metagRoot

F462344

General Info

Members	Datasets	Scaffolds	Average Seq Length
549	250	547	283

Family's Representative Sequence

Representative Sequence	3300006871\|Ga0075434_100030497\|Ga0075434_1000304974
Length	304
Sequence	MSVSTAAPSPAVPSRAAGLPLASRLAAFRTEGLPVIPIVILLVLMFTAVFAEFIVPHNPEVGSLSQRFKPPVWIAGGSSAHLLGTDHIGRDVLSRLIFGARVSMIVGFTAVIFAGVLGTALGIVSGYFGGWVDQVIMRVTDTWLALPALTFAIFLAAIVGPSEWNIVIILGAVYWTRYARVIRGEVLSLKERDFVRLAIVAGCSKWKIMRKHILPNVLNSAIVLATLMLGVVIVTEAALSFLGVGVPPPKPAWGLMLADGKKGLMAGYWWLTVFPGVCIVLMVLSANLLGDWLRVKLDPQLRQL

Samples

	Sample ID	Description	Type	Environment
1	2916971899	Alkalihalobacillus miscanthi AK13	Isolate	Rhizosphere
2	2919450847	Ancylobacter sp. 3268	Isolate	Rhizosphere
3	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
4	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
5	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
6	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
7	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
8	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
9	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
10	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
11	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
12	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
13	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
14	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
15	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
16	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
17	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
18	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
19	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
20	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
21	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
22	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
23	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
24	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
25	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
26	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
27	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
28	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
29	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
30	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
31	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
32	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
33	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
34	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
35	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
36	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
37	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
38	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
39	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
40	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
41	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
42	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
43	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
44	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
45	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
46	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
47	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
48	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
49	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
50	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
51	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
52	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
53	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
54	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
55	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
56	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
57	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
58	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
59	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
60	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
61	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
62	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
63	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
65	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
66	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
68	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
69	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
70	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
71	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
72	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
73	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
74	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
75	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
76	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
77	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
78	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
79	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
80	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
81	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
82	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
83	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
84	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
85	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
86	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
87	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
88	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
89	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
90	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
136	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
140	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
141	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
142	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
143	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
144	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
145	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
146	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
147	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
148	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
149	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
150	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
151	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
152	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
153	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
