F462292

General Info

Members Datasets Scaffolds Average Seq Length
548 386 1096 338

Family's Representative Sequence

Representative Sequence 3300049776|Ga0501280_003901|Ga0501280_003901_662_1678
Length 332
Sequence MRYFITGTAGFIGFHLARRLLADGHEVTGFDGMTPYYNVKLKHMRHAALAQYPAFEPVIAMLEDRAAVEEAMAKAKPDVVIHLAAQAGVRYSLENPQSYLTSNVTGSYNIIELAERHKVQHLMLASTSSIYGANPTVPFRETDRADEPLTIYAATKKSMEVMAHKTPTTAFRFFTVYGPWGRPDMALFKFVDLMLNDQPIEIYGEGKMSRDFTYIDDLVEAIVRISHVIPDESNRVADEKIETLSRQAPFRLVNIGGGQPENLMDFVKMVEKALGQPAVRQMLPMQKGDVPRTYAAPDLLQALTGYTPSTKLEDGVKAFVDWYLEARRELQG

Samples

Sample ID Description Type Environment
1 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
40 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
48 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
68 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
80 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
81 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
82 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
83 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
84 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
85 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
86 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
87 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
126 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
137 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
138 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
139 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
140 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
141 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
147 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
148 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
149 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
150 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
151 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
152 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
153 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
154 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
155 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
156 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
157 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
158 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
159 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
160 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
161 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
162 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
163 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
164 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
165 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
166 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
167 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
168 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
169 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
170 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
171 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
172 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
173 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
174 2519899620 Rhizobium sp. Pop5 Isolate Nodule
175 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
176 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
177 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
178 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
179 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
180 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
181 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
182 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
183 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
184 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
185 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
186 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
187 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
188 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
189 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
190 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
191 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
192 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
193 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
194 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
195 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
196 2643221599 Rhizobium sp. Root708 Isolate Unclassified
197 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
198 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
199 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
200 2643221688 Rhizobium sp. Root482 Isolate Unclassified
201 2643221719 Rhizobium sp. Root274 Isolate Unclassified
202 2718217882 Rhizobium sp. N741 Isolate Nodule
203 2718217927 Rhizobium sp. N324 Isolate Nodule
204 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
205 2718218009 Rhizobium sp. N561 Isolate Nodule
206 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
207 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
208 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
209 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
210 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
211 2718218363 Rhizobium sp. N113 Isolate Nodule
212 2718218365 Rhizobium sp. N731 Isolate Nodule
213 2718218366 Rhizobium sp. N621 Isolate Nodule
214 2718218423 Rhizobium sp. N941 Isolate Nodule
215 2721755514 Rhizobium sp. N6212 Isolate Nodule
216 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
217 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
218 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
219 2721755809 Rhizobium sp. N541 Isolate Nodule
220 2721755810 Rhizobium sp. N871 Isolate Nodule
221 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
222 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
223 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
224 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
225 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
226 2728369365 Rhizobium sp. N1341 Isolate Nodule
227 2728369397 Rhizobium sp. N1314 Isolate Nodule
228 2738541293 Rhizobium sp. GV031 Isolate Unclassified
229 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
230 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
231 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
232 2791355256 Rhizobium sp. M10 Isolate Nodule
233 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
234 2791355261 Rhizobium sp. J15 Isolate Nodule
235 2791355262 Rhizobium sp. M1 Isolate Nodule
236 2791355263 Rhizobium chutanense C5 Isolate Nodule
237 2791355264 Rhizobium sp. S9 Isolate Nodule
238 2791355265 Rhizobium sp. H4 Isolate Nodule
239 2791355266 Rhizobium sp. L43 Isolate Nodule
240 2791355267 Rhizobium sp. L18 Isolate Nodule
241 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
242 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
243 2802429633 Rhizobium anhuiense J3 Isolate Nodule
244 2802429634 Rhizobium anhuiense S10 Isolate Nodule
245 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
246 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
247 2802429637 Rhizobium anhuiense C15 Isolate Nodule
