F462297

General Info

Members Datasets Scaffolds Average Seq Length
548 409 1096 238

Family's Representative Sequence

Representative Sequence 3300053140|Ga0500573_0000189|Ga0500573_0000189_8192_8923
Length 236
Sequence MLIIAGLGNPGAQYSGNRHNIGFMAIDAIHRRHSFSSWSKKFKALISEGELGGEKVLLVKPQTFMNLSGESVGEAMRFYKLQPENVLAVYDELDLLPGKPRIKTGGGHGXXXGIKSIDAHIGKEYRRLRLKDRVHAYVLGDFAKSDQDWLQTLLDAIADNAEMLARAEDSQFMNKLALATGTPADEEKPKPAAPKKPAGGQSHIHQARNNSAQPKILPTSGPMAEMLKKLLGPKEG

Samples

Sample ID Description Type Environment
1 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
32 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
35 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
36 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
37 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
38 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
63 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
64 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
65 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
66 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
67 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
68 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
69 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
70 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
71 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
72 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
73 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
76 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
77 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
78 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
84 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
85 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
86 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
87 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
88 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
89 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
90 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
91 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
92 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
97 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
98 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
99 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
109 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
142 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
148 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
149 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
154 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
155 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
156 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
157 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
158 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
159 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
160 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
161 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
162 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
163 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
164 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
165 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
166 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
167 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
168 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
169 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
170 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
171 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
172 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
173 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
174 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
175 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
176 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
177 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
178 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
179 2519899620 Rhizobium sp. Pop5 Isolate Nodule
180 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
181 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
182 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
183 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
184 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
185 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
186 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
187 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
188 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
189 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
190 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
191 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
192 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
193 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
194 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
195 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
196 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
197 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
198 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
199 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
200 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
201 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
202 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
203 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
204 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
205 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
206 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
207 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
208 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
209 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
210 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
211 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
212 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
213 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
214 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
215 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
216 2643221558 Rhizobium sp. Root149 Isolate Unclassified
217 2643221599 Rhizobium sp. Root708 Isolate Unclassified
218 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
219 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
220 2643221719 Rhizobium sp. Root274 Isolate Unclassified
221 2643221723 Ensifer sp. Root278 Isolate Unclassified
222 2718217882 Rhizobium sp. N741 Isolate Nodule
223 2718217927 Rhizobium sp. N324 Isolate Nodule
224 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
225 2718218009 Rhizobium sp. N561 Isolate Nodule
226 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
227 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