154	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
155	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
156	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
157	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
158	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
159	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
160	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
161	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
162	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
163	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
164	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
165	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
166	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
167	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
168	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
169	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
170	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
171	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
172	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
173	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
174	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
175	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
176	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
177	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
178	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
179	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
180	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
181	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
182	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
183	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
184	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
185	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
186	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
187	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
188	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
189	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
190	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
191	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
192	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
193	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
194	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
195	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
196	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
197	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
198	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
199	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
200	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
201	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
202	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
203	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
204	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
205	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
206	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
207	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
208	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
209	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
210	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
211	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
212	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
213	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
214	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
215	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
216	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
217	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
218	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
219	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
220	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
221	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
222	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
223	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
224	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
225	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
226	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
227	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
228	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
229	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
230	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
231	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
232	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
233	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
234	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
235	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
236	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
237	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
238	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
239	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
240	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
241	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
242	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
243	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
244	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
245	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
246	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
247	3300059504	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
248	3300059646	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
249	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
250	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.72
Metatranscriptomes	0.91
Isolates	0.36

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2
Nodule	0
Rhizoplane	2.73
Rhizosphere	94.17
Stem	0
Stem Tuber	0
Unclassified	1.09

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10057238	3300003203	Unclassified	1275
2	Ga0070690_100047268	3300005330	Bacteria	2738
3	Ga0070690_100178902	3300005330	Bacteria	1465
4	Ga0068869_100010180	3300005334	Bacteria	6123
5	Ga0070680_100023019	3300005336	Bacteria	4965
6	Ga0070680_100283095	3300005336	Bacteria	1405
7	Ga0070689_100093751	3300005340	Bacteria	2370
8	Ga0070691_10001306	3300005341	Bacteria	10581
9	Ga0070691_10041358	3300005341	Bacteria	2179
10	Ga0070691_10170426	3300005341	Bacteria	1128
11	Ga0070661_100036789	3300005344	Bacteria	3558
12	Ga0070669_100066673	3300005353	Bacteria	2654
13	Ga0070674_100074583	3300005356	Bacteria	2408