248 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
249 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
250 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
251 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
252 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
253 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
254 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
255 2838048938 Rhizobium pisi 27/80 Isolate Nodule
256 2838061910 Rhizobium phaseoli L15 Isolate Nodule
257 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
258 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
259 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
260 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
261 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
262 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
263 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
264 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
265 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
266 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
267 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
268 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
269 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
270 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
271 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
272 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
273 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
274 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
275 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
276 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
277 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
278 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
279 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
280 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
281 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
282 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
283 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
284 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
285 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
286 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
287 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
288 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
289 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
290 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
291 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
292 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
293 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
294 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
295 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
296 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
297 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
298 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
299 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
300 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
301 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
302 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
303 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
304 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
305 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
306 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
307 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
308 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
309 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
310 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
311 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
312 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
313 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
314 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
315 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
316 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
317 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
318 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
319 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
320 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
321 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
322 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
323 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
324 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
325 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
326 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
327 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
328 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
329 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
330 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
331 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
332 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
333 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
334 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
335 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
336 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
337 2933599457 Rhizobium phaseoli M3 Isolate Nodule
338 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
339 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
340 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
341 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
342 2936381700 Rhizobium chutanense C16 Isolate Unclassified
343 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
344 2996887358 Rhizobium sp. R711 Isolate Nodule
345 2996893221 Rhizobium sp. R635 Isolate Nodule
346 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
347 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
348 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
349 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
350 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
351 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
352 8005258706 Rhizobium sp. R693 Isolate Nodule
353 8005275841 Rhizobium sp. N4311 Isolate Nodule
354 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
355 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
356 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
357 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
358 8005321885 Rhizobium sp. R72 Isolate Nodule
359 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
360 8005382845 Rhizobium sp. R634 Isolate Nodule
361 8005395548 Rhizobium sp. R339 Isolate Nodule
362 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
363 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
364 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
365 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
366 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
367 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
368 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
369 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
370 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
371 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
372 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
373 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
374 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