228 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
229 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
230 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
231 2718218363 Rhizobium sp. N113 Isolate Nodule
232 2718218365 Rhizobium sp. N731 Isolate Nodule
233 2718218366 Rhizobium sp. N621 Isolate Nodule
234 2718218423 Rhizobium sp. N941 Isolate Nodule
235 2721755514 Rhizobium sp. N6212 Isolate Nodule
236 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
237 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
238 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
239 2721755809 Rhizobium sp. N541 Isolate Nodule
240 2721755810 Rhizobium sp. N871 Isolate Nodule
241 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
242 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
243 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
244 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
245 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
246 2728369365 Rhizobium sp. N1341 Isolate Nodule
247 2728369397 Rhizobium sp. N1314 Isolate Nodule
248 2738541293 Rhizobium sp. GV031 Isolate Unclassified
249 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
250 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
251 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
252 2791355256 Rhizobium sp. M10 Isolate Nodule
253 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
254 2791355260 Rhizobium sp. L9 Isolate Nodule
255 2791355261 Rhizobium sp. J15 Isolate Nodule
256 2791355262 Rhizobium sp. M1 Isolate Nodule
257 2791355264 Rhizobium sp. S9 Isolate Nodule
258 2791355265 Rhizobium sp. H4 Isolate Nodule
259 2791355266 Rhizobium sp. L43 Isolate Nodule
260 2791355267 Rhizobium sp. L18 Isolate Nodule
261 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
262 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
263 2802429633 Rhizobium anhuiense J3 Isolate Nodule
264 2802429634 Rhizobium anhuiense S10 Isolate Nodule
265 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
266 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
267 2802429637 Rhizobium anhuiense C15 Isolate Nodule
268 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
269 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
270 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
271 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
272 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
273 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
274 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
275 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
276 2838048938 Rhizobium pisi 27/80 Isolate Nodule
277 2838061910 Rhizobium phaseoli L15 Isolate Nodule
278 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
279 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
280 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
281 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
282 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
283 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
284 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
285 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
286 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
287 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
288 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
289 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
290 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
291 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
292 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
293 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
294 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
295 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
296 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
297 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
298 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
299 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
300 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
301 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
302 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
303 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
304 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
305 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
306 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
307 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
308 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
309 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
310 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
311 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
312 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
313 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
314 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
315 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
316 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
317 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
318 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
319 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
320 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
321 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
322 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
323 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
324 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
325 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
326 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
327 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
328 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
329 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
330 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
331 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
332 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
333 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
334 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
335 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
336 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
337 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
338 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
339 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
340 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
341 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
342 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
343 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
344 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
345 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
346 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
347 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
