687 Ga0501037_0000008
688 Ga0501037_0000533
689 Ga0501037_0001129
690 Ga0501037_0027954
691 Ga0501037_0117317
692 Ga0501037_0222732
693 Ga0501038_0000008
694 Ga0501038_0000241
695 Ga0501038_0010826
696 Ga0501038_0021029
697 Ga0501039_0000021
698 Ga0501039_0000196
699 Ga0501039_0042311
700 Ga0501040_0004759
701 Ga0501042_0022378
702 Ga0501043_0000007
703 Ga0501043_0000043
704 Ga0501043_0001135
705 Ga0501043_0004389
706 Ga0501043_0017234
707 Ga0501043_0105434
708 Ga0501043_0117483
709 Ga0501043_0171071
710 Ga0501043_0295923
711 Ga0501043_0313743
712 Ga0501043_0491573
713 Ga0501046_0013416
714 Ga0501046_0041755
715 Ga0501046_0277510
716 Ga0501047_0000126
717 Ga0501047_0006630
718 Ga0501047_0009959
719 Ga0501047_0185570
720 Ga0501047_0342464
721 Ga0501048_0013189
722 Ga0501048_0235086
723 Ga0501068_0038128
724 Ga0501068_0061604
725 Ga0501069_0000027
726 Ga0501069_0005501
727 Ga0501070_0000231
728 Ga0501070_0000747
729 Ga0501070_0006630
730 Ga0501070_0008567
731 Ga0501070_0010600
732 Ga0501070_0037237
733 Ga0501070_0078066
734 Ga0501070_0239140
735 Ga0501071_0002085
736 Ga0501071_0043158
737 Ga0501071_0274417
738 Ga0501071_0281042
739 Ga0501073_0006075
740 Ga0501073_0089193
741 Ga0501074_0000023
742 Ga0501074_0027258
743 Ga0501074_0075346
744 Ga0501074_0128056
745 Ga0501080_0000300
746 Ga0501080_0011089
747 Ga0501080_0029890
748 Ga0501080_0233572
749 Ga0501083_0000012
750 Ga0501083_0263482
751 Ga0501035_0000023
752 Ga0501035_0000073
753 Ga0501035_0000449
754 Ga0501035_0003478
755 Ga0501035_0006830
756 Ga0501035_0018236
757 Ga0501035_0056609
758 Ga0501035_0077141
759 Ga0501035_0174827
760 Ga0501044_0000021
761 Ga0501044_0000118
762 Ga0501044_0003690
763 Ga0501044_0004843
764 Ga0501044_0013071
765 Ga0501044_0018675
766 Ga0501044_0018976
767 Ga0501044_0124833
768 Ga0501044_0132842
769 Ga0501044_0430288
770 Ga0501045_0005515
771 nmdc:mga03683_74380_c1
772 nmdc:mga03n38_136080_c1
773 nmdc:mga03n38_29487_c1
774 nmdc:mga00v17_6957_c1
775 nmdc:mga0yw44_121471_c1
776 nmdc:mga0yw44_242899_c1
777 nmdc:mga0yw44_33244_c1
778 nmdc:mga0yw44_43714_c1
779 nmdc:mga0yw44_53961_c1
780 nmdc:mga06z11_16687_c1
781 nmdc:mga07m45_16813_c1
782 Ga0500610_0085773
783 Ga0500568_0000489
784 Ga0500604_0029544
785 Ga0500604_0076985
786 Ga0500616_0189818
787 Ga0500620_000055
788 Ga0501082_0011238
789 Ga0501082_0190419
790 2503200559
791 2509112571
792 2509116858
793 2509145607
794 2509372637
795 2509395346
796 2510316367
797 2511389317
798 2512928766
799 2512963503
800 2513612393
801 2514002558
802 2514039388
803 2514419623
804 2514590735
805 2535486730
806 2588514310
807 2597811218
808 2599940606
809 2643773187
810 2643806517
811 2643840367
812 2643989881
813 2644108256
814 2644132462
815 2644145816
816 2644153533
817 2644307295
818 2644331311
819 2644541327
820 2644613384
821 2688597726
822 2694629181
823 2694636905
824 2723578274
825 2739309644
826 2753357991
827 2756676377
828 2757572435
829 2758638799
830 2765464289
831 2770194627
832 2776272579
833 2776284520
834 2792750149
835 2838699506
836 2839994213
837 2840769396
838 2841735654
839 2842124620
840 2842384248
841 2842389618
842 2842873075
843 2844004324
844 2844009882
845 2847672647
846 2847691789
847 2854916211
848 2856315127
849 2856328193
850 2856332250
851 2856338798
852 2856344832
853 2856365902
854 2857353681
855 2857369528
856 2869167306
857 2869240338
858 2869250770
859 2869259812
860 2869269583
861 2869272638
862 2869284272
863 2869286789
864 2871434053
865 2871439177
866 2871445032
867 2871458948
868 2871459703
869 2871473923
870 2871484165
871 2871490108
872 2871502017
873 2874104634
874 2874112398
875 2874121255
876 2874125287
877 2874138423
878 2874139265
879 2874147711
880 2874156629
881 2874167538
882 2874170923
883 2876369191
884 2876374243
885 2876383745
886 2876393757
887 2876404424
888 2876410643
889 2876414797
890 2876424771
891 2878042015
892 2878733395
893 2878740112
894 2878746763
895 2878753207
896 2878765746
897 2878772420
898 2878780760
899 2878783866
900 2881154702
901 2881158463
902 2881164113
903 2881848165
904 2881854718
905 2881862740
906 2882634336
907 2882916553
908 2885308790
909 2885318845
910 2885319176
911 2885333445
912 2885335970
913 2885349511
914 2885357676
915 2888342484
916 2888346263
917 2888351832
918 2889013813
919 2889021493
920 2889793895
921 2889916035
922 2894655416
923 2903449399
924 2903498029
925 2903498206
926 2903526341
927 2903529628
928 2903546692
929 2904579119
930 2904660482
931 2906309143
932 2906326750
933 2906328709
934 2906361732
935 2906365369
936 2906371301
937 2906385315
938 2906387449
939 2906394830
940 2906401586
941 2906411418
942 2906415124
943 2915652877
944 2916079228
945 2919122056
946 2921203980
947 2921204730
948 2922134627
949 2922155318
950 2922160767
951 2922175169
952 2922179539
953 2922190397
954 2924728597
955 2924738466
956 2924745383
957 2924749160
958 2924761624
959 2924767152
960 2924777711
961 2924791196
962 2928522003
963 2937108369
964 2937109030
965 2937813998
966 2937828752
967 2937845227
968 2937850855
969 2937868451
970 2937875350
971 2937883929
972 2937893591
973 2937976680
974 2937984349
975 2938000551
976 2941502801
977 2954014638
978 2958038370
979 2958049284
980 2958055980
981 2958066479
982 2958091207
983 2958101534
984 2958121425
985 2958125049
986 2958131193
987 2958139365
988 2958146766
989 2958160300
990 2958170922
991 2958172956
992 2958180592
993 2961078426
994 2961120804
995 2961137143
996 2961169366
997 2961177031
998 2961185542
999 2963650467
1000 2965023618
1001 2965029057
1002 2965034783
1003 2965047611
1004 2965048714
1005 2965063913
1006 2965095544
1007 2965106884
1008 2965115554
1009 2965122563
1010 2967666915
1011 2967667430
1012 2967741171
1013 2968002843
1014 2968005240
1015 2968021325
1016 2968085640
1017 2968095245
1018 2968101215
1019 2968111541
1020 2968120238
1021 2968128636
1022 2968140288
1023 2968177756
1024 2970088224
1025 2970476430
1026 2970493845
1027 2970509704
1028 2970514426
1029 2970527764
1030 2970537374
1031 2970541773
1032 2970554108
1033 2970560602
1034 2970598888
1035 2970620350
1036 2970630515
1037 2977822139
1038 2977836956
1039 2977845299
1040 2977851590
1041 2977862273
1042 2977875803
1043 2977904481
1044 2977913699
1045 2977917977
1046 2977923831
1047 2977940115
1048 2977949876
1049 2977953486
1050 2977961130
1051 2977978064
1052 2977990012
1053 2979717232
1054 2979746611
1055 2979773892
1056 2979780504
1057 2979795295
1058 2979814491
1059 2987642906
1060 2987649498
1061 2987658533
1062 2987665656
1063 2987671103
1064 2987679944
1065 2996312870
1066 2996337604
1067 2996348015
1068 2996356368
1069 2996387919
1070 3000142405
1071 3002142612
1072 3003935337
1073 3004172329
1074 3004194554
1075 3004210699
1076 3004213269
1077 3004221341
1078 3004237961
1079 3004251059
1080 3004271635
1081 3004282672
1082 3004293434
1083 3004338333
1084 637078465
1085 649872268
1086 8002288336
1087 8004307294
1088 8004362020
1089 8004374778
1090 8004388073
1091 8004446264
1092 8004635718
1093 8004644558
1094 8004713158
1095 8004715400
1096 8004734250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14748