375 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
376 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
377 8018176218 Rhizobium sp. N122 Isolate Nodule
378 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
379 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
380 8024501048 Rhizobium sp. H4 Isolate Nodule
381 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
382 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
383 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
384 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
385 8056382006 Rhizobium croatiense 13T Isolate Nodule
386 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.01
Metatranscriptomes 0
Isolates 47.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.74
Nodule 38.14
Rhizoplane 1.46
Rhizosphere 18.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501280_003901 3300049776 Bacteria 2239
2 JGI25158J39367_1000964 3300002739 Bacteria 5305
3 JGI25152J39213_1000435 3300002773 Bacteria 25061
4 JGI25152J39213_1000531 3300002773 Bacteria 21074
5 JGI25152J39213_1001168 3300002773 Bacteria 12131
6 JGI25152J39213_1001607 3300002773 Bacteria 9467
7 JGI25152J39213_1002082 3300002773 Bacteria 7861
8 JGI25152J39213_1005450 3300002773 Bacteria 3705
9 JGI25152J39213_1006359 3300002773 Bacteria 3240
10 JGI25150J39212_1000024 3300002774 Bacteria 129646
11 JGI25150J39212_1005606 3300002774 Bacteria 2664
12 JGI25159J45721_1000044 3300002987 Bacteria 60564
13 JGI25151J46595_10000027 3300003187 Bacteria 208739
14 JGI25151J46595_10000634 3300003187 Bacteria 30281
15 JGI25151J46595_10008979 3300003187 Bacteria 4765
16 JGI25151J46595_10015608 3300003187 Bacteria 3342
17 JGI25153J46596_10000495 3300003215 Bacteria 25061
18 JGI25153J46596_10000517 3300003215 Bacteria 24352
19 JGI25153J46596_10001188 3300003215 Bacteria 15732
20 JGI25153J46596_10001983 3300003215 Bacteria 12131
21 JGI25153J46596_10016729 3300003215 Bacteria 2922
22 JGI25153J46596_10021590 3300003215 Bacteria 2395
23 JGI25153J46596_10024969 3300003215 Bacteria 2144
24 JGI25160J50197_1000206 3300003354 Bacteria 49083
25 JGI25160J50197_1002748 3300003354 Bacteria 8069
26 JGI25160J50197_1006928 3300003354 Bacteria 4510
27 JGI25161J50226_1000387 3300003374 Bacteria 22204
28 Ga0055526_1006113 3300003771 Bacteria 6641
29 Ga0055526_1009236 3300003771 Bacteria 4783
30 Ga0055526_1015301 3300003771 Bacteria 3088
31 Ga0055524_1004300 3300003775 Bacteria 6604
32 Ga0055524_1009860 3300003775 Bacteria 3846
33 Ga0055524_1011132 3300003775 Bacteria 3536
34 Ga0055524_1012487 3300003775 Bacteria 3257
35 Ga0055524_1019911 3300003775 Bacteria 2278
36 Ga0055524_1022037 3300003775 Bacteria 2093
37 Ga0055528_1000247 3300003790 Bacteria 45698
38 Ga0055528_1001182 3300003790 Bacteria 16852
39 Ga0055528_1001629 3300003790 Bacteria 13235
40 Ga0055528_1003027 3300003790 Bacteria 8660
41 Ga0055528_1005020 3300003790 Bacteria 6248
42 Ga0055528_1011401 3300003790 Bacteria 3534
43 Ga0055528_1011907 3300003790 Bacteria 3413
44 Ga0055528_1022224 3300003790 Bacteria 1982
45 Ga0055528_1023012 3300003790 Bacteria 1917
46 Ga0055540_1000830 3300003792 Bacteria 20773
47 Ga0055540_1004081 3300003792 Bacteria 6767
48 Ga0055540_1007535 3300003792 Bacteria 4083
49 Ga0058692_1000330 3300003856 Bacteria 23529
50 Ga0055543_1000056 3300004625 Bacteria 103704
51 Ga0055543_1002217 3300004625 Bacteria 6634
52 Ga0065165_1017136 3300005262 Bacteria 2683
53 Ga0065165_1022055 3300005262 Bacteria 2194
54 Ga0065165_1024015 3300005262 Bacteria 2056
55 Ga0070680_100044531 3300005336 Bacteria 3606
56 Ga0070688_100033982 3300005365 Bacteria 3085
57 Ga0070659_100046275 3300005366 Bacteria 3410
58 Ga0070667_100249939 3300005367 Bacteria 1585
59 Ga0070663_100078994 3300005455 Bacteria 2413
60 Ga0070663_100093951 3300005455 Bacteria 2226
61 Ga0070681_10017220 3300005458 Bacteria 7225
62 Ga0070679_100010793 3300005530 Bacteria 8674
63 Ga0068853_100007906 3300005539 Bacteria 8528
64 Ga0081455_10080712 3300005937 Bacteria 2666
65 Ga0075365_10000289 3300006038 Bacteria 17410
66 Ga0075365_10000666 3300006038 Bacteria 13739
67 Ga0075365_10019983 3300006038 Bacteria 4145
68 Ga0075363_100052365 3300006048 Bacteria 2179
69 Ga0075362_10000179 3300006177 Bacteria 17463
70 Ga0075362_10008978 3300006177 Bacteria 3845
71 Ga0075367_10000694 3300006178 Bacteria 12957
72 Ga0075367_10000950 3300006178 Bacteria 11792
73 Ga0075369_10000690 3300006186 Bacteria 10819
74 Ga0075369_10007923 3300006186 Bacteria 4070
75 Ga0075366_10043506 3300006195 Bacteria 2660
76 Ga0075370_10045692 3300006353 Bacteria 2477
77 Ga0075370_10082030 3300006353 Bacteria 1854
78 Ga0105251_10029812 3300009011 Bacteria 2745
79 Ga0105243_10255584 3300009148 Bacteria 1566
80 Ga0105241_10187784 3300009174 Bacteria 1718
81 Ga0105248_10039240 3300009177 Bacteria 5303
82 Ga0105237_10129635 3300009545 Bacteria 2517
83 Ga0105237_10449846 3300009545 Bacteria 1294
84 Ga0105249_10050450 3300009553 Bacteria 3793
85 Ga0123341_1000219 3300009765 Bacteria 29972
86 Ga0123341_1001576 3300009765 Bacteria 17486
87 Ga0123342_1016311 3300009766 Bacteria 6493
88 Ga0123342_1025878 3300009766 Bacteria 3479
89 Ga0105239_10281323 3300010375 Bacteria 1873
90 Ga0157373_10009198 3300013100 Bacteria 7307
91 Ga0157373_10084770 3300013100 Bacteria 2233
92 Ga0157370_10005531 3300013104 Bacteria 14164
93 Ga0157372_10012472 3300013307 Bacteria 9059
94 Ga0213876_10055529 3300021384 Bacteria 2091
95 Ga0209436_100008 3300025208 Bacteria 145772
96 Ga0207425_1000043 3300025245 Bacteria 208791
97 Ga0207425_1000542 3300025245 Bacteria 22633
98 Ga0207425_1001081 3300025245 Bacteria 12401
99 Ga0207425_1001177 3300025245 Bacteria 11657
100 Ga0207425_1024093 3300025245 Bacteria 1268
101 Ga0209129_1000072 3300025258 Bacteria 208805
102 Ga0209129_1000226 3300025258 Bacteria 63537
103 Ga0209129_1000259 3300025258 Bacteria 53817
104 Ga0209129_1000268 3300025258 Bacteria 51242
105 Ga0209129_1000456 3300025258 Bacteria 30258
106 Ga0209129_1001403 3300025258 Bacteria 13475
107 Ga0209129_1002070 3300025258 Bacteria 10341
108 Ga0209129_1002289 3300025258 Bacteria 9541
109 Ga0209673_1000025 3300025273 Bacteria 404572
110 Ga0209673_1000125 3300025273 Bacteria 168465
111 Ga0209673_1000256 3300025273 Bacteria 100514
112 Ga0209673_1001826 3300025273 Bacteria 17422
113 Ga0209673_1003372 3300025273 Bacteria 9504
114 Ga0209673_1003534 3300025273 Bacteria 9142
115 Ga0209673_1004865 3300025273 Bacteria 7013
116 Ga0209673_1005424 3300025273 Bacteria 6412
117 Ga0209673_1006302 3300025273 Bacteria 5762
118 Ga0209673_1035744 3300025273 Bacteria 1483
119 Ga0209130_1000019 3300025284 Bacteria 381993
120 Ga0209130_1003677 3300025284 Bacteria 6335
121 Ga0209676_1004071 3300025292 Bacteria 8391
122 Ga0209025_1000120 3300025294 Bacteria 208791
123 Ga0209025_1000386 3300025294 Bacteria 91377
124 Ga0209025_1001755 3300025294 Bacteria 25992
125 Ga0209025_1002496 3300025294 Bacteria 19310
126 Ga0209025_1012706 3300025294 Bacteria 5368
127 Ga0209564_1000259 3300025295 Bacteria 112570
128 Ga0209564_1000488 3300025295 Bacteria 65982
129 Ga0209564_1002700 3300025295 Bacteria 13404
130 Ga0209564_1003408 3300025295 Bacteria 10928
131 Ga0209564_1008925 3300025295 Bacteria 4863
132 Ga0209564_1028131 3300025295 Bacteria 1806
133 Ga0209758_1000111 3300025297 Bacteria 208790