348 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
349 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
350 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
351 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
352 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
353 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
354 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
355 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
356 2933599457 Rhizobium phaseoli M3 Isolate Nodule
357 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
358 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
359 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
360 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
361 2936381700 Rhizobium chutanense C16 Isolate Unclassified
362 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
363 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
364 2996887358 Rhizobium sp. R711 Isolate Nodule
365 2996893221 Rhizobium sp. R635 Isolate Nodule
366 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
367 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
368 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
369 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
370 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
371 8005258706 Rhizobium sp. R693 Isolate Nodule
372 8005275841 Rhizobium sp. N4311 Isolate Nodule
373 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
374 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
375 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
376 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
377 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
378 8005321885 Rhizobium sp. R72 Isolate Nodule
379 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
380 8005382845 Rhizobium sp. R634 Isolate Nodule
381 8005395548 Rhizobium sp. R339 Isolate Nodule
382 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
383 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
384 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
385 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
386 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
387 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
388 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
389 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
390 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
391 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
392 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
393 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
394 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
395 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
396 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
397 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
398 8018176218 Rhizobium sp. N122 Isolate Nodule
399 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
400 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
401 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
402 8024501048 Rhizobium sp. H4 Isolate Nodule
403 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
404 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
405 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
406 8056382006 Rhizobium croatiense 13T Isolate Nodule
407 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
408 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
409 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 53.1
Metatranscriptomes 0.36
Isolates 46.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.91
Nodule 33.39
Rhizoplane 3.28
Rhizosphere 20.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500573_0000189 3300053140 Bacteria 25044
2 JGI25152J39213_1001572 3300002773 Bacteria 9598
3 JGI25152J39213_1003120 3300002773 Bacteria 5790
4 JGI25152J39213_1003379 3300002773 Bacteria 5476
5 JGI25150J39212_1001440 3300002774 Bacteria 6659
6 JGI25159J45721_1000120 3300002987 Bacteria 37322
7 JGI25159J45721_1001458 3300002987 Bacteria 9756
8 JGI25151J46595_10000280 3300003187 Bacteria 58125
9 JGI25151J46595_10020074 3300003187 Bacteria 2825
10 JGI25153J46596_10005459 3300003215 Bacteria 6663
11 JGI25153J46596_10005956 3300003215 Bacteria 6280
12 JGI25153J46596_10008146 3300003215 Bacteria 5049
13 JGI25160J50197_1000001 3300003354 Bacteria 782301
14 JGI25160J50197_1000021 3300003354 Bacteria 215789
15 JGI25160J50197_1001268 3300003354 Bacteria 12798
16 JGI25160J50197_1009037 3300003354 Bacteria 3735
17 JGI25161J50226_1000001 3300003374 Bacteria 655036
18 JGI25161J50226_1001240 3300003374 Bacteria 8244
19 JGI25161J50226_1004078 3300003374 Bacteria 3147
20 Ga0055526_1001766 3300003771 Bacteria 15022
21 Ga0055526_1006894 3300003771 Bacteria 6050
22 Ga0055526_1007936 3300003771 Bacteria 5395
23 Ga0055526_1016628 3300003771 Bacteria 2862
24 Ga0055524_1000994 3300003775 Bacteria 17704
25 Ga0055524_1017012 3300003775 Bacteria 2580
26 Ga0055524_1022782 3300003775 Bacteria 2035
27 Ga0055524_1042667 3300003775 Bacteria 1125
28 Ga0055536_1017481 3300003781 Bacteria 2344
29 Ga0055528_1000290 3300003790 Bacteria 42833
30 Ga0055528_1002459 3300003790 Bacteria 9912
31 Ga0055528_1018265 3300003790 Bacteria 2383
32 Ga0055528_1033630 3300003790 Bacteria 1280
33 Ga0055528_1038693 3300003790 Bacteria 1101
34 Ga0055530_10011441 3300003791 Bacteria 3186
35 Ga0055540_1000592 3300003792 Bacteria 26360
36 Ga0055540_1001344 3300003792 Bacteria 14812
37 Ga0055531_10004872 3300003794 Bacteria 7998
38 Ga0055543_1000003 3300004625 Bacteria 358656
39 Ga0055543_1000164 3300004625 Bacteria 55304
40 Ga0055543_1003307 3300004625 Bacteria 4831
41 Ga0065165_1000033 3300005262 Bacteria 215827
42 Ga0065165_1000335 3300005262 Bacteria 77037
43 Ga0065165_1008287 3300005262 Bacteria 4902
44 Ga0065165_1008530 3300005262 Bacteria 4769
45 Ga0070670_100049146 3300005331 Bacteria 3627
46 Ga0070671_100017144 3300005355 Bacteria 5861
47 Ga0070667_100498405 3300005367 Bacteria 1116
48 Ga0081539_10000991 3300005985 Bacteria 52737
49 Ga0075365_10002132 3300006038 Bacteria 9494
50 Ga0075365_10002309 3300006038 Bacteria 9277
51 Ga0075363_100015347 3300006048 Bacteria 3764
52 Ga0075363_100055517 3300006048 Bacteria 2122
53 Ga0075364_10000266 3300006051 Bacteria 25404
54 Ga0075362_10018986 3300006177 Bacteria 2854
55 Ga0075362_10034539 3300006177 Bacteria 2205
56 Ga0075367_10001001 3300006178 Bacteria 11597
57 Ga0075369_10000834 3300006186 Bacteria 10168
58 Ga0075369_10015394 3300006186 Bacteria 3069
59 Ga0075369_10181232 3300006186 Bacteria 969
60 Ga0075370_10006544 3300006353 Bacteria 5867
61 Ga0079104_1000045 3300006946 Bacteria 183705
62 Ga0105248_10455471 3300009177 Bacteria 1442
63 Ga0123341_1000124 3300009765 Bacteria 35033
64 Ga0123342_1014819 3300009766 Bacteria 7313
65 Ga0123342_1022183 3300009766 Bacteria 4335