14	Ga0070673_100082142	3300005364	Bacteria	2615
15	Ga0070673_100185650	3300005364	Bacteria	1782
16	Ga0070659_100220917	3300005366	Bacteria	1564
17	Ga0070703_10011632	3300005406	Bacteria	2488
18	Ga0070703_10015466	3300005406	Bacteria	2183
19	Ga0070714_100094967	3300005435	Bacteria	2618
20	Ga0070701_10004446	3300005438	Bacteria	5681
21	Ga0070701_10134864	3300005438	Bacteria	1406
22	Ga0070705_100013022	3300005440	Bacteria	4244
23	Ga0070705_100101479	3300005440	Bacteria	1818
24	Ga0070705_100103288	3300005440	Bacteria	1804
25	Ga0070700_100036815	3300005441	Bacteria	2971
26	Ga0070694_100004360	3300005444	Bacteria	8507
27	Ga0070694_100047963	3300005444	Bacteria	2872
28	Ga0070694_100057177	3300005444	Bacteria	2651
29	Ga0070694_100144773	3300005444	Bacteria	1730
30	Ga0070678_100124692	3300005456	Bacteria	2036
31	Ga0070662_100068033	3300005457	Bacteria	2617
32	Ga0070681_10227042	3300005458	Bacteria	1782
33	Ga0070681_10518024	3300005458	Bacteria	1106
34	Ga0068867_100049511	3300005459	Bacteria	3094
35	Ga0068867_100218019	3300005459	Bacteria	1536
36	Ga0070706_100029003	3300005467	Bacteria	5097
37	Ga0070706_100041777	3300005467	Bacteria	4234
38	Ga0070706_100073920	3300005467	Bacteria	3156
39	Ga0070706_100075770	3300005467	Bacteria	3114
40	Ga0070706_100185198	3300005467	Bacteria	1945
41	Ga0070706_100203258	3300005467	Bacteria	1850
42	Ga0070707_100004668	3300005468	Bacteria	12831
43	Ga0070707_100042921	3300005468	Bacteria	4330
44	Ga0070707_100117242	3300005468	Bacteria	2584
45	Ga0070707_100182610	3300005468	Bacteria	2045
46	Ga0070698_100003620	3300005471	Bacteria	16986
47	Ga0070698_100073429	3300005471	Bacteria	3427
48	Ga0070698_100081656	3300005471	Bacteria	3226
49	Ga0070698_100445921	3300005471	Bacteria	1230
50	Ga0070699_100029439	3300005518	Bacteria	4734
51	Ga0070699_100030865	3300005518	Bacteria	4626
52	Ga0070679_100081658	3300005530	Bacteria	3222
53	Ga0070679_100216637	3300005530	Unclassified	1877
54	Ga0070684_100003405	3300005535	Bacteria	11934
55	Ga0070697_100102244	3300005536	Bacteria	2381
56	Ga0070697_100268904	3300005536	Bacteria	1461
57	Ga0068853_100467448	3300005539	Bacteria	1188
58	Ga0070672_100014565	3300005543	Bacteria	5576
59	Ga0070686_100141230	3300005544	Bacteria	1677
60	Ga0070695_100000486	3300005545	Bacteria	20702
61	Ga0070695_100005906	3300005545	Bacteria	7223
62	Ga0070695_100006683	3300005545	Bacteria	6819
63	Ga0070695_100006977	3300005545	Bacteria	6692
64	Ga0070695_100030571	3300005545	Bacteria	3354
65	Ga0070696_100006808	3300005546	Bacteria	7632
66	Ga0070665_100423047	3300005548	Bacteria	1341
67	Ga0070704_100023823	3300005549	Bacteria	4006
68	Ga0070704_100037034	3300005549	Bacteria	3329
69	Ga0070704_100059931	3300005549	Bacteria	2717
70	Ga0070704_100159070	3300005549	Bacteria	1785
71	Ga0070704_100164686	3300005549	Bacteria	1757
72	Ga0068855_100047139	3300005563	Bacteria	5092
73	Ga0068855_100107060	3300005563	Bacteria	3212
74	Ga0068857_100004916	3300005577	Bacteria	11340
75	Ga0068856_100029378	3300005614	Bacteria	5370
76	Ga0068856_100096072	3300005614	Bacteria	2952
77	Ga0068856_100679883	3300005614	Bacteria	1050
78	Ga0068852_100019640	3300005616	Bacteria	5354
79	Ga0068866_10160323	3300005718	Bacteria	1311
80	Ga0068861_100090766	3300005719	Bacteria	2411
81	Ga0068861_100149343	3300005719	Bacteria	1916
82	Ga0068863_100122637	3300005841	Bacteria	2479
83	Ga0068863_100479640	3300005841	Bacteria	1223
84	Ga0068860_100116823	3300005843	Bacteria	2552
85	Ga0068860_100230487	3300005843	Bacteria	1800
86	Ga0068862_100054736	3300005844	Bacteria	3416
87	Ga0068862_100065352	3300005844	Bacteria	3133
88	Ga0068862_100164322	3300005844	Bacteria	1983
89	Ga0081455_10000302	3300005937	Bacteria	65101
90	Ga0081455_10000666	3300005937	Bacteria	44517
91	Ga0081540_1033259	3300005983	Bacteria	2802
92	Ga0081539_10000020	3300005985	Bacteria	366549
93	Ga0075365_10152600	3300006038	Bacteria	1607
94	Ga0070716_100093733	3300006173	Bacteria	1824
95	Ga0070712_100103053	3300006175	Bacteria	2115
96	Ga0070712_100139027	3300006175	Bacteria	1851
97	Ga0075369_10014460	3300006186	Bacteria	3153
98	Ga0075369_10105602	3300006186	Bacteria	1266
99	Ga0075370_10138624	3300006353	Bacteria	1421
100	Ga0075428_100001365	3300006844	Bacteria	25940
101	Ga0075428_100002513	3300006844	Bacteria	19932
102	Ga0075428_100002795	3300006844	Bacteria	18990
103	Ga0075428_100004121	3300006844	Bacteria	16002
104	Ga0075428_100039429	3300006844	Bacteria	5199
105	Ga0075428_100204396	3300006844	Bacteria	2135
106	Ga0075428_100213671	3300006844	Bacteria	2084
107	Ga0075428_100594518	3300006844	Bacteria	1182
108	Ga0075428_100609597	3300006844	Bacteria	1166
109	Ga0075430_100000052	3300006846	Bacteria	60703
110	Ga0075430_100003056	3300006846	Bacteria	13990
111	Ga0075430_100008106	3300006846	Bacteria	8881
112	Ga0075430_100079600	3300006846	Bacteria	2746
113	Ga0075430_100097897	3300006846	Bacteria	2451
114	Ga0075430_100140448	3300006846	Bacteria	2012
115	Ga0075430_100287322	3300006846	Bacteria	1360
116	Ga0075431_100000038	3300006847	Bacteria	68191
117	Ga0075431_100000309	3300006847	Bacteria	38472
118	Ga0075431_100003208	3300006847	Bacteria	15823
119	Ga0075431_100003560	3300006847	Bacteria	15083
120	Ga0075431_100007008	3300006847	Bacteria	11202
121	Ga0075431_100028574	3300006847	Bacteria	5733
122	Ga0075431_100037217	3300006847	Bacteria	5015
123	Ga0075431_100050327	3300006847	Bacteria	4296
124	Ga0075431_100146686	3300006847	Bacteria	2432
125	Ga0075433_10016949	3300006852	Bacteria	6020
126	Ga0075433_10036035	3300006852	Bacteria	4259
127	Ga0075433_10077845	3300006852	Bacteria	2921
128	Ga0075433_10080881	3300006852	Bacteria	2864
129	Ga0075433_10161872	3300006852	Bacteria	1992
130	Ga0075433_10162649	3300006852	Bacteria	1987
131	Ga0075433_10212773	3300006852	Bacteria	1718
132	Ga0075433_10264177	3300006852	Bacteria	1525
133	Ga0075433_10272616	3300006852	Bacteria	1500
134	Ga0075434_100030497	3300006871	Bacteria	5310
135	Ga0075434_100069045	3300006871	Bacteria	3522
136	Ga0075434_100096127	3300006871	Bacteria	2968
137	Ga0075434_100123969	3300006871	Bacteria	2600
138	Ga0075434_100163274	3300006871	Bacteria	2247
139	Ga0075434_100437403	3300006871	Bacteria	1329
140	Ga0075434_100651254	3300006871	Unclassified	1072
141	Ga0075429_100000898	3300006880	Bacteria	23530
142	Ga0075429_100004919	3300006880	Bacteria	11517
143	Ga0075429_100004927	3300006880	Bacteria	11504
144	Ga0075429_100029569	3300006880	Bacteria	4758
145	Ga0075429_100091607	3300006880	Bacteria	2652
146	Ga0075429_100184156	3300006880	Bacteria	1830
147	Ga0075435_100003234	3300007076	Bacteria	11027