134 Ga0209758_1000151 3300025297 Bacteria 162732
135 Ga0209758_1000254 3300025297 Bacteria 107330
136 Ga0209758_1000512 3300025297 Bacteria 62287
137 Ga0209758_1000699 3300025297 Bacteria 49788
138 Ga0209758_1002960 3300025297 Bacteria 16294
139 Ga0209758_1003401 3300025297 Bacteria 14535
140 Ga0209758_1004233 3300025297 Bacteria 12147
141 Ga0209758_1032542 3300025297 Bacteria 2114
142 Ga0209256_1000619 3300025299 Bacteria 49078
143 Ga0209256_1001144 3300025299 Bacteria 30100
144 Ga0209256_1002819 3300025299 Bacteria 13286
145 Ga0209256_1004407 3300025299 Bacteria 8866
146 Ga0209256_1004514 3300025299 Bacteria 8689
147 Ga0209256_1012487 3300025299 Bacteria 3244
148 Ga0209256_1013242 3300025299 Bacteria 3074
149 Ga0209256_1013925 3300025299 Bacteria 2942
150 Ga0207426_1000005 3300025302 Bacteria 1037188
151 Ga0207426_1000208 3300025302 Bacteria 140385
152 Ga0207426_1003122 3300025302 Bacteria 9445
153 Ga0209051_1000176 3300025303 Bacteria 115875
154 Ga0209051_1000704 3300025303 Bacteria 36587
155 Ga0209051_1000756 3300025303 Bacteria 34622
156 Ga0209051_1002940 3300025303 Bacteria 11653
157 Ga0209051_1005181 3300025303 Bacteria 7720
158 Ga0209051_1015054 3300025303 Bacteria 3578
159 Ga0209051_1021290 3300025303 Bacteria 2765
160 Ga0209257_1001801 3300025304 Bacteria 23510
161 Ga0209257_1010040 3300025304 Bacteria 4900
162 Ga0207654_10139775 3300025911 Bacteria 1543
163 Ga0207707_10012096 3300025912 Bacteria 7505
164 Ga0207652_10023265 3300025921 Bacteria 5132
165 Ga0207690_10057400 3300025932 Bacteria 2630
166 Ga0207670_10003793 3300025936 Bacteria 8036
167 Ga0207712_10199525 3300025961 Bacteria 1585
168 Ga0207668_10093278 3300025972 Bacteria 2218
169 Ga0207639_10278084 3300026041 Bacteria 1471
170 Ga0209281_1000043 3300027111 Bacteria 341543
171 Ga0209371_1000035 3300027312 Bacteria 368979
172 Ga0307515_10000029 3300028794 Bacteria 365410
173 Ga0307515_10000950 3300028794 Bacteria 66308
174 Ga0307515_10099506 3300028794 Bacteria 3530
175 Ga0268256_1000037 3300030500 Bacteria 367024
176 Ga0265340_10002231 3300031247 Bacteria 11077
177 Ga0265313_10057827 3300031595 Bacteria 1829
178 Ga0307516_10120116 3300031730 Bacteria 2420
179 Ga0307405_10017586 3300031731 Bacteria 3927
180 Ga0307413_10382002 3300031824 Bacteria 1098
181 Ga0307406_10015184 3300031901 Bacteria 4451
182 Ga0307412_10004632 3300031911 Bacteria 7665
183 Ga0307412_10324870 3300031911 Bacteria 1226
184 Ga0436365_0384385 3300039437 Bacteria 4252
185 Ga0439465_0030553 3300041413 Bacteria 1714
186 Ga0451789_0804863 3300041443 Bacteria 1266
187 Ga0451833_0402211 3300041491 Bacteria 3050
188 Ga0451835_0985294 3300041492 Bacteria 1797
189 Ga0451839_0665625 3300041496 Bacteria 22196
190 Ga0451841_0720592 3300041498 Bacteria 4982
191 Ga0451851_0667719 3300041507 Bacteria 3358
192 Ga0451855_0312244 3300041511 Bacteria 1393
193 Ga0439432_041678 3300042006 Bacteria 1453
194 Ga0453684_0131042 3300044712 Bacteria 3008
195 Ga0466968_0013503 3300044735 Bacteria 3212
196 Ga0466960_0197039 3300044901 Bacteria 1099
197 Ga0495638_0004884 3300046460 Bacteria 10085
198 Ga0495638_0144464 3300046460 Bacteria 1385
199 Ga0495605_0000998 3300046474 Bacteria 19122
200 Ga0495585_0016986 3300046492 Bacteria 4213
201 Ga0495585_0057231 3300046492 Bacteria 2152
202 Ga0495607_0038685 3300046501 Bacteria 2856
203 Ga0495583_0003578 3300046506 Bacteria 11679
204 Ga0495606_0076456 3300046507 Bacteria 2093
205 Ga0495610_0022845 3300046512 Bacteria 3411
206 Ga0495616_0012156 3300046513 Bacteria 4899
207 Ga0495620_0037858 3300046515 Bacteria 2144
208 Ga0495631_0002952 3300046518 Bacteria 9418
209 Ga0495631_0105600 3300046518 Bacteria 1211
210 Ga0495632_0004532 3300046519 Bacteria 9420
211 Ga0495632_0007430 3300046519 Bacteria 6881
212 Ga0495632_0112062 3300046519 Bacteria 1280
213 Ga0495643_0007005 3300046522 Bacteria 7325
214 Ga0495643_0050384 3300046522 Bacteria 2243
215 Ga0495643_0095834 3300046522 Bacteria 1526
216 Ga0495654_0038468 3300046530 Bacteria 2392
217 Ga0495609_0016298 3300046538 Bacteria 3462
218 Ga0495668_0002457 3300046616 Bacteria 15250
219 Ga0495625_0006387 3300046660 Bacteria 10511
220 Ga0495625_0014976 3300046660 Bacteria 6161
221 Ga0495588_0057133 3300046674 Bacteria 2016
222 Ga0495670_0047796 3300046691 Bacteria 2139
223 Ga0495636_0034072 3300047318 Bacteria 2095
224 Ga0495672_0055625 3300047320 Bacteria 2308
225 Ga0495686_0012523 3300047472 Bacteria 5930
226 Ga0495686_0083228 3300047472 Bacteria 1952
227 Ga0496106_0000712 3300048909 Bacteria 23955
228 Ga0496110_0038763 3300048913 Bacteria 4148
229 Ga0496111_0011505 3300048914 Bacteria 5964
230 Ga0496114_0176233 3300048917 Bacteria 1866
231 Ga0496116_0012509 3300048919 Bacteria 6928
232 Ga0496116_0030814 3300048919 Bacteria 3848
233 Ga0496117_0011023 3300048920 Bacteria 8139
234 Ga0496117_0014595 3300048920 Bacteria 6759
235 Ga0496117_0119127 3300048920 Bacteria 1626
236 Ga0496118_0001964 3300048921 Bacteria 29165
237 Ga0496118_0017115 3300048921 Bacteria 6617
238 Ga0496118_0032643 3300048921 Bacteria 4283
239 Ga0496121_0002534 3300048924 Bacteria 27692
240 Ga0496121_0005312 3300048924 Bacteria 16568
241 Ga0496121_0026378 3300048924 Bacteria 5478
242 Ga0496122_0000018 3300048925 Bacteria 426350
243 Ga0496122_0002366 3300048925 Bacteria 27019
244 Ga0496122_0015622 3300048925 Bacteria 7243
245 Ga0496122_0023853 3300048925 Bacteria 5373
246 Ga0496122_0027288 3300048925 Bacteria 4886
247 Ga0496122_0032667 3300048925 Bacteria 4298
248 Ga0496123_0000015 3300048926 Bacteria 426088
249 Ga0496123_0006417 3300048926 Bacteria 11402
250 Ga0496123_0018257 3300048926 Bacteria 5586
251 Ga0496123_0054339 3300048926 Bacteria 2638
252 Ga0496123_0099160 3300048926 Bacteria 1701
253 Ga0496124_0001771 3300048927 Bacteria 30049
254 Ga0496124_0006219 3300048927 Bacteria 13078
255 Ga0496124_0065532 3300048927 Bacteria 3028
256 Ga0496125_0022372 3300048928 Bacteria 5872
257 Ga0496125_0109792 3300048928 Bacteria 2002
258 Ga0496126_0051115 3300048929 Bacteria 3764
259 Ga0495678_055040 3300049459 Bacteria 1520
260 Ga0495678_056280 3300049459 Bacteria 1496
261 Ga0495682_0040134 3300049460 Bacteria 1717
262 Ga0501036_0333448 3300049572 Bacteria 1267
263 Ga0501038_0171301 3300049574 Bacteria 1757
264 Ga0501077_0207559 3300049593 Bacteria 1245
265 Ga0501083_0156692 3300049744 Bacteria 1490
266 nmdc:mga03n38_12331_c1 3300050490 Bacteria 3213
267 nmdc:mga0yw44_55429_c1 3300050492 Bacteria 2412
268 nmdc:mga0k408_77506_c1 3300050493 Bacteria 1944
269 nmdc:mga06z11_106801_c1 3300050494 Bacteria 1544
270 nmdc:mga07m45_1626_c1 3300050496 Bacteria 10337
271 Ga0500651_0102774 3300053093 Bacteria 1751
272 Ga0500557_000228 3300053105 Bacteria 8621
273 Ga0500594_0000601 3300053118 Bacteria 7716
274 Ga0500594_0004766 3300053118 Bacteria 2996
275 Ga0500608_017376 3300053122 Bacteria 3267
276 Ga0500618_000850 3300053125 Bacteria 16412
277 Ga0500658_0000390 3300053134 Bacteria 19207
278 Ga0500559_0002464 3300053136 Bacteria 9563
279 Ga0500568_0000217 3300053139 Bacteria 49245
280 Ga0500606_078153 3300053152 Bacteria 1120
281 Ga0500616_0000437 3300053153 Bacteria 55094
282 Ga0500616_0015565 3300053153 Bacteria 4345
283 Ga0500616_0028712 3300053153 Bacteria 3064
284 Ga0500622_0000092 3300053156 Bacteria 92830
285 Ga0500627_0018549 3300053158 Bacteria 2756
286 2509390199 2509276021 Bacteria 7634384