66 Ga0105246_10111486 3300011119 Bacteria 2010
67 Ga0171463_1017 3300013249 Bacteria 48649
68 Ga0183363_1050 3300015690 Bacteria 38817
69 Ga0209436_100070 3300025208 Bacteria 51558
70 Ga0207425_1000055 3300025245 Bacteria 152820
71 Ga0207425_1002677 3300025245 Bacteria 6099
72 Ga0207425_1004042 3300025245 Bacteria 4498
73 Ga0207425_1004680 3300025245 Bacteria 4044
74 Ga0209129_1000029 3300025258 Bacteria 401149
75 Ga0209129_1000252 3300025258 Bacteria 55710
76 Ga0209129_1001350 3300025258 Bacteria 13855
77 Ga0209129_1004754 3300025258 Bacteria 5143
78 Ga0209129_1004826 3300025258 Bacteria 5078
79 Ga0209129_1011892 3300025258 Bacteria 2044
80 Ga0209673_1000010 3300025273 Bacteria 596656
81 Ga0209673_1000025 3300025273 Bacteria 404572
82 Ga0209673_1000878 3300025273 Bacteria 39065
83 Ga0209673_1001610 3300025273 Bacteria 19758
84 Ga0209673_1004326 3300025273 Bacteria 7663
85 Ga0209673_1008113 3300025273 Bacteria 4721
86 Ga0209673_1017874 3300025273 Bacteria 2600
87 Ga0209673_1063232 3300025273 Bacteria 914
88 Ga0209130_1000003 3300025284 Bacteria 677988
89 Ga0209130_1000017 3300025284 Bacteria 388431
90 Ga0209130_1000020 3300025284 Bacteria 379297
91 Ga0209676_1006076 3300025292 Bacteria 6077
92 Ga0209676_1011727 3300025292 Bacteria 3506
93 Ga0209676_1012962 3300025292 Bacteria 3235
94 Ga0209025_1000070 3300025294 Bacteria 287776
95 Ga0209025_1000091 3300025294 Bacteria 250401
96 Ga0209025_1000161 3300025294 Bacteria 166506
97 Ga0209025_1002035 3300025294 Bacteria 23068
98 Ga0209025_1007003 3300025294 Bacteria 8557
99 Ga0209025_1012336 3300025294 Bacteria 5494
100 Ga0209025_1035935 3300025294 Bacteria 2229
101 Ga0209564_1000013 3300025295 Bacteria 775755
102 Ga0209564_1000265 3300025295 Bacteria 110606
103 Ga0209564_1000644 3300025295 Bacteria 52727
104 Ga0209564_1001272 3300025295 Bacteria 27752
105 Ga0209564_1004372 3300025295 Bacteria 8682
106 Ga0209564_1004592 3300025295 Bacteria 8344
107 Ga0209758_1000094 3300025297 Bacteria 241068
108 Ga0209758_1002497 3300025297 Bacteria 18675
109 Ga0209758_1002519 3300025297 Bacteria 18566
110 Ga0209758_1004278 3300025297 Bacteria 12055
111 Ga0209758_1005108 3300025297 Bacteria 10385
112 Ga0209758_1005708 3300025297 Bacteria 9392
113 Ga0209758_1009652 3300025297 Bacteria 5947
114 Ga0209050_1004415 3300025298 Bacteria 9515
115 Ga0209050_1005237 3300025298 Bacteria 8269
116 Ga0209050_1023944 3300025298 Bacteria 2130
117 Ga0209256_1000940 3300025299 Bacteria 35371
118 Ga0209256_1001609 3300025299 Bacteria 22077
119 Ga0209256_1002138 3300025299 Bacteria 17084
120 Ga0209256_1002922 3300025299 Bacteria 12855
121 Ga0209256_1004254 3300025299 Bacteria 9156
122 Ga0209256_1005694 3300025299 Bacteria 7000
123 Ga0209256_1008439 3300025299 Bacteria 4776
124 Ga0207426_1000006 3300025302 Bacteria 1025969
125 Ga0207426_1000008 3300025302 Bacteria 848730
126 Ga0207426_1000011 3300025302 Bacteria 791203
127 Ga0207426_1000218 3300025302 Bacteria 135865
128 Ga0207426_1002039 3300025302 Bacteria 14113
129 Ga0209051_1000393 3300025303 Bacteria 60776
130 Ga0209051_1000645 3300025303 Bacteria 39647
131 Ga0209051_1002719 3300025303 Bacteria 12290
132 Ga0209051_1007816 3300025303 Bacteria 5774
133 Ga0209051_1026156 3300025303 Bacteria 2358
134 Ga0209051_1039540 3300025303 Bacteria 1701
135 Ga0209257_1001083 3300025304 Bacteria 35747
136 Ga0209257_1009964 3300025304 Bacteria 4934
137 Ga0209257_1023809 3300025304 Bacteria 2139
138 Ga0207650_10070701 3300025925 Bacteria 2624
139 Ga0207711_10054555 3300025941 Bacteria 3430
140 Ga0207658_10877179 3300025986 Bacteria 816
141 Ga0207678_10027801 3300026067 Bacteria 4938
142 Ga0209281_1000034 3300027111 Bacteria 382562
143 Ga0268266_10054529 3300028379 Bacteria 3435
144 Ga0307513_10003237 3300031456 Bacteria 22198
145 Ga0307508_10389914 3300031616 Bacteria 984
146 Ga0307405_10000170 3300031731 Bacteria 24017
147 Ga0307412_10002136 3300031911 Bacteria 10965
148 Ga0307414_10090562 3300032004 Bacteria 2270
149 Ga0307414_10097819 3300032004 Bacteria 2200
150 Ga0395900_0070984 3300037418 Bacteria 3580
151 Ga0439439_0052153 3300041406 Bacteria 1074
152 Ga0451795_1372635 3300041456 Bacteria 1495
153 Ga0451833_1103729 3300041491 Bacteria 3054
154 Ga0451835_0143687 3300041492 Bacteria 1754
155 Ga0451837_0602560 3300041494 Bacteria 2831
156 Ga0451837_0629985 3300041494 Bacteria 1225
157 Ga0451841_0622163 3300041498 Bacteria 2871
158 Ga0451845_0541100 3300041501 Bacteria 4679
159 Ga0451846_21688 3300041502 Bacteria 1679
160 Ga0451847_0120876 3300041503 Bacteria 5670
161 Ga0451849_1553131 3300041505 Bacteria 6634
162 Ga0451851_0718869 3300041507 Bacteria 3711
163 Ga0451854_16362 3300041510 Bacteria 1839
164 Ga0451853_0592169 3300041512 Bacteria 6014
165 Ga0439445_0015047 3300042004 Bacteria 1891
166 Ga0439432_060043 3300042006 Bacteria 1174
167 Ga0439449_0016539 3300042007 Bacteria 2772
168 Ga0439449_0034642 3300042007 Bacteria 1880
169 Ga0439462_0072674 3300042015 Bacteria 935
170 Ga0495592_0227437 3300046454 Bacteria 1244
171 Ga0495638_0254473 3300046460 Bacteria 966
172 Ga0495651_0119997 3300046462 Bacteria 1933
173 Ga0495650_0097271 3300046471 Bacteria 1110
174 Ga0495605_0023814 3300046474 Bacteria 3214
175 Ga0495607_0055151 3300046501 Bacteria 2287
176 Ga0495583_0010441 3300046506 Bacteria 5414
177 Ga0495606_0028221 3300046507 Bacteria 3963
178 Ga0495610_0001284 3300046512 Bacteria 22438
179 Ga0495610_0084495 3300046512 Bacteria 1450
180 Ga0495610_0149266 3300046512 Bacteria 999
181 Ga0495616_0029910 3300046513 Bacteria 2869
182 Ga0495620_0008324 3300046515 Bacteria 5574
183 Ga0495632_0010504 3300046519 Bacteria 5475
184 Ga0495632_0023287 3300046519 Bacteria 3309
185 Ga0495643_0007330 3300046522 Bacteria 7127
186 Ga0495643_0019929 3300046522 Bacteria 3876
187 Ga0495643_0057970 3300046522 Bacteria 2062
188 Ga0495643_0065317 3300046522 Bacteria 1921
189 Ga0495648_0016246 3300046524 Bacteria 5370
190 Ga0495652_0097799 3300046529 Bacteria 2387
191 Ga0495654_0001905 3300046530 Bacteria 13848
192 Ga0495587_0099502 3300046536 Bacteria 1676
193 Ga0495609_0090334 3300046538 Bacteria 1332
194 Ga0495597_0020023 3300046542 Bacteria 3122
195 Ga0495622_0021567 3300046557 Bacteria 2998
196 Ga0495633_0054801 3300046558 Bacteria 1875
197 Ga0495656_0096855 3300046615 Bacteria 1358
198 Ga0495611_0047914 3300046648 Bacteria 1919
199 Ga0495625_0043877 3300046660 Bacteria 3240
200 Ga0495625_0109808 3300046660 Bacteria 1886
201 Ga0495625_0181831 3300046660 Bacteria 1397
202 Ga0495635_0052547 3300046663 Bacteria 2807
203 Ga0495661_0056455 3300046665 Bacteria 2349
204 Ga0495661_0184016 3300046665 Bacteria 1105
205 Ga0495657_0010582 3300046675 Bacteria 6935
206 Ga0495646_0266971 3300046680 Bacteria 913
207 Ga0495624_0083039 3300046690 Bacteria 1982
208 Ga0495589_0287119 3300046794 Bacteria 764
209 Ga0495660_0042236 3300046810 Bacteria 2520