148	Ga0075435_100014830	3300007076	Bacteria	5842
149	Ga0075435_100034131	3300007076	Bacteria	4028
150	Ga0075435_100098773	3300007076	Bacteria	2417
151	Ga0075435_100215666	3300007076	Bacteria	1629
152	Ga0099794_10006950	3300007265	Bacteria	4615
153	Ga0099794_10077387	3300007265	Bacteria	1636
154	Ga0111539_10000552	3300009094	Bacteria	47861
155	Ga0111539_10004281	3300009094	Bacteria	18675
156	Ga0111539_10113883	3300009094	Bacteria	3172
157	Ga0111539_10128679	3300009094	Bacteria	2966
158	Ga0111539_10248727	3300009094	Bacteria	2070
159	Ga0111539_10340568	3300009094	Bacteria	1746
160	Ga0111539_10537460	3300009094	Bacteria	1362
161	Ga0111539_10852033	3300009094	Bacteria	1060
162	Ga0105245_10391694	3300009098	Bacteria	1386
163	Ga0105247_10300078	3300009101	Bacteria	1114
164	Ga0105247_10394175	3300009101	Bacteria	985
165	Ga0114129_10000919	3300009147	Bacteria	38401
166	Ga0114129_10002604	3300009147	Bacteria	25084
167	Ga0114129_10009756	3300009147	Bacteria	13694
168	Ga0114129_10016331	3300009147	Bacteria	10568
169	Ga0114129_10016728	3300009147	Bacteria	10446
170	Ga0114129_10016827	3300009147	Bacteria	10410
171	Ga0114129_10044316	3300009147	Bacteria	6258
172	Ga0114129_10056789	3300009147	Bacteria	5481
173	Ga0114129_10099934	3300009147	Bacteria	4014
174	Ga0114129_10305772	3300009147	Bacteria	2118
175	Ga0114129_10360925	3300009147	Bacteria	1922
176	Ga0114129_10521735	3300009147	Bacteria	1549
177	Ga0114129_10600362	3300009147	Bacteria	1426
178	Ga0114129_10857813	3300009147	Bacteria	1154
179	Ga0105243_10034011	3300009148	Bacteria	3944
180	Ga0105243_10146589	3300009148	Bacteria	2020
181	Ga0105243_10184410	3300009148	Bacteria	1817
182	Ga0105241_10049300	3300009174	Bacteria	3206
183	Ga0105242_10013272	3300009176	Bacteria	6361
184	Ga0105248_10052063	3300009177	Bacteria	4594
185	Ga0105248_10167472	3300009177	Bacteria	2477
186	Ga0105238_10013568	3300009551	Bacteria	8226
187	Ga0105249_10257934	3300009553	Bacteria	1731
188	Ga0105249_10409967	3300009553	Bacteria	1387
189	Ga0105246_10210075	3300011119	Bacteria	1519
190	Ga0157371_10047325	3300013102	Bacteria	3058
191	Ga0157370_10597115	3300013104	Bacteria	1011
192	Ga0157369_10038752	3300013105	Bacteria	5210
193	Ga0157374_10155548	3300013296	Bacteria	2225
194	Ga0157374_10172217	3300013296	Bacteria	2112
195	Ga0157378_10085835	3300013297	Bacteria	2852
196	Ga0163162_10149302	3300013306	Bacteria	2454
197	Ga0157372_10114313	3300013307	Bacteria	3094
198	Ga0157372_10888242	3300013307	Bacteria	1034
199	Ga0157375_10031764	3300013308	Bacteria	4998
200	Ga0163163_10084127	3300014325	Bacteria	3187
201	Ga0182008_10096729	3300014497	Bacteria	1457
202	Ga0163161_10296578	3300017792	Bacteria	1272
203	Ga0206356_10548587	3300020070	Bacteria	1489
204	Ga0206350_11380830	3300020080	Bacteria	1189
205	Ga0213876_10237204	3300021384	Bacteria	969
206	Ga0224712_10012862	3300022467	Bacteria	2648
207	Ga0207426_1046375	3300025302	Bacteria	1316
208	Ga0207653_10021994	3300025885	Bacteria	2025
209	Ga0207653_10049843	3300025885	Bacteria	1391
210	Ga0207647_10064617	3300025904	Bacteria	2223
211	Ga0207647_10141531	3300025904	Bacteria	1410
212	Ga0207685_10013532	3300025905	Bacteria	2526
213	Ga0207643_10062898	3300025908	Bacteria	2121
214	Ga0207684_10030532	3300025910	Bacteria	4587
215	Ga0207684_10040928	3300025910	Bacteria	3929
216	Ga0207684_10041705	3300025910	Bacteria	3890
217	Ga0207684_10056676	3300025910	Bacteria	3325
218	Ga0207684_10251082	3300025910	Bacteria	1526
219	Ga0207693_10052009	3300025915	Bacteria	3213
220	Ga0207693_10111503	3300025915	Bacteria	2146
221	Ga0207660_10366235	3300025917	Bacteria	1157
222	Ga0207657_10116574	3300025919	Bacteria	2201
223	Ga0207649_10022741	3300025920	Bacteria	3622
224	Ga0207652_10050772	3300025921	Bacteria	3554
225	Ga0207646_10035476	3300025922	Bacteria	4504
226	Ga0207646_10050043	3300025922	Bacteria	3741
227	Ga0207646_10058200	3300025922	Bacteria	3452
228	Ga0207646_10178122	3300025922	Bacteria	1920
229	Ga0207694_10032416	3300025924	Bacteria	4000
230	Ga0207650_10256101	3300025925	Bacteria	1418
231	Ga0207659_10057627	3300025926	Bacteria	2786
232	Ga0207706_10031319	3300025933	Bacteria	4739
233	Ga0207706_10049981	3300025933	Bacteria	3695
234	Ga0207706_10055724	3300025933	Bacteria	3485
235	Ga0207686_10049117	3300025934	Bacteria	2617
236	Ga0207686_10105481	3300025934	Bacteria	1890
237	Ga0207709_10013989	3300025935	Bacteria	4430
238	Ga0207665_10000522	3300025939	Bacteria	25926
239	Ga0207691_10035022	3300025940	Bacteria	4665
240	Ga0207691_10217369	3300025940	Bacteria	1658
241	Ga0207711_10181224	3300025941	Bacteria	1916
242	Ga0207689_10005613	3300025942	Bacteria	11180
243	Ga0207689_10012502	3300025942	Bacteria	7252
244	Ga0207661_10020435	3300025944	Bacteria	4950
245	Ga0207679_10011214	3300025945	Bacteria	5792
246	Ga0207712_10129746	3300025961	Bacteria	1919
247	Ga0207712_10220247	3300025961	Bacteria	1517
248	Ga0207668_10033646	3300025972	Bacteria	3397
249	Ga0207668_10337103	3300025972	Bacteria	1257
250	Ga0207677_10232308	3300026023	Bacteria	1486
251	Ga0207639_10031224	3300026041	Bacteria	3914
252	Ga0207702_10006161	3300026078	Bacteria	10379
253	Ga0207702_10063224	3300026078	Bacteria	3164
254	Ga0207641_10065111	3300026088	Bacteria	3117
255	Ga0207641_10308901	3300026088	Bacteria	1496
256	Ga0207648_10110621	3300026089	Bacteria	2412
257	Ga0207648_10153788	3300026089	Bacteria	2030
258	Ga0207648_10188273	3300026089	Bacteria	1828
259	Ga0207676_10403143	3300026095	Bacteria	1279
260	Ga0207674_10003977	3300026116	Bacteria	17968
261	Ga0207674_10523885	3300026116	Bacteria	1145
262	Ga0207675_100060260	3300026118	Bacteria	3543
263	Ga0207675_100060331	3300026118	Bacteria	3541
264	Ga0207675_100130311	3300026118	Bacteria	2384
265	Ga0207675_100164904	3300026118	Bacteria	2115
266	Ga0207683_10139314	3300026121	Bacteria	2185
267	Ga0207698_10021425	3300026142	Bacteria	4470
268	Ga0209981_1001844	3300027378	Bacteria	2695
269	Ga0209982_1002551	3300027552	Bacteria	2563
270	Ga0209970_1000999	3300027614	Bacteria	5030
271	Ga0210002_1003634	3300027617	Bacteria	2281
272	Ga0209983_1000359	3300027665	Bacteria	9610
273	Ga0209983_1008156	3300027665	Bacteria	2142
274	Ga0209588_1003205	3300027671	Bacteria	4517
275	Ga0209971_1000091	3300027682	Bacteria	27342
276	Ga0209971_1023439	3300027682	Bacteria	1473
277	Ga0209966_1000471	3300027695	Bacteria	10948
278	Ga0209966_1029230	3300027695	Bacteria	1110
279	Ga0209998_10000487	3300027717	Bacteria	10916
280	Ga0209974_10000497	3300027876	Bacteria	13125
281	Ga0207428_10000173	3300027907	Bacteria	90064
282	Ga0207428_10005690	3300027907	Bacteria	11584