287 2509447509 2509276033 Bacteria 7180565
288 2510134335 2510065019 Bacteria 6903379
289 2510895767 2510461076 Bacteria 8618824
290 2511170077 2510917026 Bacteria 7046020
291 2511186189 2510917028 Bacteria 6185411
292 2511197026 2510917030 Bacteria 7460662
293 2513567544 2513237084 Bacteria 7231967
294 2513577883 2513237085 Bacteria 7695351
295 2513589016 2513237087 Bacteria 5817514
296 2513601002 2513237088 Bacteria 6927906
297 2513631973 2513237093 Bacteria 7545552
298 2513708007 2513237103 Bacteria 7647401
299 2513869753 2513237138 Bacteria 7368160
300 2513910562 2513237144 Bacteria 7530820
301 2513928004 2513237146 Bacteria 7166346
302 2514017922 2513237162 Bacteria 7468464
303 2515113506 2515075009 Bacteria 7288508
304 2515635217 2515154113 Bacteria 7807172
305 2515643873 2515154114 Bacteria 7848616
306 2515654963 2515154116 Bacteria 7552979
307 2515739857 2515154134 Bacteria 7220242
308 2517037112 2516653077 Bacteria 7555578
309 2517077456 2516653085 Bacteria 7346596
310 2517096223 2517093000 Bacteria 7412387
311 2517408082 2517287029 Bacteria 6905599
312 2520378363 2519899620 Bacteria 6499161
313 2523468601 2523231067 Bacteria 5230452
314 2523470644 2523231067 Bacteria 5230452
315 2530646413 2529292951 Bacteria 6916614
316 2535517313 2534681796 Bacteria 7146037
317 2537875756 2537561587 Bacteria 5425293
318 2561467966 2558860983 Bacteria 4133860
319 2585227490 2582581298 Bacteria 7315509
320 2585230756 2582581299 Bacteria 6518058
321 2585259286 2582581304 Bacteria 5831370
322 2585336437 2582581316 Bacteria 7774528
323 2585402858 2582581867 Bacteria 7184437
324 2585524883 2585427526 Bacteria 7258840
325 2585538571 2585427528 Bacteria 6842387
326 2585550934 2585427529 Bacteria 7395659
327 2585823480 2585427590 Bacteria 6824633
328 2585836522 2585427593 Bacteria 7141551
329 2585847502 2585427594 Bacteria 6180594
330 2585998417 2585427633 Bacteria 6413184
331 2586002979 2585427634 Bacteria 6455027
332 2599421015 2599185170 Bacteria 7295545
333 2599718648 2599185236 Bacteria 6875203
334 2600376750 2600254933 Bacteria 4750527
335 2644002998 2643221599 Bacteria 6292121
336 2644194314 2643221634 Bacteria 6705461
337 2644237977 2643221643 Bacteria 5749658
338 2644296697 2643221653 Bacteria 4569637
339 2644495897 2643221688 Bacteria 5260751
340 2644654951 2643221719 Bacteria 4568197
341 2719182229 2718217882 Bacteria 6556348
342 2719386809 2718217927 Bacteria 6972593
343 2719666547 2718217997 Bacteria 6740740
344 2719732945 2718218009 Bacteria 6478651
345 2720492967 2718218199 Bacteria 6740745
346 2720614446 2718218232 Bacteria 6720332
347 2720617831 2718218233 Bacteria 6662049
348 2720621222 2718218233 Bacteria 6662049
349 2720632548 2718218235 Bacteria 6630699
350 2720776270 2718218269 Bacteria 6906114
351 2721148320 2718218363 Bacteria 6524337
352 2721159728 2718218365 Bacteria 6274507
353 2721165156 2718218366 Bacteria 6425255
354 2721400532 2718218423 Bacteria 6438183
355 2722841326 2721755514 Bacteria 6424414
356 2723027862 2721755556 Bacteria 6745503
357 2723561490 2721755684 Bacteria 6859907
358 2723568120 2721755685 Bacteria 6704835
359 2724039345 2721755809 Bacteria 6438790
360 2724045701 2721755810 Bacteria 6479005
361 2724090877 2721755819 Bacteria 6906405
362 2724105385 2721755822 Bacteria 6726041
363 2724111205 2721755823 Bacteria 6752556
364 2725950265 2724679232 Bacteria 7646494
365 2730108798 2728369352 Bacteria 6745171
366 2730165464 2728369365 Bacteria 6555560
367 2730299360 2728369397 Bacteria 6274511
368 2738803288 2738541293 Bacteria 7065685
369 2739033210 2738541333 Bacteria 7106503
370 2766066253 2765235942 Bacteria 7445910
371 2792584121 2791355082 Bacteria 5973319
372 2793294045 2791355256 Bacteria 6798008
373 2793314280 2791355259 Bacteria 7254731
374 2793328827 2791355261 Bacteria 6661293
375 2793334805 2791355262 Bacteria 6774204
376 2793342944 2791355263 Bacteria 6872478
377 2793346868 2791355264 Bacteria 6429314
378 2793351407 2791355265 Bacteria 6539969
379 2793356529 2791355265 Bacteria 6539969
380 2793362383 2791355266 Bacteria 7116587
381 2793367505 2791355267 Bacteria 7222458
382 2805926686 2802429605 Bacteria 6875453
383 2805932594 2802429606 Bacteria 6346811
384 2806049747 2802429633 Bacteria 7341974
385 2806056654 2802429634 Bacteria 7083200
386 2806064059 2802429635 Bacteria 7650140
387 2806064073 2802429636 Bacteria 7597525
388 2806070858 2802429636 Bacteria 7597525
389 2806078085 2802429637 Bacteria 7067217
390 2819242393 2818991272 Bacteria 4622173
391 2819561444 2818991439 Bacteria 6907412
392 2821123201 2821123053 Bacteria 7836056
393 2838019963 2838016132 Bacteria 6577831
394 2838023462 2838022645 Bacteria 6494267
395 2838041375 2838035591 Bacteria 7166484
396 2838045583 2838042994 Bacteria 6046894
397 2838052773 2838048938 Bacteria 6044578
398 2838065029 2838061910 Bacteria 6794874
399 2838069753 2838068647 Bacteria 6208656
400 2838665767 2838661181 Bacteria 7385261
401 2838671740 2838668709 Bacteria 6671819
402 2838679402 2838675328 Bacteria 4909118
403 2838683055 2838680041 Bacteria 6545511
404 2838686309 2838680041 Bacteria 6545511
405 2838686667 2838686498 Bacteria 7807632
406 2838698001 2838694306 Bacteria 6853137
407 2838700727 2838694306 Bacteria 6853137
408 2838704419 2838701080 Bacteria 6669771
409 2838711116 2838707686 Bacteria 6619912
410 2838714114 2838707686 Bacteria 6619912
411 2838718759 2838714209 Bacteria 5525906
412 2838723757 2838719591 Bacteria 5523910
413 2838729080 2838724970 Bacteria 4908691
414 2838734909 2838729681 Bacteria 7400765
415 2838739776 2838736955 Bacteria 5760694
416 2838747524 2838742623 Bacteria 7396178
417 2841844100 2841840854 Bacteria 5761912
418 2841854496 2841851746 Bacteria 7532261
419 2841867362 2841864319 Bacteria 6742987
420 2842079291 2842077413 Bacteria 6508645
421 2842083416 2842077413 Bacteria 6508645
422 2842115603 2842110456 Bacteria 7656360
423 2842118198 2842118031 Bacteria 7033875
424 2842124377 2842118031 Bacteria 7033875
425 2842134479 2842130223 Bacteria 4909145
426 2842143821 2842140634 Bacteria 5759631
427 2842149637 2842146304 Bacteria 5957337
428 2842156475 2842152218 Bacteria 4908957
429 2842158485 2842156927 Bacteria 6894975
430 2842169071 2842163707 Bacteria 6916235
431 2842175004 2842170452 Bacteria 5525737
432 2842179921 2842175837 Bacteria 4908771
433 2842182099 2842180545 Bacteria 6888678
434 2842191661 2842187318 Bacteria 5524014
435 2842192922 2842192696 Bacteria 6147454
436 2842195659 2842192696 Bacteria 6147454
437 2842198976 2842198810 Bacteria 6608673
438 2842209424 2842205361 Bacteria 6340321
439 2842215978 2842211629 Bacteria 5523832
440 2842218336 2842217011 Bacteria 7497767
441 2842228522 2842224351 Bacteria 5524473
442 2842229901 2842229732 Bacteria 7475766
443 2842240112 2842237096 Bacteria 6620661
444 2842243527 2842237096 Bacteria 6620661
445 2842243790 2842243621 Bacteria 7421798
446 2842254196 2842250916 Bacteria 6579627
447 2842258125 2842257432 Bacteria 7401195
448 2842267682 2842264693 Bacteria 6472963
449 2842271795 2842271015 Bacteria 7807131
450 2842282878 2842278818 Bacteria 6340002
451 2842285217 2842285085 Bacteria 6011953
452 2842292953 2842291075 Bacteria 7076806
453 2842297596 2842291075 Bacteria 7076806
454 2842305406 2842304105 Bacteria 7023636
455 2842306458 2842304105 Bacteria 7023636