210 Ga0495604_0008895 3300047317 Bacteria 7939
211 Ga0495636_0107834 3300047318 Bacteria 1223
212 Ga0495672_0052077 3300047320 Bacteria 2406
213 Ga0495687_012523 3300047443 Bacteria 4478
214 Ga0495686_0014886 3300047472 Bacteria 5336
215 Ga0495686_0017574 3300047472 Bacteria 4812
216 Ga0495686_0190709 3300047472 Bacteria 1182
217 Ga0496101_0046834 3300048904 Bacteria 3102
218 Ga0496101_0082911 3300048904 Bacteria 2373
219 Ga0496101_0158444 3300048904 Bacteria 1735
220 Ga0496102_0070167 3300048905 Bacteria 3217
221 Ga0496103_0178295 3300048906 Bacteria 1365
222 Ga0496104_0093226 3300048907 Bacteria 2880
223 Ga0496105_0080307 3300048908 Bacteria 2694
224 Ga0496106_0001054 3300048909 Bacteria 20308
225 Ga0496107_0154555 3300048910 Bacteria 1698
226 Ga0496107_0181528 3300048910 Bacteria 1563
227 Ga0496111_0026731 3300048914 Bacteria 4076
228 Ga0496113_0049301 3300048916 Bacteria 3135
229 Ga0496114_0163759 3300048917 Bacteria 1935
230 Ga0496116_0003082 3300048919 Bacteria 16806
231 Ga0496116_0012537 3300048919 Bacteria 6916
232 Ga0496116_0017728 3300048919 Bacteria 5516
233 Ga0496116_0046798 3300048919 Bacteria 2917
234 Ga0496116_0058169 3300048919 Bacteria 2522
235 Ga0496116_0079117 3300048919 Bacteria 2047
236 Ga0496116_0109240 3300048919 Bacteria 1631
237 Ga0496117_0024813 3300048920 Bacteria 4727
238 Ga0496118_0014245 3300048921 Bacteria 7457
239 Ga0496118_0022203 3300048921 Bacteria 5558
240 Ga0496118_0023607 3300048921 Bacteria 5336
241 Ga0496118_0028387 3300048921 Bacteria 4713
242 Ga0496119_0031580 3300048922 Bacteria 3548
243 Ga0496119_0094603 3300048922 Bacteria 1690
244 Ga0496121_0001531 3300048924 Bacteria 38692
245 Ga0496121_0026114 3300048924 Bacteria 5516
246 Ga0496121_0035236 3300048924 Bacteria 4489
247 Ga0496121_0039195 3300048924 Bacteria 4181
248 Ga0496121_0050502 3300048924 Bacteria 3513
249 Ga0496121_0112780 3300048924 Bacteria 2070
250 Ga0496121_0128427 3300048924 Bacteria 1902
251 Ga0496121_0241126 3300048924 Bacteria 1259
252 Ga0496122_0013481 3300048925 Bacteria 7998
253 Ga0496122_0023236 3300048925 Bacteria 5475
254 Ga0496122_0032126 3300048925 Bacteria 4347
255 Ga0496122_0064920 3300048925 Bacteria 2651
256 Ga0496122_0081062 3300048925 Bacteria 2260
257 Ga0496123_0005261 3300048926 Bacteria 13130
258 Ga0496123_0046270 3300048926 Bacteria 2952
259 Ga0496123_0070960 3300048926 Bacteria 2176
260 Ga0496124_0010044 3300048927 Bacteria 9655
261 Ga0496124_0014104 3300048927 Bacteria 7747
262 Ga0496124_0027396 3300048927 Bacteria 5115
263 Ga0496124_0156693 3300048927 Bacteria 1780
264 Ga0496125_0019828 3300048928 Bacteria 6327
265 Ga0496125_0069658 3300048928 Bacteria 2758
266 Ga0496126_0054005 3300048929 Bacteria 3642
267 Ga0496126_0195993 3300048929 Bacteria 1708
268 Ga0496126_0211615 3300048929 Bacteria 1632
269 Ga0495678_007538 3300049459 Bacteria 5621
270 Ga0501034_0001662 3300049571 Bacteria 28665
271 Ga0501034_0069100 3300049571 Bacteria 3543
272 Ga0501036_0332995 3300049572 Bacteria 1268
273 Ga0501037_0048825 3300049573 Bacteria 3100
274 Ga0501073_0053231 3300049589 Bacteria 2834
275 Ga0501083_0048394 3300049744 Bacteria 2869
276 nmdc:mga00v17_241_c1 3300050491 Bacteria 32423
277 nmdc:mga0yw44_1036_c1 3300050492 Bacteria 10672
278 nmdc:mga0k408_109141_c1 3300050493 Bacteria 1635
279 nmdc:mga06z11_59920_c1 3300050494 Bacteria 1980
280 nmdc:mga06z11_66931_c1 3300050494 Bacteria 1890
281 nmdc:mga07m45_48238_c1 3300050496 Bacteria 2395
282 Ga0495619_0123203 3300053085 Bacteria 1778
283 Ga0500618_002031 3300053125 Bacteria 8183
284 Ga0500658_0000715 3300053134 Bacteria 13705
285 Ga0500658_0054605 3300053134 Bacteria 1642
286 Ga0500559_0018359 3300053136 Bacteria 2956
287 Ga0500568_0006560 3300053139 Bacteria 5824
288 Ga0500590_002985 3300053148 Bacteria 7687
289 Ga0500616_0000577 3300053153 Bacteria 44621
290 Ga0500616_0002510 3300053153 Bacteria 15189
291 Ga0500616_0010239 3300053153 Bacteria 5622
292 Ga0500622_0000429 3300053156 Bacteria 39925
293 Ga0500611_030869 3300053727 Bacteria 1108
294 2509391857 2509276021 Bacteria 7634384
295 2510839535 2510461069 Bacteria 5505000
296 2510895558 2510461076 Bacteria 8618824
297 2511133279 2510917022 Bacteria 6504556
298 2511182530 2510917028 Bacteria 6185411
299 2511199197 2510917030 Bacteria 7460662
300 2513567800 2513237084 Bacteria 7231967
301 2513577122 2513237085 Bacteria 7695351
302 2513599942 2513237088 Bacteria 6927906
303 2513633208 2513237093 Bacteria 7545552
304 2513707787 2513237103 Bacteria 7647401
305 2513865866 2513237138 Bacteria 7368160
306 2513908598 2513237144 Bacteria 7530820
307 2513925235 2513237146 Bacteria 7166346
308 2514018129 2513237162 Bacteria 7468464
309 2515113231 2515075009 Bacteria 7288508
310 2515636820 2515154113 Bacteria 7807172
311 2515646314 2515154114 Bacteria 7848616
312 2515655170 2515154116 Bacteria 7552979
313 2515739655 2515154134 Bacteria 7220242
314 2517036891 2516653077 Bacteria 7555578
315 2517077252 2516653085 Bacteria 7346596
316 2517096010 2517093000 Bacteria 7412387
317 2517407629 2517287029 Bacteria 6905599
318 2520377076 2519899620 Bacteria 6499161
319 2524458796 2524023209 Bacteria 6679728
320 2530646626 2529292951 Bacteria 6916614
321 2535517050 2534681796 Bacteria 7146037
322 2561468650 2558860983 Bacteria 4133860
323 2585202048 2582581294 Bacteria 6626667
324 2585223027 2582581298 Bacteria 7315509
325 2585228465 2582581299 Bacteria 6518058
326 2585258330 2582581304 Bacteria 5831370
327 2585271291 2582581307 Bacteria 6597605
328 2585279230 2582581308 Bacteria 7413247
329 2585323165 2582581315 Bacteria 7318924
330 2585331273 2582581316 Bacteria 7774528
331 2585400899 2582581867 Bacteria 7184437
332 2585524679 2585427526 Bacteria 7258840
333 2585531285 2585427527 Bacteria 7273426
334 2585538367 2585427528 Bacteria 6842387
335 2585545610 2585427529 Bacteria 7395659
336 2585552792 2585427530 Bacteria 7383882
337 2585559036 2585427531 Bacteria 6992870
338 2585822199 2585427590 Bacteria 6824633
339 2585836320 2585427593 Bacteria 7141551
340 2585843405 2585427594 Bacteria 6180594
341 2585898416 2585427608 Bacteria 6544331
342 2585904017 2585427609 Bacteria 6667127
343 2585996613 2585427633 Bacteria 6413184
344 2586001141 2585427634 Bacteria 6455027
345 2587980865 2585428125 Bacteria 6662905
346 2599417143 2599185170 Bacteria 7295545
347 2599721541 2599185236 Bacteria 6875203
348 2600194800 2599185352 Bacteria 7228948
349 2600374166 2600254933 Bacteria 4750527
350 2616293189 2615840624 Bacteria 6557588
351 2616311397 2615840626 Bacteria 7921970
352 2617386258 2617270742 Bacteria 6808054
353 2643776345 2643221551 Bacteria 3750538
354 2643794792 2643221555 Bacteria 3749717
355 2643811371 2643221558 Bacteria 5460675
356 2644007091 2643221599 Bacteria 6292121
357 2644242511 2643221643 Bacteria 5749658
358 2644298804 2643221653 Bacteria 4569637