283	Ga0207428_10028359	3300027907	Bacteria	4652
284	Ga0207428_10094552	3300027907	Bacteria	2317
285	Ga0268266_10176261	3300028379	Bacteria	1944
286	Ga0268266_10290582	3300028379	Bacteria	1522
287	Ga0268266_10559387	3300028379	Bacteria	1096
288	Ga0268265_10045342	3300028380	Bacteria	3280
289	Ga0268265_10057568	3300028380	Bacteria	2963
290	Ga0268264_10148547	3300028381	Bacteria	2099
291	Ga0307408_100014396	3300031548	Bacteria	5254
292	Ga0307408_100047261	3300031548	Bacteria	3081
293	Ga0307406_10090638	3300031901	Bacteria	2058
294	Ga0307416_100020346	3300032002	Bacteria	4733
295	Ga0307416_100124457	3300032002	Bacteria	2306
296	Ga0307416_100379428	3300032002	Bacteria	1443
297	Ga0307411_10069133	3300032005	Bacteria	2384
298	Ga0373958_0011565	3300034819	Bacteria	1494
299	Ga0373929_0019172	3300035085	Bacteria	1367
300	Ga0373940_0056931	3300035088	Bacteria	1110
301	Ga0373932_0025365	3300035112	Bacteria	1604
302	Ga0373939_0003477	3300035114	Bacteria	3697
303	Ga0373945_0043832	3300035116	Bacteria	1625
304	Ga0373953_0002546	3300035117	Bacteria	5506
305	Ga0373953_0116865	3300035117	Bacteria	1131
306	Ga0373954_0010485	3300035118	Bacteria	4089
307	Ga0373954_0086383	3300035118	Bacteria	1503
308	Ga0373956_0033976	3300035119	Bacteria	2245
309	Ga0373961_0001772	3300035241	Bacteria	5961
310	Ga0373962_0006367	3300035242	Bacteria	2859
311	Ga0373931_0001525	3300035691	Bacteria	9986
312	Ga0373931_0011575	3300035691	Bacteria	4261
313	Ga0373935_0421911	3300035692	Bacteria	960
314	Ga0373927_0060036	3300035695	Bacteria	2460
315	Ga0373933_0006509	3300035724	Bacteria	6360
316	Ga0373933_0035959	3300035724	Bacteria	2896
317	Ga0373947_0024333	3300035725	Bacteria	3529
318	Ga0373947_0112780	3300035725	Bacteria	1720
319	Ga0373937_0003961	3300036401	Bacteria	12519
320	Ga0373937_0005068	3300036401	Bacteria	11213
321	Ga0373925_0072582	3300037068	Bacteria	2604
322	Ga0395899_0019687	3300037312	Bacteria	5124
323	Ga0395900_0015260	3300037418	Bacteria	7833
324	Ga0395900_0033238	3300037418	Bacteria	5309
325	Ga0395898_0021228	3300037466	Bacteria	6587
326	Ga0395901_0015493	3300038443	Bacteria	7762
327	Ga0395901_0021176	3300038443	Bacteria	6659
328	Ga0395901_0360982	3300038443	Bacteria	1498
329	Ga0242420_006449	3300038996	Bacteria	1854
330	Ga0436365_1637095	3300039437	Bacteria	3023
331	Ga0436362_0597598	3300039453	Bacteria	1316
332	Ga0439460_0003075	3300042461	Bacteria	4033
333	Ga0439460_0020358	3300042461	Bacteria	1803
334	Ga0451577_0002345	3300042876	Bacteria	22791
335	Ga0451577_0030609	3300042876	Bacteria	4862
336	Ga0451577_0105087	3300042876	Bacteria	2524
337	Ga0453683_0014510	3300044673	Bacteria	5112
338	Ga0453683_0021239	3300044673	Bacteria	4145
339	Ga0453684_0021719	3300044712	Bacteria	9569
340	Ga0451576_0005434	3300045051	Bacteria	15978
341	Ga0451576_0053050	3300045051	Bacteria	4249
342	Ga0451576_0144686	3300045051	Bacteria	2478
343	Ga0451576_0355353	3300045051	Bacteria	1534
344	Ga0495592_0087330	3300046454	Bacteria	2244
345	Ga0495638_0006471	3300046460	Bacteria	8520
346	Ga0495580_0203499	3300046472	Bacteria	1364
347	Ga0495584_0080535	3300046491	Bacteria	1639
348	Ga0495594_0123576	3300046499	Bacteria	1464
349	Ga0495594_0216361	3300046499	Bacteria	1092
350	Ga0495628_0096459	3300046516	Bacteria	2284
351	Ga0495640_0093768	3300046533	Bacteria	1978
352	Ga0495656_0004975	3300046615	Bacteria	4578
353	Ga0495599_0041473	3300046678	Bacteria	2890
354	Ga0495658_0128836	3300046683	Bacteria	1538
355	Ga0495658_0258622	3300046683	Bacteria	1096
356	Ga0495669_0050276	3300046684	Bacteria	1869
357	Ga0495674_0120764	3300047319	Bacteria	2214
358	Ga0496101_0095823	3300048904	Bacteria	2214
359	Ga0496102_0044173	3300048905	Bacteria	4043
360	Ga0496102_0166379	3300048905	Bacteria	2075
361	Ga0496102_0257210	3300048905	Bacteria	1646
362	Ga0496103_0015830	3300048906	Bacteria	4497
363	Ga0496104_0029980	3300048907	Bacteria	5051
364	Ga0496105_0083681	3300048908	Bacteria	2635
365	Ga0496107_0156770	3300048910	Bacteria	1686
366	Ga0496108_0026850	3300048911	Bacteria	4752
367	Ga0496108_0055272	3300048911	Bacteria	3333
368	Ga0496109_0020386	3300048912	Bacteria	5856
369	Ga0496110_0026516	3300048913	Bacteria	4960
370	Ga0496110_0063298	3300048913	Bacteria	3268
371	Ga0496111_0090599	3300048914	Bacteria	2240
372	Ga0496114_0127528	3300048917	Bacteria	2194
373	Ga0496119_0000546	3300048922	Bacteria	51240
374	Ga0496122_0002881	3300048925	Bacteria	23547
375	Ga0496123_0005437	3300048926	Bacteria	12825
376	Ga0496126_0027540	3300048929	Bacteria	5427
377	Ga0501031_0063074	3300049568	Bacteria	2415
378	Ga0501033_0055416	3300049570	Bacteria	2931
379	Ga0501033_0251018	3300049570	Bacteria	1254
380	Ga0501033_0287657	3300049570	Bacteria	1159
381	Ga0501034_0001551	3300049571	Bacteria	30141
382	Ga0501034_0005696	3300049571	Bacteria	13542
383	Ga0501034_0559236	3300049571	Bacteria	1053
384	Ga0501034_0593761	3300049571	Bacteria	1013
385	Ga0501036_0244287	3300049572	Bacteria	1505
386	Ga0501038_0204474	3300049574	Bacteria	1583
387	Ga0501039_0010436	3300049575	Bacteria	7078
388	Ga0501039_0114487	3300049575	Bacteria	2110
389	Ga0501040_0184780	3300049576	Bacteria	1478
390	Ga0501041_0002268	3300049577	Bacteria	10876
391	Ga0501041_0122101	3300049577	Bacteria	1619
392	Ga0501042_0004738	3300049578	Bacteria	8684
393	Ga0501042_0224816	3300049578	Bacteria	1354
394	Ga0501043_0077379	3300049579	Bacteria	2614
395	Ga0501046_0000256	3300049580	Bacteria	54366
396	Ga0501046_0043384	3300049580	Bacteria	3581
397	Ga0501046_0177130	3300049580	Bacteria	1597
398	Ga0501046_0242836	3300049580	Bacteria	1328
399	Ga0501046_0417689	3300049580	Bacteria	967
400	Ga0501047_0031300	3300049581	Bacteria	5131
401	Ga0501048_0015816	3300049582	Bacteria	5566
402	Ga0501067_0014703	3300049583	Bacteria	4330
403	Ga0501068_0003189	3300049584	Bacteria	8782
404	Ga0501069_0048946	3300049585	Bacteria	2349
405	Ga0501069_0052978	3300049585	Bacteria	2260
406	Ga0501070_0450073	3300049586	Bacteria	1038
407	Ga0501070_0533406	3300049586	Bacteria	941
408	Ga0501071_0031991	3300049587	Bacteria	3733
409	Ga0501071_0132005	3300049587	Bacteria	1856
410	Ga0501071_0143229	3300049587	Bacteria	1781
411	Ga0501072_0028873	3300049588	Bacteria	4330
412	Ga0501072_0055625	3300049588	Bacteria	3118
413	Ga0501072_0055626	3300049588	Bacteria	3118
414	Ga0501072_0099772	3300049588	Bacteria	2308
415	Ga0501072_0104538	3300049588	Bacteria	2252
416	Ga0501072_0121234	3300049588	Bacteria	2083
417	Ga0501074_0034129	3300049590	Bacteria	3688
418	Ga0501074_0357526	3300049590	Bacteria	1036
419	Ga0501075_0003599	3300049591	Bacteria	10385
420	Ga0501075_0080905	3300049591	Bacteria	2459