456 2842310764 2842304105 Bacteria 7023636
457 2842314131 2842311132 Bacteria 6616990
458 2842316251 2842311132 Bacteria 6616990
459 2842319935 2842317721 Bacteria 6793725
460 2842347668 2842341865 Bacteria 7003929
461 2842368680 2842363717 Bacteria 6844742
462 2842373685 2842370503 Bacteria 7038661
463 2842376868 2842370503 Bacteria 7038661
464 2842379350 2842377471 Bacteria 7140707
465 2842384103 2842377471 Bacteria 7140707
466 2842384709 2842384541 Bacteria 7057858
467 2842391149 2842384541 Bacteria 7057858
468 2842400613 2842395702 Bacteria 6780583
469 2842402575 2842402390 Bacteria 6681310
470 2842410054 2842409023 Bacteria 6687331
471 2842416702 2842415677 Bacteria 6596907
472 2842423367 2842422224 Bacteria 6239196
473 2842430326 2842428310 Bacteria 6767288
474 2842436862 2842434925 Bacteria 6502746
475 2842443296 2842441272 Bacteria 6769273
476 2842449161 2842447887 Bacteria 6754142
477 2842449606 2842447887 Bacteria 6754142
478 2842467198 2842462802 Bacteria 6588055
479 2842471268 2842469257 Bacteria 6752936
480 2842493523 2842489311 Bacteria 6620893
481 2842497675 2842495871 Bacteria 6820686
482 2844457965 2844454524 Bacteria 7952546
483 2854900869 2854896431 Bacteria 5869725
484 2854918897 2854916844 Bacteria 5725939
485 2857517040 2857516855 Bacteria 7787325
486 2857533847 2857531043 Bacteria 6754041
487 2899808711 2899803654 Bacteria 5577784
488 2919108277 2919100787 Bacteria 7710546
489 2919172491 2919171160 Bacteria 6499771
490 2923562014 2923556063 Bacteria 6793593
491 2933011249 2933006813 Bacteria 4912075
492 2933571213 2933570622 Bacteria 7023390
493 2933573527 2933570622 Bacteria 7023390
494 2933577258 2933570622 Bacteria 7023390
495 2933592018 2933586486 Bacteria 7667493
496 2933600560 2933599457 Bacteria 5858799
497 2935896615 2935894831 Bacteria 6620579
498 2935901057 2935894831 Bacteria 6620579
499 2935901513 2935901341 Bacteria 7341747
500 2936371655 2936367885 Bacteria 7324495
501 2936378838 2936375103 Bacteria 6652732
502 2936383383 2936381700 Bacteria 7006523
503 2989778326 2989776772 Bacteria 4843317
504 2996892612 2996887358 Bacteria 5795980
505 2996898018 2996893221 Bacteria 5823108
506 3003670961 3003665799 Bacteria 7279786
507 3003934600 3003930520 Bacteria 5667563
508 3005409319 3005409236 Bacteria 7188837
509 3005451791 3005445848 Bacteria 6906074
510 3005455137 3005452660 Bacteria 5889319
511 639649552 639633055 Bacteria 7751309
512 8005264761 8005258706 Bacteria 6184835
513 8005281619 8005275841 Bacteria 6929066
514 8005284417 8005282627 Bacteria 6675747
515 8005289676 8005289223 Bacteria 6634003
516 8005303530 8005301065 Bacteria 6614431
517 8005314041 8005307578 Bacteria 7395396
518 8005327139 8005321885 Bacteria 5795980
519 8005381312 8005376324 Bacteria 6590079
520 8005384677 8005382845 Bacteria 6732062
521 8005395705 8005395548 Bacteria 6806915
522 8005433434 8005430974 Bacteria 6689030
523 8005464190 8005460587 Bacteria 7157962
524 8005501294 8005497431 Bacteria 6477605
525 8005502154 8005497431 Bacteria 6477605
526 8005546137 8005542996 Bacteria 7077758
527 8005561603 8005556819 Bacteria 6908598
528 8005568378 8005563573 Bacteria 7153261
529 8005573081 8005570704 Bacteria 6957481
530 8005622654 8005619151 Bacteria 7030230
531 8005630174 8005626139 Bacteria 6534237
532 8005672713 8005668836 Bacteria 6953162
533 8005673577 8005668836 Bacteria 6953162
534 8005691693 8005688590 Bacteria 6610080
535 8005696825 8005695170 Bacteria 6912330
536 8018127536 8018127388 Bacteria 7351159
537 8018152422 8018150411 Bacteria 5549903
538 8018164182 8018163183 Bacteria 7277977
539 8018179584 8018176218 Bacteria 6896178
540 8023682788 8023680758 Bacteria 7729763
541 8024486142 8024479707 Bacteria 6954785
542 8024501221 8024501048 Bacteria 6427847
543 8049293879 8049293176 Bacteria 6128433
544 8054562369 8054558443 Bacteria 5204801
545 8055434900 8055431914 Bacteria 4551896
546 8056376987 8056375014 Bacteria 7006639
547 8056387307 8056382006 Bacteria 6408074
548 8057881959 8057874678 Bacteria 7494653
549 Ga0501280_003901
550 JGI25158J39367_1000964
551 JGI25152J39213_1000435
552 JGI25152J39213_1000531
553 JGI25152J39213_1001168
554 JGI25152J39213_1001607
555 JGI25152J39213_1002082
556 JGI25152J39213_1005450
557 JGI25152J39213_1006359
558 JGI25150J39212_1000024
559 JGI25150J39212_1005606
560 JGI25159J45721_1000044
561 JGI25151J46595_10000027
562 JGI25151J46595_10000634
563 JGI25151J46595_10008979
564 JGI25151J46595_10015608
565 JGI25153J46596_10000495
566 JGI25153J46596_10000517
567 JGI25153J46596_10001188
568 JGI25153J46596_10001983
569 JGI25153J46596_10016729
570 JGI25153J46596_10021590
571 JGI25153J46596_10024969
572 JGI25160J50197_1000206
573 JGI25160J50197_1002748
574 JGI25160J50197_1006928
575 JGI25161J50226_1000387
576 Ga0055526_1006113
577 Ga0055526_1009236
578 Ga0055526_1015301
579 Ga0055524_1004300
580 Ga0055524_1009860
581 Ga0055524_1011132
582 Ga0055524_1012487
583 Ga0055524_1019911
584 Ga0055524_1022037
585 Ga0055528_1000247
586 Ga0055528_1001182
587 Ga0055528_1001629
588 Ga0055528_1003027
589 Ga0055528_1005020
590 Ga0055528_1011401
591 Ga0055528_1011907
592 Ga0055528_1022224
593 Ga0055528_1023012
594 Ga0055540_1000830
595 Ga0055540_1004081
596 Ga0055540_1007535
597 Ga0058692_1000330
598 Ga0055543_1000056
599 Ga0055543_1002217
600 Ga0065165_1017136
601 Ga0065165_1022055
602 Ga0065165_1024015
603 Ga0070680_100044531
604 Ga0070688_100033982
605 Ga0070659_100046275
606 Ga0070667_100249939
607 Ga0070663_100078994
608 Ga0070663_100093951
609 Ga0070681_10017220
610 Ga0070679_100010793
611 Ga0068853_100007906
612 Ga0081455_10080712
613 Ga0075365_10000289
614 Ga0075365_10000666
615 Ga0075365_10019983
616 Ga0075363_100052365
617 Ga0075362_10000179
618 Ga0075362_10008978
619 Ga0075367_10000694
620 Ga0075367_10000950
621 Ga0075369_10000690
622 Ga0075369_10007923
623 Ga0075366_10043506
624 Ga0075370_10045692
625 Ga0075370_10082030
626 Ga0105251_10029812
627 Ga0105243_10255584
628 Ga0105241_10187784
629 Ga0105248_10039240
630 Ga0105237_10129635
631 Ga0105237_10449846
632 Ga0105249_10050450
633 Ga0123341_1000219
634 Ga0123341_1001576
635 Ga0123342_1016311
636 Ga0123342_1025878
637 Ga0105239_10281323
638 Ga0157373_10009198
639 Ga0157373_10084770
640 Ga0157370_10005531
641 Ga0157372_10012472
642 Ga0213876_10055529
643 Ga0209436_100008
644 Ga0207425_1000043
645 Ga0207425_1000542
646 Ga0207425_1001081
647 Ga0207425_1001177
648 Ga0207425_1024093
649 Ga0209129_1000072
650 Ga0209129_1000226
651 Ga0209129_1000259
652 Ga0209129_1000268
653 Ga0209129_1000456
654 Ga0209129_1001403
655 Ga0209129_1002070
656 Ga0209129_1002289
657 Ga0209673_1000025
658 Ga0209673_1000125
659 Ga0209673_1000256
660 Ga0209673_1001826
661 Ga0209673_1003372
662 Ga0209673_1003534
663 Ga0209673_1004865
664 Ga0209673_1005424
665 Ga0209673_1006302
666 Ga0209673_1035744
667 Ga0209130_1000019
668 Ga0209130_1003677
669 Ga0209676_1004071
670 Ga0209025_1000120
671 Ga0209025_1000386
672 Ga0209025_1001755
673 Ga0209025_1002496
674 Ga0209025_1012706
675 Ga0209564_1000259
676 Ga0209564_1000488
677 Ga0209564_1002700
678 Ga0209564_1003408
679 Ga0209564_1008925
680 Ga0209564_1028131
681 Ga0209758_1000111
682 Ga0209758_1000151
683 Ga0209758_1000254
684 Ga0209758_1000512
685 Ga0209758_1000699
686 Ga0209758_1002960
687 Ga0209758_1003401
688 Ga0209758_1004233