P5CR_dimer

Pyrroline-5-carboxylate reductase dimerisation

189

294

0.98

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

29

125

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tri-assembly1.cif.gz_B structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii 0.9204 1 270
2ag8-assembly1.cif.gz_A nadp complex of pyrroline-5-carboxylate reductase from neisseria meningitidis 0.919 4 269
5bsh-assembly1.cif.gz_D crystal structure of medicago truncatula (delta)1-pyrroline-5-carboxylate reductase (mtp5cr) in complex with l-proline 0.9139 2 268
5bsh-assembly1.cif.gz_G crystal structure of medicago truncatula (delta)1-pyrroline-5-carboxylate reductase (mtp5cr) in complex with l-proline 0.9088 2 268
5bse-assembly1.cif.gz_A crystal structure of medicago truncatula (delta)1-pyrroline-5-carboxylate reductase (mtp5cr) 0.908 2 268
ID Description Score Start End Superfamily
3triA02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9593 171 268 1.10.3730.10
5bsfB02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9589 170 268 1.10.3730.10
5bshF02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9583 170 268 1.10.3730.10
5bshB02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9579 170 268 1.10.3730.10
5bseA02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9575 170 268 1.10.3730.10
ID Description Score Start End GO Terms
AF-A0A436E0X8-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9953 124 270 GO:0004735
GO:0055129
AF-A0A520HN33-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9911 168 268 GO:0004735
GO:0055129
AF-A0A527YSQ5-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9881 34 146 GO:0004735
GO:0055129
AF-A0A5B6U144-F1-model_v4 Pyrroline-5-carboxylate reductase (P5C reductase) (P5CR) (EC 1.5.1.2) (PCA reductase) 0.9863 1 270 GO:0004735
GO:0005737
GO:0055129
AF-A0A530R5A8-F1-model_v4 Pyrroline-5-carboxylate reductase (EC 1.5.1.2) 0.9841 1 245 GO:0004735
GO:0055129

Map