359 2644657033 2643221719 Bacteria 4568197
360 2644675869 2643221723 Bacteria 7095460
361 2719181968 2718217882 Bacteria 6556348
362 2719386579 2718217927 Bacteria 6972593
363 2719666326 2718217997 Bacteria 6740740
364 2719732685 2718218009 Bacteria 6478651
365 2720492746 2718218199 Bacteria 6740745
366 2720614215 2718218232 Bacteria 6720332
367 2720620983 2718218233 Bacteria 6662049
368 2720632307 2718218235 Bacteria 6630699
369 2720776035 2718218269 Bacteria 6906114
370 2721148059 2718218363 Bacteria 6524337
371 2721159510 2718218365 Bacteria 6274507
372 2721164895 2718218366 Bacteria 6425255
373 2721400283 2718218423 Bacteria 6438183
374 2722841065 2721755514 Bacteria 6424414
375 2723027634 2721755556 Bacteria 6745503
376 2723561262 2721755684 Bacteria 6859907
377 2723567885 2721755685 Bacteria 6704835
378 2724039096 2721755809 Bacteria 6438790
379 2724045441 2721755810 Bacteria 6479005
380 2724090642 2721755819 Bacteria 6906405
381 2724105150 2721755822 Bacteria 6726041
382 2724110978 2721755823 Bacteria 6752556
383 2725951430 2724679232 Bacteria 7646494
384 2730108570 2728369352 Bacteria 6745171
385 2730165203 2728369365 Bacteria 6555560
386 2730299142 2728369397 Bacteria 6274511
387 2738800260 2738541293 Bacteria 7065685
388 2739033008 2738541333 Bacteria 7106503
389 2766066048 2765235942 Bacteria 7445910
390 2776914119 2775507049 Bacteria 6284736
391 2793294266 2791355256 Bacteria 6798008
392 2793315919 2791355259 Bacteria 7254731
393 2793319347 2791355260 Bacteria 6598818
394 2793328433 2791355261 Bacteria 6661293
395 2793335390 2791355262 Bacteria 6774204
396 2793347078 2791355264 Bacteria 6429314
397 2793351670 2791355265 Bacteria 6539969
398 2793361968 2791355266 Bacteria 7116587
399 2793367723 2791355267 Bacteria 7222458
400 2805926901 2802429605 Bacteria 6875453
401 2805932816 2802429606 Bacteria 6346811
402 2806045147 2802429633 Bacteria 7341974
403 2806050058 2802429634 Bacteria 7083200
404 2806056896 2802429635 Bacteria 7650140
405 2806064277 2802429636 Bacteria 7597525
406 2806071545 2802429637 Bacteria 7067217
407 2819241195 2818991272 Bacteria 4622173
408 2819641390 2818991453 Bacteria 7181617
409 2819685093 2818991461 Bacteria 7026071
410 2821127354 2821123053 Bacteria 7836056
411 2838021623 2838016132 Bacteria 6577831
412 2838023683 2838022645 Bacteria 6494267
413 2838038651 2838035591 Bacteria 7166484
414 2838045139 2838042994 Bacteria 6046894
415 2838053382 2838048938 Bacteria 6044578
416 2838065502 2838061910 Bacteria 6794874
417 2838069981 2838068647 Bacteria 6208656
418 2838661427 2838661181 Bacteria 7385261
419 2838670531 2838668709 Bacteria 6671819
420 2838683283 2838680041 Bacteria 6545511
421 2838686875 2838686498 Bacteria 7807632
422 2838697773 2838694306 Bacteria 6853137
423 2838702902 2838701080 Bacteria 6669771
424 2838710889 2838707686 Bacteria 6619912
425 2838730167 2838729681 Bacteria 7400765
426 2838737878 2838736955 Bacteria 5760694
427 2838742818 2838742623 Bacteria 7396178
428 2841841753 2841840854 Bacteria 5761912
429 2841852321 2841851746 Bacteria 7532261
430 2841867128 2841864319 Bacteria 6742987
431 2842079062 2842077413 Bacteria 6508645
432 2842113092 2842110456 Bacteria 7656360
433 2842118428 2842118031 Bacteria 7033875
434 2842141531 2842140634 Bacteria 5759631
435 2842147840 2842146304 Bacteria 5957337
436 2842158221 2842156927 Bacteria 6894975
437 2842168620 2842163707 Bacteria 6916235
438 2842181841 2842180545 Bacteria 6888678
439 2842195888 2842192696 Bacteria 6147454
440 2842199197 2842198810 Bacteria 6608673
441 2842209646 2842205361 Bacteria 6340321
442 2842218117 2842217011 Bacteria 7497767
443 2842230108 2842229732 Bacteria 7475766
444 2842240339 2842237096 Bacteria 6620661
445 2842243997 2842243621 Bacteria 7421798
446 2842252906 2842250916 Bacteria 6579627
447 2842257918 2842257432 Bacteria 7401195
448 2842269454 2842264693 Bacteria 6472963
449 2842271587 2842271015 Bacteria 7807131
450 2842283100 2842278818 Bacteria 6340002
451 2842285436 2842285085 Bacteria 6011953
452 2842292724 2842291075 Bacteria 7076806
453 2842298144 2842298080 Bacteria 6123127
454 2842305218 2842304105 Bacteria 7023636
455 2842314052 2842311132 Bacteria 6616990
456 2842324384 2842317721 Bacteria 6793725
457 2842347348 2842341865 Bacteria 7003929
458 2842360256 2842357229 Bacteria 6485165
459 2842370157 2842363717 Bacteria 6844742
460 2842373914 2842370503 Bacteria 7038661
461 2842379122 2842377471 Bacteria 7140707
462 2842384938 2842384541 Bacteria 7057858
463 2842400176 2842395702 Bacteria 6780583
464 2842402796 2842402390 Bacteria 6681310
465 2842409833 2842409023 Bacteria 6687331
466 2842416482 2842415677 Bacteria 6596907
467 2842423595 2842422224 Bacteria 6239196
468 2842430544 2842428310 Bacteria 6767288
469 2842436644 2842434925 Bacteria 6502746
470 2842443514 2842441272 Bacteria 6769273
471 2842449384 2842447887 Bacteria 6754142
472 2842466798 2842462802 Bacteria 6588055
473 2842471486 2842469257 Bacteria 6752936
474 2842483908 2842482326 Bacteria 7212537
475 2842492239 2842489311 Bacteria 6620893
476 2842502589 2842495871 Bacteria 6820686
477 2842510937 2842509118 Bacteria 6850950
478 2844458172 2844454524 Bacteria 7952546
479 2852390419 2852387548 Bacteria 8025568
480 2854901284 2854896431 Bacteria 5869725
481 2854918659 2854916844 Bacteria 5725939
482 2857517250 2857516855 Bacteria 7787325
483 2857532230 2857531043 Bacteria 6754041
484 2889796046 2889790730 Bacteria 5689708
485 2889919849 2889914905 Bacteria 5702301
486 2891049751 2891048133 Bacteria 4447501
487 2899804197 2899803654 Bacteria 5577784
488 2919106287 2919100787 Bacteria 7710546
489 2919172899 2919171160 Bacteria 6499771
490 2920825442 2920822456 Bacteria 6897201
491 2923559274 2923556063 Bacteria 6793593
492 2933020835 2933016740 Bacteria 6355406
493 2933571025 2933570622 Bacteria 7023390
494 2933588851 2933586486 Bacteria 7667493
495 2933600787 2933599457 Bacteria 5858799
496 2935896841 2935894831 Bacteria 6620579
497 2935901782 2935901341 Bacteria 7341747
498 2936371866 2936367885 Bacteria 7324495
499 2936379700 2936375103 Bacteria 6652732
500 2936387871 2936381700 Bacteria 7006523
501 2989776053 2989771324 Bacteria 5605128
502 2989779361 2989776772 Bacteria 4843317
503 2996892870 2996887358 Bacteria 5795980
504 2996894975 2996893221 Bacteria 5823108
505 3005414398 3005409236 Bacteria 7188837
506 3005417529 3005416602 Bacteria 7064308
507 3005448622 3005445848 Bacteria 6906074
508 639649349 639633055 Bacteria 7751309
509 8005248908 8005246636 Bacteria 4933972
510 8005259363 8005258706 Bacteria 6184835
511 8005281385 8005275841 Bacteria 6929066
512 8005284646 8005282627 Bacteria 6675747
513 8005295687 8005289223 Bacteria 6634003
514 8005303300 8005301065 Bacteria 6614431
515 8005309565 8005307578 Bacteria 7395396
516 8005315682 8005314921 Bacteria 7072929