689 Ga0209758_1032542
690 Ga0209256_1000619
691 Ga0209256_1001144
692 Ga0209256_1002819
693 Ga0209256_1004407
694 Ga0209256_1004514
695 Ga0209256_1012487
696 Ga0209256_1013242
697 Ga0209256_1013925
698 Ga0207426_1000005
699 Ga0207426_1000208
700 Ga0207426_1003122
701 Ga0209051_1000176
702 Ga0209051_1000704
703 Ga0209051_1000756
704 Ga0209051_1002940
705 Ga0209051_1005181
706 Ga0209051_1015054
707 Ga0209051_1021290
708 Ga0209257_1001801
709 Ga0209257_1010040
710 Ga0207654_10139775
711 Ga0207707_10012096
712 Ga0207652_10023265
713 Ga0207690_10057400
714 Ga0207670_10003793
715 Ga0207712_10199525
716 Ga0207668_10093278
717 Ga0207639_10278084
718 Ga0209281_1000043
719 Ga0209371_1000035
720 Ga0307515_10000029
721 Ga0307515_10000950
722 Ga0307515_10099506
723 Ga0268256_1000037
724 Ga0265340_10002231
725 Ga0265313_10057827
726 Ga0307516_10120116
727 Ga0307405_10017586
728 Ga0307413_10382002
729 Ga0307406_10015184
730 Ga0307412_10004632
731 Ga0307412_10324870
732 Ga0436365_0384385
733 Ga0439465_0030553
734 Ga0451789_0804863
735 Ga0451833_0402211
736 Ga0451835_0985294
737 Ga0451839_0665625
738 Ga0451841_0720592
739 Ga0451851_0667719
740 Ga0451855_0312244
741 Ga0439432_041678
742 Ga0453684_0131042
743 Ga0466968_0013503
744 Ga0466960_0197039
745 Ga0495638_0004884
746 Ga0495638_0144464
747 Ga0495605_0000998
748 Ga0495585_0016986
749 Ga0495585_0057231
750 Ga0495607_0038685
751 Ga0495583_0003578
752 Ga0495606_0076456
753 Ga0495610_0022845
754 Ga0495616_0012156
755 Ga0495620_0037858
756 Ga0495631_0002952
757 Ga0495631_0105600
758 Ga0495632_0004532
759 Ga0495632_0007430
760 Ga0495632_0112062
761 Ga0495643_0007005
762 Ga0495643_0050384
763 Ga0495643_0095834
764 Ga0495654_0038468
765 Ga0495609_0016298
766 Ga0495668_0002457
767 Ga0495625_0006387
768 Ga0495625_0014976
769 Ga0495588_0057133
770 Ga0495670_0047796
771 Ga0495636_0034072
772 Ga0495672_0055625
773 Ga0495686_0012523
774 Ga0495686_0083228
775 Ga0496106_0000712
776 Ga0496110_0038763
777 Ga0496111_0011505
778 Ga0496114_0176233
779 Ga0496116_0012509
780 Ga0496116_0030814
781 Ga0496117_0011023
782 Ga0496117_0014595
783 Ga0496117_0119127
784 Ga0496118_0001964
785 Ga0496118_0017115
786 Ga0496118_0032643
787 Ga0496121_0002534
788 Ga0496121_0005312
789 Ga0496121_0026378
790 Ga0496122_0000018
791 Ga0496122_0002366
792 Ga0496122_0015622
793 Ga0496122_0023853
794 Ga0496122_0027288
795 Ga0496122_0032667
796 Ga0496123_0000015
797 Ga0496123_0006417
798 Ga0496123_0018257
799 Ga0496123_0054339
800 Ga0496123_0099160
801 Ga0496124_0001771
802 Ga0496124_0006219
803 Ga0496124_0065532
804 Ga0496125_0022372
805 Ga0496125_0109792
806 Ga0496126_0051115
807 Ga0495678_055040
808 Ga0495678_056280
809 Ga0495682_0040134
810 Ga0501036_0333448
811 Ga0501038_0171301
812 Ga0501077_0207559
813 Ga0501083_0156692
814 nmdc:mga03n38_12331_c1
815 nmdc:mga0yw44_55429_c1
816 nmdc:mga0k408_77506_c1
817 nmdc:mga06z11_106801_c1
818 nmdc:mga07m45_1626_c1
819 Ga0500651_0102774
820 Ga0500557_000228
821 Ga0500594_0000601
822 Ga0500594_0004766
823 Ga0500608_017376
824 Ga0500618_000850
825 Ga0500658_0000390
826 Ga0500559_0002464
827 Ga0500568_0000217
828 Ga0500606_078153
829 Ga0500616_0000437
830 Ga0500616_0015565
831 Ga0500616_0028712
832 Ga0500622_0000092
833 Ga0500627_0018549
834 2509390199
835 2509447509
836 2510134335
837 2510895767
838 2511170077
839 2511186189
840 2511197026
841 2513567544
842 2513577883
843 2513589016
844 2513601002
845 2513631973
846 2513708007
847 2513869753
848 2513910562
849 2513928004
850 2514017922
851 2515113506
852 2515635217
853 2515643873
854 2515654963
855 2515739857
856 2517037112
857 2517077456
858 2517096223
859 2517408082
860 2520378363
861 2523468601
862 2523470644
863 2530646413
864 2535517313
865 2537875756
866 2561467966
867 2585227490
868 2585230756
869 2585259286
870 2585336437
871 2585402858
872 2585524883
873 2585538571
874 2585550934
875 2585823480
876 2585836522
877 2585847502
878 2585998417
879 2586002979
880 2599421015
881 2599718648
882 2600376750
883 2644002998
884 2644194314
885 2644237977
886 2644296697
887 2644495897
888 2644654951
889 2719182229
890 2719386809
891 2719666547
892 2719732945
893 2720492967
894 2720614446
895 2720617831
896 2720621222
897 2720632548
898 2720776270
899 2721148320
900 2721159728
901 2721165156
902 2721400532
903 2722841326
904 2723027862
905 2723561490
906 2723568120
907 2724039345
908 2724045701
909 2724090877
910 2724105385
911 2724111205
912 2725950265
913 2730108798
914 2730165464
915 2730299360
916 2738803288
917 2739033210
918 2766066253
919 2792584121
920 2793294045
921 2793314280
922 2793328827
923 2793334805
924 2793342944
925 2793346868
926 2793351407
927 2793356529
928 2793362383
929 2793367505
930 2805926686
931 2805932594
932 2806049747
933 2806056654
934 2806064059
935 2806064073
936 2806070858
937 2806078085
938 2819242393
939 2819561444
940 2821123201
941 2838019963
942 2838023462
943 2838041375
944 2838045583
945 2838052773
946 2838065029
947 2838069753
948 2838665767
949 2838671740
950 2838679402
951 2838683055
952 2838686309
953 2838686667
954 2838698001
955 2838700727
956 2838704419
957 2838711116
958 2838714114
959 2838718759
960 2838723757
961 2838729080
962 2838734909
963 2838739776
964 2838747524
965 2841844100
966 2841854496
967 2841867362
968 2842079291
969 2842083416
970 2842115603
971 2842118198
972 2842124377
973 2842134479
974 2842143821
975 2842149637
976 2842156475
977 2842158485
978 2842169071
979 2842175004
980 2842179921
981 2842182099
982 2842191661
983 2842192922
984 2842195659
985 2842198976
986 2842209424
987 2842215978
988 2842218336
989 2842228522
990 2842229901
991 2842240112
992 2842243527
993 2842243790
994 2842254196
995 2842258125
996 2842267682
997 2842271795
998 2842282878
999 2842285217
1000 2842292953
1001 2842297596
1002 2842305406
1003 2842306458
1004 2842310764
1005 2842314131
1006 2842316251
1007 2842319935
1008 2842347668
1009 2842368680
1010 2842373685
1011 2842376868
1012 2842379350
1013 2842384103
1014 2842384709
1015 2842391149
1016 2842400613
1017 2842402575
1018 2842410054
1019 2842416702
1020 2842423367
1021 2842430326
1022 2842436862
1023 2842443296
1024 2842449161
1025 2842449606
1026 2842467198
1027 2842471268
1028 2842493523
1029 2842497675
1030 2844457965
1031 2854900869
1032 2854918897
1033 2857517040
1034 2857533847
1035 2899808711
1036 2919108277
1037 2919172491
1038 2923562014
1039 2933011249
1040 2933571213
1041 2933573527
1042 2933577258
1043 2933592018
1044 2933600560
1045 2935896615
1046 2935901057
1047 2935901513
1048 2936371655
1049 2936378838
1050 2936383383
1051 2989778326
1052 2996892612
1053 2996898018
1054 3003670961
1055 3003934600
1056 3005409319
1057 3005451791
1058 3005455137
1059 639649552
1060 8005264761
1061 8005281619
1062 8005284417
1063 8005289676
1064 8005303530
1065 8005314041
1066 8005327139
1067 8005381312
1068 8005384677
1069 8005395705
1070 8005433434
1071 8005464190
1072 8005501294
1073 8005502154
1074 8005546137
1075 8005561603
1076 8005568378
1077 8005573081
1078 8005622654
1079 8005630174
1080 8005672713
1081 8005673577
1082 8005691693
1083 8005696825
1084 8018127536
1085 8018152422
1086 8018164182
1087 8018179584
1088 8023682788
1089 8024486142
1090 8024501221
1091 8049293879
1092 8054562369
1093 8055434900
1094 8056376987
1095 8056387307
1096 8057881959