421	Ga0501075_0097622	3300049591	Bacteria	2230
422	Ga0501075_0129245	3300049591	Bacteria	1924
423	Ga0501076_0002735	3300049592	Bacteria	12207
424	Ga0501076_0004588	3300049592	Bacteria	9833
425	Ga0501076_0005794	3300049592	Bacteria	8914
426	Ga0501076_0188170	3300049592	Bacteria	1684
427	Ga0501076_0301746	3300049592	Bacteria	1313
428	Ga0501076_0542287	3300049592	Bacteria	959
429	Ga0501077_0002642	3300049593	Bacteria	10733
430	Ga0501077_0053630	3300049593	Bacteria	2560
431	Ga0501077_0249450	3300049593	Bacteria	1129
432	Ga0501079_0002601	3300049741	Bacteria	13121
433	Ga0501079_0005395	3300049741	Bacteria	9524
434	Ga0501079_0053889	3300049741	Bacteria	3103
435	Ga0501079_0136058	3300049741	Bacteria	1913
436	Ga0501079_0236116	3300049741	Bacteria	1428
437	Ga0501080_0087696	3300049742	Bacteria	2891
438	Ga0501080_0149411	3300049742	Bacteria	2160
439	Ga0501080_0311233	3300049742	Bacteria	1427
440	Ga0501081_0002007	3300049743	Bacteria	12673
441	Ga0501081_0038180	3300049743	Bacteria	3279
442	Ga0501081_0095777	3300049743	Bacteria	2093
443	Ga0501081_0129196	3300049743	Bacteria	1804
444	Ga0501081_0210372	3300049743	Bacteria	1412
445	Ga0501083_0004985	3300049744	Bacteria	9413
446	Ga0501083_0053708	3300049744	Bacteria	2705
447	Ga0501045_0000178	3300049824	Bacteria	35077
448	Ga0501045_0096279	3300049824	Bacteria	2190
449	Ga0501045_0110250	3300049824	Bacteria	2040
450	Ga0501045_0179213	3300049824	Bacteria	1579
451	nmdc:mga03683_56283_c1	3300050489	Bacteria	1653
452	nmdc:mga06z11_111188_c1	3300050494	Bacteria	1517
453	nmdc:mga05p37_113254_c1	3300050507	Bacteria	3335
454	nmdc:mga05p37_15883_c1	3300050507	Bacteria	9057
455	nmdc:mga05p37_29407_c1	3300050507	Bacteria	6705
456	nmdc:mga05p37_30746_c1	3300050507	Bacteria	6553
457	nmdc:mga05p37_38575_c1	3300050507	Bacteria	5860
458	nmdc:mga05p37_390182_c1	3300050507	Bacteria	1629
459	nmdc:mga05p37_422611_c1	3300050507	Bacteria	1551
460	nmdc:mga05p37_4960_c1	3300050507	Bacteria	15593
461	nmdc:mga05p37_5898_c1	3300050507	Bacteria	14410
462	nmdc:mga05p37_652662_c1	3300050507	Bacteria	1178
463	nmdc:mga05p37_74134_c1	3300050507	Bacteria	4189
464	nmdc:mga05p37_8835_c1	3300050507	Bacteria	11903
465	nmdc:mga09592_124616_c1	3300050508	Bacteria	2214
466	nmdc:mga09592_1465_c1	3300050508	Bacteria	18943
467	nmdc:mga09592_194728_c1	3300050508	Bacteria	1755
468	nmdc:mga09592_26346_c1	3300050508	Bacteria	4816
469	nmdc:mga09592_7120_c1	3300050508	Bacteria	9093
470	nmdc:mga09592_73577_c1	3300050508	Bacteria	2903
471	nmdc:mga09592_88982_c1	3300050508	Bacteria	2637
472	nmdc:mga0qj67_140130_c1	3300050509	Bacteria	1961
473	nmdc:mga0qj67_15200_c1	3300050509	Bacteria	5826
474	nmdc:mga0qj67_30561_c1	3300050509	Bacteria	4194
475	nmdc:mga0qj67_364310_c1	3300050509	Bacteria	1168
476	nmdc:mga0qj67_449_c1	3300050509	Bacteria	28141
477	nmdc:mga0qj67_5329_c1	3300050509	Bacteria	9382
478	nmdc:mga0qj67_71070_c1	3300050509	Bacteria	2777
479	nmdc:mga06r32_1206_c1	3300050510	Bacteria	23285
480	nmdc:mga06r32_161042_c1	3300050510	Bacteria	2227
481	nmdc:mga06r32_282795_c1	3300050510	Bacteria	1646
482	nmdc:mga06r32_29446_c1	3300050510	Bacteria	5146
483	nmdc:mga06r32_29463_c1	3300050510	Bacteria	5145
484	nmdc:mga06r32_37763_c1	3300050510	Bacteria	4569
485	nmdc:mga06r32_40957_c1	3300050510	Bacteria	4400
486	nmdc:mga06r32_4577_c1	3300050510	Bacteria	12400
487	nmdc:mga06r32_4734_c1	3300050510	Bacteria	12237
488	nmdc:mga06r32_5623_c1	3300050510	Bacteria	11275
489	nmdc:mga06r32_75773_c1	3300050510	Bacteria	3266
490	nmdc:mga06r32_966_c1	3300050510	Bacteria	25673
491	nmdc:mga08y16_12285_c1	3300050511	Bacteria	9003
492	nmdc:mga08y16_164755_c1	3300050511	Bacteria	2303
493	nmdc:mga08y16_171520_c1	3300050511	Bacteria	2253
494	nmdc:mga08y16_181022_c1	3300050511	Bacteria	2189
495	nmdc:mga08y16_2085_c1	3300050511	Bacteria	20512
496	nmdc:mga08y16_559732_c1	3300050511	Bacteria	1156
497	nmdc:mga08y16_83181_c1	3300050511	Bacteria	3336
498	nmdc:mga0n895_109937_c1	3300050512	Bacteria	2772
499	nmdc:mga0n895_130456_c1	3300050512	Bacteria	2538
500	nmdc:mga0n895_156062_c1	3300050512	Bacteria	2313
501	nmdc:mga0n895_17105_c1	3300050512	Bacteria	6678
502	nmdc:mga0n895_217483_c1	3300050512	Bacteria	1940
503	nmdc:mga0n895_50835_c1	3300050512	Bacteria	4065
504	nmdc:mga0n895_567804_c1	3300050512	Bacteria	1139
505	nmdc:mga0n895_65749_c1	3300050512	Bacteria	3590
506	nmdc:mga0rr50_12033_c1	3300050513	Bacteria	3854
507	nmdc:mga0rr50_15534_c1	3300050513	Bacteria	5029
508	nmdc:mga0rr50_6209_c1	3300050513	Bacteria	7244
509	nmdc:mga08x19_2285_c1	3300050514	Bacteria	11635
510	nmdc:mga08x19_82235_c1	3300050514	Bacteria	2116
511	nmdc:mga08x19_88983_c1	3300050514	Bacteria	2036
512	nmdc:mga0a205_12064_c1	3300050515	Bacteria	6964
513	nmdc:mga0a205_148663_c1	3300050515	Bacteria	2243
514	nmdc:mga0a205_16698_c1	3300050515	Bacteria	3184
515	nmdc:mga0a205_217470_c1	3300050515	Bacteria	1797
516	nmdc:mga0a205_2612_c1	3300050515	Bacteria	15917
517	nmdc:mga0a205_342726_c1	3300050515	Bacteria	1363
518	nmdc:mga0a205_353862_c1	3300050515	Bacteria	1336
519	nmdc:mga0a205_36620_c1	3300050515	Bacteria	4715
520	nmdc:mga0a205_460716_c1	3300050515	Bacteria	1131
521	nmdc:mga0a205_4755_c1	3300050515	Bacteria	12202
522	nmdc:mga0a205_85448_c1	3300050515	Bacteria	3047
523	nmdc:mga0a205_98794_c1	3300050515	Bacteria	2817
524	nmdc:mga0sz30_13173_c2	3300050516	Bacteria	2770
525	nmdc:mga0sz30_51673_c1	3300050516	Bacteria	1744
526	Ga0495601_0079689	3300053077	Bacteria	2100
527	Ga0495619_0035758	3300053085	Bacteria	3232
528	Ga0495619_0039442	3300053085	Bacteria	3083
529	Ga0500646_0053349	3300053090	Bacteria	1172
530	Ga0500556_0000431	3300053104	Bacteria	29930
531	Ga0501084_0002999	3300054114	Bacteria	13674
532	Ga0501084_0013238	3300054114	Bacteria	6827
533	Ga0501084_0029766	3300054114	Bacteria	4568
534	Ga0501084_0256596	3300054114	Bacteria	1476
535	Ga0590071_019838	3300059421	Bacteria	1583
536	Ga0590075_018354	3300059424	Bacteria	1730
537	Ga0587082_011752	3300059504	Bacteria	1287
538	Ga0587078_001161	3300059646	Bacteria	2276
539	Ga0501082_0005151	3300060353	Bacteria	11379
540	Ga0501082_0012756	3300060353	Bacteria	7222
541	Ga0501082_0053769	3300060353	Bacteria	3470
542	Ga0501082_0292033	3300060353	Bacteria	1419
543	Ga0530510_0000152	3300061734	Bacteria	41201
544	Ga0530510_0052644	3300061734	Bacteria	2941
545	Ga0530510_0061626	3300061734	Bacteria	2716
546	Ga0530510_0144342	3300061734	Bacteria	1755
547	Ga0530510_0175877	3300061734	Bacteria	1586

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049742	Ga0501080_0311233	Ga0501080_0311233_337_1071	227