517 8005327397 8005321885 Bacteria 5795980
518 8005381102 8005376324 Bacteria 6590079
519 8005388948 8005382845 Bacteria 6732062
520 8005395931 8005395548 Bacteria 6806915
521 8005437453 8005430974 Bacteria 6689030
522 8005463914 8005460587 Bacteria 7157962
523 8005489033 8005484373 Bacteria 6297373
524 8005501066 8005497431 Bacteria 6477605
525 8005545864 8005542996 Bacteria 7077758
526 8005556847 8005556819 Bacteria 6908598
527 8005568171 8005563573 Bacteria 7153261
528 8005573290 8005570704 Bacteria 6957481
529 8005622433 8005619151 Bacteria 7030230
530 8005629934 8005626139 Bacteria 6534237
531 8005658903 8005658619 Bacteria 4500593
532 8005672483 8005668836 Bacteria 6953162
533 8005691928 8005688590 Bacteria 6610080
534 8005697579 8005695170 Bacteria 6912330
535 8018128031 8018127388 Bacteria 7351159
536 8018164398 8018163183 Bacteria 7277977
537 8018176881 8018176218 Bacteria 6896178
538 8023682995 8023680758 Bacteria 7729763
539 8024482693 8024479707 Bacteria 6954785
540 8024488206 8024486573 Bacteria 6540512
541 8024504606 8024501048 Bacteria 6427847
542 8046771779 8046767195 Bacteria 7547379
543 8055432448 8055431914 Bacteria 4551896
544 8056378312 8056375014 Bacteria 7006639
545 8056384247 8056382006 Bacteria 6408074
546 8056875718 8056875544 Bacteria 4355797
547 8057575537 8057575449 Bacteria 7367519
548 8057878490 8057874678 Bacteria 7494653
549 Ga0500573_0000189
550 JGI25152J39213_1001572
551 JGI25152J39213_1003120
552 JGI25152J39213_1003379
553 JGI25150J39212_1001440
554 JGI25159J45721_1000120
555 JGI25159J45721_1001458
556 JGI25151J46595_10000280
557 JGI25151J46595_10020074
558 JGI25153J46596_10005459
559 JGI25153J46596_10005956
560 JGI25153J46596_10008146
561 JGI25160J50197_1000001
562 JGI25160J50197_1000021
563 JGI25160J50197_1001268
564 JGI25160J50197_1009037
565 JGI25161J50226_1000001
566 JGI25161J50226_1001240
567 JGI25161J50226_1004078
568 Ga0055526_1001766
569 Ga0055526_1006894
570 Ga0055526_1007936
571 Ga0055526_1016628
572 Ga0055524_1000994
573 Ga0055524_1017012
574 Ga0055524_1022782
575 Ga0055524_1042667
576 Ga0055536_1017481
577 Ga0055528_1000290
578 Ga0055528_1002459
579 Ga0055528_1018265
580 Ga0055528_1033630
581 Ga0055528_1038693
582 Ga0055530_10011441
583 Ga0055540_1000592
584 Ga0055540_1001344
585 Ga0055531_10004872
586 Ga0055543_1000003
587 Ga0055543_1000164
588 Ga0055543_1003307
589 Ga0065165_1000033
590 Ga0065165_1000335
591 Ga0065165_1008287
592 Ga0065165_1008530
593 Ga0070670_100049146
594 Ga0070671_100017144
595 Ga0070667_100498405
596 Ga0081539_10000991
597 Ga0075365_10002132
598 Ga0075365_10002309
599 Ga0075363_100015347
600 Ga0075363_100055517
601 Ga0075364_10000266
602 Ga0075362_10018986
603 Ga0075362_10034539
604 Ga0075367_10001001
605 Ga0075369_10000834
606 Ga0075369_10015394
607 Ga0075369_10181232
608 Ga0075370_10006544
609 Ga0079104_1000045
610 Ga0105248_10455471
611 Ga0123341_1000124
612 Ga0123342_1014819
613 Ga0123342_1022183
614 Ga0105246_10111486
615 Ga0171463_1017
616 Ga0183363_1050
617 Ga0209436_100070
618 Ga0207425_1000055
619 Ga0207425_1002677
620 Ga0207425_1004042
621 Ga0207425_1004680
622 Ga0209129_1000029
623 Ga0209129_1000252
624 Ga0209129_1001350
625 Ga0209129_1004754
626 Ga0209129_1004826
627 Ga0209129_1011892
628 Ga0209673_1000010
629 Ga0209673_1000025
630 Ga0209673_1000878
631 Ga0209673_1001610
632 Ga0209673_1004326
633 Ga0209673_1008113
634 Ga0209673_1017874
635 Ga0209673_1063232
636 Ga0209130_1000003
637 Ga0209130_1000017
638 Ga0209130_1000020
639 Ga0209676_1006076
640 Ga0209676_1011727
641 Ga0209676_1012962
642 Ga0209025_1000070
643 Ga0209025_1000091
644 Ga0209025_1000161
645 Ga0209025_1002035
646 Ga0209025_1007003
647 Ga0209025_1012336
648 Ga0209025_1035935
649 Ga0209564_1000013
650 Ga0209564_1000265
651 Ga0209564_1000644
652 Ga0209564_1001272
653 Ga0209564_1004372
654 Ga0209564_1004592
655 Ga0209758_1000094
656 Ga0209758_1002497
657 Ga0209758_1002519
658 Ga0209758_1004278
659 Ga0209758_1005108
660 Ga0209758_1005708
661 Ga0209758_1009652
662 Ga0209050_1004415
663 Ga0209050_1005237
664 Ga0209050_1023944
665 Ga0209256_1000940
666 Ga0209256_1001609
667 Ga0209256_1002138
668 Ga0209256_1002922
669 Ga0209256_1004254
670 Ga0209256_1005694
671 Ga0209256_1008439
672 Ga0207426_1000006
673 Ga0207426_1000008
674 Ga0207426_1000011
675 Ga0207426_1000218
676 Ga0207426_1002039
677 Ga0209051_1000393
678 Ga0209051_1000645
679 Ga0209051_1002719
680 Ga0209051_1007816
681 Ga0209051_1026156
682 Ga0209051_1039540
683 Ga0209257_1001083
684 Ga0209257_1009964
685 Ga0209257_1023809
686 Ga0207650_10070701
687 Ga0207711_10054555
688 Ga0207658_10877179
689 Ga0207678_10027801
690 Ga0209281_1000034
691 Ga0268266_10054529
692 Ga0307513_10003237
693 Ga0307508_10389914
694 Ga0307405_10000170
695 Ga0307412_10002136
696 Ga0307414_10090562
697 Ga0307414_10097819
698 Ga0395900_0070984
699 Ga0439439_0052153
700 Ga0451795_1372635
701 Ga0451833_1103729
702 Ga0451835_0143687
703 Ga0451837_0602560
704 Ga0451837_0629985
705 Ga0451841_0622163
706 Ga0451845_0541100
707 Ga0451846_21688
708 Ga0451847_0120876
709 Ga0451849_1553131
710 Ga0451851_0718869
711 Ga0451854_16362
712 Ga0451853_0592169
713 Ga0439445_0015047
714 Ga0439432_060043
715 Ga0439449_0016539
716 Ga0439449_0034642
717 Ga0439462_0072674
718 Ga0495592_0227437
719 Ga0495638_0254473
720 Ga0495651_0119997
721 Ga0495650_0097271
722 Ga0495605_0023814
723 Ga0495607_0055151
724 Ga0495583_0010441
725 Ga0495606_0028221
726 Ga0495610_0001284
727 Ga0495610_0084495
728 Ga0495610_0149266
729 Ga0495616_0029910
730 Ga0495620_0008324
731 Ga0495632_0010504
732 Ga0495632_0023287
733 Ga0495643_0007330
734 Ga0495643_0019929
735 Ga0495643_0057970
736 Ga0495643_0065317
737 Ga0495648_0016246
738 Ga0495652_0097799
739 Ga0495654_0001905
740 Ga0495587_0099502
741 Ga0495609_0090334
742 Ga0495597_0020023
743 Ga0495622_0021567
744 Ga0495633_0054801
745 Ga0495656_0096855
746 Ga0495611_0047914
747 Ga0495625_0043877
748 Ga0495625_0109808
749 Ga0495625_0181831
750 Ga0495635_0052547
751 Ga0495661_0056455
752 Ga0495661_0184016
753 Ga0495657_0010582
754 Ga0495646_0266971
755 Ga0495624_0083039
756 Ga0495589_0287119
757 Ga0495660_0042236
758 Ga0495604_0008895
759 Ga0495636_0107834
760 Ga0495672_0052077
761 Ga0495687_012523
762 Ga0495686_0014886
763 Ga0495686_0017574
764 Ga0495686_0190709
765 Ga0496101_0046834
766 Ga0496101_0082911
767 Ga0496101_0158444
768 Ga0496102_0070167
769 Ga0496103_0178295
770 Ga0496104_0093226
771 Ga0496105_0080307
772 Ga0496106_0001054
773 Ga0496107_0154555
774 Ga0496107_0181528
775 Ga0496111_0026731
776 Ga0496113_0049301
777 Ga0496114_0163759
778 Ga0496116_0003082
779 Ga0496116_0012537
780 Ga0496116_0017728
781 Ga0496116_0046798
782 Ga0496116_0058169
783 Ga0496116_0079117
784 Ga0496116_0109240
785 Ga0496117_0024813
786 Ga0496118_0014245
787 Ga0496118_0022203
788 Ga0496118_0023607
789 Ga0496118_0028387
790 Ga0496119_0031580