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

235

0.95

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

225

0.88

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

4

319

0.86

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

4

284

0.81

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

3

230

0.75

PF07993

NAD_binding_4

Male sterility protein

64

183

0.71

PF13460

NAD_binding_10

NAD(P)H-binding

7

169

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ys8-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (rv3634c) from mycobacterium tuberculosis 0.9071 1 332
6zlk-assembly2.cif.gz_B equilibrium structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid/udp-galacturonic acid and nad 0.9066 1 332
7ys9-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis 0.9062 1 331
5u4q-assembly1.cif.gz_B 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9045 1 332
6zla-assembly2.cif.gz_C crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with nad 0.9037 1 331
ID Description Score Start End Superfamily
af_Q4CM81_8_135_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8967 3 116 3.40.50.720
af_K7VFN4_114_450_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8954 1 331 3.40.50.720
1r6dA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8929 1 179 3.40.50.720
af_Q0DDZ4_1_298_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.89 37 334 3.40.50.720
5u4qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8872 3 334 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2D7PJU7-F1-model_v4 Capsular biosynthesis protein CpsI 0.9762 1 176
AF-A0A523M0X6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.971 1 126
AF-A0A849FW71-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9698 3 138
AF-A0A7C0UNZ2-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9641 3 80
AF-A0A7X7YJV8-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9613 1 174

Map