2	3300046683	Ga0495658_0258622	Ga0495658_0258622_18_839	230
3	3300049580	Ga0501046_0417689	Ga0501046_0417689_13_825	234
4	3300050507	nmdc:mga05p37_30746_c1	nmdc:mga05p37_30746_c1_1164_1976	235
5	3300050508	nmdc:mga09592_88982_c1	nmdc:mga09592_88982_c1_44_856	235
6	3300050509	nmdc:mga0qj67_364310_c1	nmdc:mga0qj67_364310_c1_312_1124	235
7	3300050510	nmdc:mga06r32_29446_c1	nmdc:mga06r32_29446_c1_3959_4771	235
8	3300009147	Ga0114129_10099934	Ga0114129_100999343	237
9	3300035118	Ga0373954_0086383	Ga0373954_0086383_210_1022	237
10	3300037418	Ga0395900_0033238	Ga0395900_0033238_3235_4047	237
11	3300037466	Ga0395898_0021228	Ga0395898_0021228_4844_5656	237
12	3300038443	Ga0395901_0021176	Ga0395901_0021176_4830_5642	237
13	3300048925	Ga0496122_0002881	Ga0496122_0002881_8570_9439	237
14	3300048926	Ga0496123_0005437	Ga0496123_0005437_11762_12631	237
15	3300050507	nmdc:mga05p37_390182_c1	nmdc:mga05p37_390182_c1_396_1208	237
16	3300050515	nmdc:mga0a205_36620_c1	nmdc:mga0a205_36620_c1_2031_2843	237
17	3300053104	Ga0500556_0000431	Ga0500556_0000431_2861_3730	237
18	3300035112	Ga0373932_0025365	Ga0373932_0025365_303_1115	238
19	3300035691	Ga0373931_0001525	Ga0373931_0001525_7496_8308	238
20	3300048905	Ga0496102_0044173	Ga0496102_0044173_3207_4019	238
21	3300048906	Ga0496103_0015830	Ga0496103_0015830_1866_2678	238
22	3300050511	nmdc:mga08y16_559732_c1	nmdc:mga08y16_559732_c1_333_1145	238
23	iso_pu_bacteria	2919450847	2919450961	238
24	3300006852	Ga0075433_10077845	Ga0075433_100778453	240
25	3300009094	Ga0111539_10340568	Ga0111539_103405683	240
26	3300050512	nmdc:mga0n895_156062_c1	nmdc:mga0n895_156062_c1_1207_2127	240
27	3300048922	Ga0496119_0000546	Ga0496119_0000546_2492_3361	241
28	3300005983	Ga0081540_1033259	Ga0081540_10332593	242
29	3300046460	Ga0495638_0006471	Ga0495638_0006471_2238_3107	243
30	3300053090	Ga0500646_0053349	Ga0500646_0053349_255_1139	243
31	3300005353	Ga0070669_100066673	Ga0070669_1000666733	246
32	3300005543	Ga0070672_100014565	Ga0070672_1000145656	246
33	3300005719	Ga0068861_100090766	Ga0068861_1000907662	246
34	3300005843	Ga0068860_100230487	Ga0068860_1002304872	246
35	3300025933	Ga0207706_10049981	Ga0207706_100499814	246
36	3300025934	Ga0207686_10105481	Ga0207686_101054812	246
37	3300025935	Ga0207709_10013989	Ga0207709_100139893	246
38	3300025940	Ga0207691_10035022	Ga0207691_100350224	246
39	3300026088	Ga0207641_10308901	Ga0207641_103089011	246
40	3300028381	Ga0268264_10148547	Ga0268264_101485472	246
41	3300026089	Ga0207648_10110621	Ga0207648_101106213	247
42	3300050494	nmdc:mga06z11_111188_c1	nmdc:mga06z11_111188_c1_681_1493	248
43	3300005330	Ga0070690_100047268	Ga0070690_1000472682	250
44	3300005438	Ga0070701_10134864	Ga0070701_101348642	250
45	3300005544	Ga0070686_100141230	Ga0070686_1001412301	250
46	3300005841	Ga0068863_100479640	Ga0068863_1004796401	250
47	3300009094	Ga0111539_10537460	Ga0111539_105374602	250
48	3300009177	Ga0105248_10052063	Ga0105248_100520632	250
49	3300025961	Ga0207712_10129746	Ga0207712_101297462	250
50	iso_pu_bacteria	2916971899	2916974218	251
51	3300006844	Ga0075428_100002795	Ga0075428_10000279520	252
52	3300009094	Ga0111539_10004281	Ga0111539_1000428111	252
53	3300025972	Ga0207668_10033646	Ga0207668_100336462	252
54	3300026118	Ga0207675_100060260	Ga0207675_1000602603	252
55	3300027907	Ga0207428_10005690	Ga0207428_1000569011	252
56	3300046615	Ga0495656_0004975	Ga0495656_0004975_1350_2249	252
57	3300050511	nmdc:mga08y16_12285_c1	nmdc:mga08y16_12285_c1_3589_4488	252
58	3300037312	Ga0395899_0019687	Ga0395899_0019687_571_1461	253
59	3300005356	Ga0070674_100074583	Ga0070674_1000745832	254
60	3300005458	Ga0070681_10518024	Ga0070681_105180242	254
61	3300005530	Ga0070679_100216637	Ga0070679_1002166371	254
62	3300006852	Ga0075433_10016949	Ga0075433_100169496	254
63	3300006852	Ga0075433_10036035	Ga0075433_100360353	254
64	3300007076	Ga0075435_100098773	Ga0075435_1000987732	254
65	3300009094	Ga0111539_10113883	Ga0111539_101138832	254
66	3300027907	Ga0207428_10094552	Ga0207428_100945523	254
67	3300034819	Ga0373958_0011565	Ga0373958_0011565_102_980	254
68	3300035085	Ga0373929_0019172	Ga0373929_0019172_242_1120	254
69	3300035114	Ga0373939_0003477	Ga0373939_0003477_1794_2672	254
70	3300035241	Ga0373961_0001772	Ga0373961_0001772_336_1214	254
71	3300035242	Ga0373962_0006367	Ga0373962_0006367_833_1711	254
72	3300035691	Ga0373931_0011575	Ga0373931_0011575_1093_1971	254
73	3300042876	Ga0451577_0105087	Ga0451577_0105087_83_943	254
74	3300045051	Ga0451576_0355353	Ga0451576_0355353_526_1431	254
75	3300050511	nmdc:mga08y16_181022_c1	nmdc:mga08y16_181022_c1_774_1652	254
76	3300050512	nmdc:mga0n895_65749_c1	nmdc:mga0n895_65749_c1_2041_2919	254
77	3300050515	nmdc:mga0a205_2612_c1	nmdc:mga0a205_2612_c1_3404_4282	254
78	3300006844	Ga0075428_100002513	Ga0075428_1000025136	255
79	3300006846	Ga0075430_100000052	Ga0075430_10000005240	255
80	3300006847	Ga0075431_100037217	Ga0075431_1000372174	255
81	3300006880	Ga0075429_100000898	Ga0075429_1000008988	255
82	3300009147	Ga0114129_10016728	Ga0114129_100167285	255
83	3300035117	Ga0373953_0002546	Ga0373953_0002546_1519_2409	255
84	3300035118	Ga0373954_0010485	Ga0373954_0010485_2245_3135	255
85	3300035119	Ga0373956_0033976	Ga0373956_0033976_773_1663	255
86	3300035724	Ga0373933_0006509	Ga0373933_0006509_1816_2706	255
87	3300036401	Ga0373937_0003961	Ga0373937_0003961_8908_9798	255
88	3300046533	Ga0495640_0093768	Ga0495640_0093768_263_1153	255
89	3300050507	nmdc:mga05p37_5898_c1	nmdc:mga05p37_5898_c1_7807_8712	255
90	3300050508	nmdc:mga09592_1465_c1	nmdc:mga09592_1465_c1_6244_7149	255
91	3300050509	nmdc:mga0qj67_5329_c1	nmdc:mga0qj67_5329_c1_7360_8265	255
92	3300050510	nmdc:mga06r32_1206_c1	nmdc:mga06r32_1206_c1_11569_12474	255
93	3300053077	Ga0495601_0079689	Ga0495601_0079689_916_1806	255
94	3300053085	Ga0495619_0039442	Ga0495619_0039442_603_1493	255
95	3300007265	Ga0099794_10077387	Ga0099794_100773872	256
96	3300013104	Ga0157370_10597115	Ga0157370_105971151	256
97	3300028379	Ga0268266_10559387	Ga0268266_105593871	256
98	3300049588	Ga0501072_0055625	Ga0501072_0055625_384_1280	256
99	3300049824	Ga0501045_0110250	Ga0501045_0110250_649_1545	256
100	3300060353	Ga0501082_0292033	Ga0501082_0292033_201_1097	256
101	3300005545	Ga0070695_100000486	Ga0070695_1000004862	257
102	3300006186	Ga0075369_10014460	Ga0075369_100144603	257
103	3300006846	Ga0075430_100097897	Ga0075430_1000978973	257
104	3300025926	Ga0207659_10057627	Ga0207659_100576272	257
105	3300026095	Ga0207676_10403143	Ga0207676_104031431	257