791 Ga0496119_0094603
792 Ga0496121_0001531
793 Ga0496121_0026114
794 Ga0496121_0035236
795 Ga0496121_0039195
796 Ga0496121_0050502
797 Ga0496121_0112780
798 Ga0496121_0128427
799 Ga0496121_0241126
800 Ga0496122_0013481
801 Ga0496122_0023236
802 Ga0496122_0032126
803 Ga0496122_0064920
804 Ga0496122_0081062
805 Ga0496123_0005261
806 Ga0496123_0046270
807 Ga0496123_0070960
808 Ga0496124_0010044
809 Ga0496124_0014104
810 Ga0496124_0027396
811 Ga0496124_0156693
812 Ga0496125_0019828
813 Ga0496125_0069658
814 Ga0496126_0054005
815 Ga0496126_0195993
816 Ga0496126_0211615
817 Ga0495678_007538
818 Ga0501034_0001662
819 Ga0501034_0069100
820 Ga0501036_0332995
821 Ga0501037_0048825
822 Ga0501073_0053231
823 Ga0501083_0048394
824 nmdc:mga00v17_241_c1
825 nmdc:mga0yw44_1036_c1
826 nmdc:mga0k408_109141_c1
827 nmdc:mga06z11_59920_c1
828 nmdc:mga06z11_66931_c1
829 nmdc:mga07m45_48238_c1
830 Ga0495619_0123203
831 Ga0500618_002031
832 Ga0500658_0000715
833 Ga0500658_0054605
834 Ga0500559_0018359
835 Ga0500568_0006560
836 Ga0500590_002985
837 Ga0500616_0000577
838 Ga0500616_0002510
839 Ga0500616_0010239
840 Ga0500622_0000429
841 Ga0500611_030869
842 2509391857
843 2510839535
844 2510895558
845 2511133279
846 2511182530
847 2511199197
848 2513567800
849 2513577122
850 2513599942
851 2513633208
852 2513707787
853 2513865866
854 2513908598
855 2513925235
856 2514018129
857 2515113231
858 2515636820
859 2515646314
860 2515655170
861 2515739655
862 2517036891
863 2517077252
864 2517096010
865 2517407629
866 2520377076
867 2524458796
868 2530646626
869 2535517050
870 2561468650
871 2585202048
872 2585223027
873 2585228465
874 2585258330
875 2585271291
876 2585279230
877 2585323165
878 2585331273
879 2585400899
880 2585524679
881 2585531285
882 2585538367
883 2585545610
884 2585552792
885 2585559036
886 2585822199
887 2585836320
888 2585843405
889 2585898416
890 2585904017
891 2585996613
892 2586001141
893 2587980865
894 2599417143
895 2599721541
896 2600194800
897 2600374166
898 2616293189
899 2616311397
900 2617386258
901 2643776345
902 2643794792
903 2643811371
904 2644007091
905 2644242511
906 2644298804
907 2644657033
908 2644675869
909 2719181968
910 2719386579
911 2719666326
912 2719732685
913 2720492746
914 2720614215
915 2720620983
916 2720632307
917 2720776035
918 2721148059
919 2721159510
920 2721164895
921 2721400283
922 2722841065
923 2723027634
924 2723561262
925 2723567885
926 2724039096
927 2724045441
928 2724090642
929 2724105150
930 2724110978
931 2725951430
932 2730108570
933 2730165203
934 2730299142
935 2738800260
936 2739033008
937 2766066048
938 2776914119
939 2793294266
940 2793315919
941 2793319347
942 2793328433
943 2793335390
944 2793347078
945 2793351670
946 2793361968
947 2793367723
948 2805926901
949 2805932816
950 2806045147
951 2806050058
952 2806056896
953 2806064277
954 2806071545
955 2819241195
956 2819641390
957 2819685093
958 2821127354
959 2838021623
960 2838023683
961 2838038651
962 2838045139
963 2838053382
964 2838065502
965 2838069981
966 2838661427
967 2838670531
968 2838683283
969 2838686875
970 2838697773
971 2838702902
972 2838710889
973 2838730167
974 2838737878
975 2838742818
976 2841841753
977 2841852321
978 2841867128
979 2842079062
980 2842113092
981 2842118428
982 2842141531
983 2842147840
984 2842158221
985 2842168620
986 2842181841
987 2842195888
988 2842199197
989 2842209646
990 2842218117
991 2842230108
992 2842240339
993 2842243997
994 2842252906
995 2842257918
996 2842269454
997 2842271587
998 2842283100
999 2842285436
1000 2842292724
1001 2842298144
1002 2842305218
1003 2842314052
1004 2842324384
1005 2842347348
1006 2842360256
1007 2842370157
1008 2842373914
1009 2842379122
1010 2842384938
1011 2842400176
1012 2842402796
1013 2842409833
1014 2842416482
1015 2842423595
1016 2842430544
1017 2842436644
1018 2842443514
1019 2842449384
1020 2842466798
1021 2842471486
1022 2842483908
1023 2842492239
1024 2842502589
1025 2842510937
1026 2844458172
1027 2852390419
1028 2854901284
1029 2854918659
1030 2857517250
1031 2857532230
1032 2889796046
1033 2889919849
1034 2891049751
1035 2899804197
1036 2919106287
1037 2919172899
1038 2920825442
1039 2923559274
1040 2933020835
1041 2933571025
1042 2933588851
1043 2933600787
1044 2935896841
1045 2935901782
1046 2936371866
1047 2936379700
1048 2936387871
1049 2989776053
1050 2989779361
1051 2996892870
1052 2996894975
1053 3005414398
1054 3005417529
1055 3005448622
1056 639649349
1057 8005248908
1058 8005259363
1059 8005281385
1060 8005284646
1061 8005295687
1062 8005303300
1063 8005309565
1064 8005315682
1065 8005327397
1066 8005381102
1067 8005388948
1068 8005395931
1069 8005437453
1070 8005463914
1071 8005489033
1072 8005501066
1073 8005545864
1074 8005556847
1075 8005568171
1076 8005573290
1077 8005622433
1078 8005629934
1079 8005658903
1080 8005672483
1081 8005691928
1082 8005697579
1083 8018128031
1084 8018164398
1085 8018176881
1086 8023682995
1087 8024482693
1088 8024488206
1089 8024504606
1090 8046771779
1091 8055432448
1092 8056378312
1093 8056384247
1094 8056875718
1095 8057575537
1096 8057878490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

3

177

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ofv-assembly1.cif.gz_C crystal structure of peptidyl-trna hydrolase from escherichia coli, i222 crystal form 0.9361 1 171
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9318 2 175
5imb-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase mutant-n14d from vibrio cholerae 0.9302 1 182
4olj-assembly1.cif.gz_A crystal structure of arg119gln mutant of peptidyl-trna hydrolase from acinetobacter baumannii at 1.49 a resolution 0.9298 1 182
4zxp-assembly3.cif.gz_A crystal structure of peptidyl- trna hydrolase from vibrio cholerae 0.9253 1 182
ID Description Score Start End Superfamily
af_F1M8A9_28_144_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9141 2 107 3.40.50.1470
af_Q10LI6_46_183_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9122 2 131 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9119 1 182 3.40.50.1470
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9098 1 175 3.40.50.1470
af_Q86Y79_27_209_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9034 2 175 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A7C1P4V1-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9779 1 151 GO:0004045
GO:0005737
GO:0006412
AF-A0A1W9I528-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9775 1 187 GO:0004045
GO:0005737
GO:0006412
AF-A0A2E5L551-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9758 1 186 GO:0004045
GO:0005737
GO:0006412
AF-A0A0Q4FF18-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9744 1 187 GO:0004045
GO:0005737
GO:0006412
AF-A0A1U9KKT1-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9742 1 187 GO:0004045
GO:0005737
GO:0006412

Map