106	3300026118	Ga0207675_100060331	Ga0207675_1000603313	257
107	3300045051	Ga0451576_0053050	Ga0451576_0053050_2023_2910	257
108	3300048905	Ga0496102_0166379	Ga0496102_0166379_92_970	257
109	3300049577	Ga0501041_0122101	Ga0501041_0122101_131_1015	257
110	3300049588	Ga0501072_0028873	Ga0501072_0028873_1409_2293	257
111	3300049591	Ga0501075_0097622	Ga0501075_0097622_603_1487	257
112	3300049592	Ga0501076_0005794	Ga0501076_0005794_4839_5723	257
113	3300049593	Ga0501077_0002642	Ga0501077_0002642_6194_7078	257
114	3300049741	Ga0501079_0005395	Ga0501079_0005395_689_1573	257
115	3300049743	Ga0501081_0038180	Ga0501081_0038180_1482_2366	257
116	3300050516	nmdc:mga0sz30_13173_c2	nmdc:mga0sz30_13173_c2_216_1106	257
117	3300005330	Ga0070690_100178902	Ga0070690_1001789022	258
118	3300005364	Ga0070673_100185650	Ga0070673_1001856502	258
119	3300005456	Ga0070678_100124692	Ga0070678_1001246922	258
120	3300006871	Ga0075434_100437403	Ga0075434_1004374031	258
121	3300009147	Ga0114129_10016331	Ga0114129_100163316	258
122	3300013296	Ga0157374_10155548	Ga0157374_101555482	258
123	3300025925	Ga0207650_10256101	Ga0207650_102561012	258
124	3300025940	Ga0207691_10217369	Ga0207691_102173692	258
125	3300026118	Ga0207675_100130311	Ga0207675_1001303112	258
126	3300026121	Ga0207683_10139314	Ga0207683_101393142	258
127	3300035088	Ga0373940_0056931	Ga0373940_0056931_53_934	258
128	3300037068	Ga0373925_0072582	Ga0373925_0072582_1588_2493	258
129	3300042461	Ga0439460_0020358	Ga0439460_0020358_578_1459	258
130	3300049586	Ga0501070_0450073	Ga0501070_0450073_23_910	258
131	3300049587	Ga0501071_0143229	Ga0501071_0143229_454_1335	258
132	3300049588	Ga0501072_0099772	Ga0501072_0099772_800_1681	258
133	3300049592	Ga0501076_0301746	Ga0501076_0301746_210_1091	258
134	3300050507	nmdc:mga05p37_8835_c1	nmdc:mga05p37_8835_c1_7930_8814	258
135	3300050508	nmdc:mga09592_194728_c1	nmdc:mga09592_194728_c1_795_1670	258
136	3300050509	nmdc:mga0qj67_140130_c1	nmdc:mga0qj67_140130_c1_807_1682	258
137	3300050509	nmdc:mga0qj67_15200_c1	nmdc:mga0qj67_15200_c1_4870_5745	258
138	3300050510	nmdc:mga06r32_161042_c1	nmdc:mga06r32_161042_c1_579_1454	258
139	3300050510	nmdc:mga06r32_40957_c1	nmdc:mga06r32_40957_c1_978_1853	258
140	3300050515	nmdc:mga0a205_217470_c1	nmdc:mga0a205_217470_c1_305_1186	258
141	3300059646	Ga0587078_001161	Ga0587078_001161_465_1358	258
142	3300061734	Ga0530510_0052644	Ga0530510_0052644_133_1014	258
143	3300061734	Ga0530510_0061626	Ga0530510_0061626_1603_2499	258
144	3300005467	Ga0070706_100075770	Ga0070706_1000757703	259
145	3300005471	Ga0070698_100003620	Ga0070698_10000362014	259
146	3300006846	Ga0075430_100003056	Ga0075430_1000030563	259
147	3300006847	Ga0075431_100007008	Ga0075431_10000700810	259
148	3300006880	Ga0075429_100184156	Ga0075429_1001841562	259
149	3300009101	Ga0105247_10394175	Ga0105247_103941751	259
150	3300009147	Ga0114129_10016827	Ga0114129_1001682710	259
151	3300009147	Ga0114129_10521735	Ga0114129_105217353	259
152	3300009553	Ga0105249_10409967	Ga0105249_104099672	259
153	3300013306	Ga0163162_10149302	Ga0163162_101493022	259
154	3300014325	Ga0163163_10084127	Ga0163163_100841273	259
155	3300014497	Ga0182008_10096729	Ga0182008_100967291	259
156	3300020080	Ga0206350_11380830	Ga0206350_113808301	259
157	3300022467	Ga0224712_10012862	Ga0224712_100128622	259
158	3300025910	Ga0207684_10251082	Ga0207684_102510822	259
159	3300025922	Ga0207646_10178122	Ga0207646_101781222	259
160	3300048904	Ga0496101_0095823	Ga0496101_0095823_440_1318	259
161	3300048905	Ga0496102_0257210	Ga0496102_0257210_349_1227	259
162	3300048907	Ga0496104_0029980	Ga0496104_0029980_3834_4712	259
163	3300048908	Ga0496105_0083681	Ga0496105_0083681_1279_2157	259
164	3300048910	Ga0496107_0156770	Ga0496107_0156770_186_1064	259
165	3300048911	Ga0496108_0055272	Ga0496108_0055272_1589_2467	259
166	3300048912	Ga0496109_0020386	Ga0496109_0020386_3577_4455	259
167	3300048913	Ga0496110_0026516	Ga0496110_0026516_3183_4061	259
168	3300048917	Ga0496114_0127528	Ga0496114_0127528_810_1688	259
169	3300049588	Ga0501072_0055626	Ga0501072_0055626_1644_2567	259
170	3300049590	Ga0501074_0357526	Ga0501074_0357526_49_972	259
171	3300049743	Ga0501081_0095777	Ga0501081_0095777_717_1640	259
172	3300050507	nmdc:mga05p37_74134_c1	nmdc:mga05p37_74134_c1_1161_2066	259
173	3300050508	nmdc:mga09592_124616_c1	nmdc:mga09592_124616_c1_817_1722	259
174	3300050509	nmdc:mga0qj67_449_c1	nmdc:mga0qj67_449_c1_2118_3023	259
175	3300050510	nmdc:mga06r32_5623_c1	nmdc:mga06r32_5623_c1_2209_3114	259
176	3300050511	nmdc:mga08y16_171520_c1	nmdc:mga08y16_171520_c1_484_1359	259
177	3300050512	nmdc:mga0n895_17105_c1	nmdc:mga0n895_17105_c1_1682_2560	259
178	3300050513	nmdc:mga0rr50_12033_c1	nmdc:mga0rr50_12033_c1_664_1542	259
179	3300050514	nmdc:mga08x19_2285_c1	nmdc:mga08x19_2285_c1_546_1445	259
180	3300061734	Ga0530510_0175877	Ga0530510_0175877_422_1345	259
181	3300005467	Ga0070706_100185198	Ga0070706_1001851982	260
182	3300005536	Ga0070697_100268904	Ga0070697_1002689042	260
183	3300005548	Ga0070665_100423047	Ga0070665_1004230472	260
184	3300005614	Ga0068856_100096072	Ga0068856_1000960721	260
185	3300005614	Ga0068856_100679883	Ga0068856_1006798832	260
186	3300005843	Ga0068860_100116823	Ga0068860_1001168232	260
187	3300005937	Ga0081455_10000302	Ga0081455_1000030249	260
188	3300006175	Ga0070712_100103053	Ga0070712_1001030532	260
189	3300006844	Ga0075428_100039429	Ga0075428_1000394293	260
190	3300006844	Ga0075428_100204396	Ga0075428_1002043962	260
191	3300006844	Ga0075428_100594518	Ga0075428_1005945181	260
192	3300006846	Ga0075430_100287322	Ga0075430_1002873222	260
193	3300006852	Ga0075433_10161872	Ga0075433_101618722	260
194	3300006871	Ga0075434_100096127	Ga0075434_1000961272	260
195	3300006871	Ga0075434_100651254	Ga0075434_1006512541	260
196	3300006880	Ga0075429_100091607	Ga0075429_1000916073	260
197	3300007076	Ga0075435_100003234	Ga0075435_1000032344	260
198	3300009094	Ga0111539_10248727	Ga0111539_102487272	260
199	3300009147	Ga0114129_10000919	Ga0114129_1000091932	260
200	3300009147	Ga0114129_10360925	Ga0114129_103609252	260
201	3300009148	Ga0105243_10184410	Ga0105243_101844102	260
202	3300013296	Ga0157374_10172217	Ga0157374_101722172	260
203	3300025910	Ga0207684_10056676	Ga0207684_100566762	260
204	3300026078	Ga0207702_10063224	Ga0207702_100632242	260
205	3300027907	Ga0207428_10028359	Ga0207428_100283593	260
206	3300028379	Ga0268266_10176261	Ga0268266_101762612	260
207	3300028379	Ga0268266_10290582	Ga0268266_102905822	260
208	3300032005	Ga0307411_10069133	Ga0307411_100691333	260
209	3300035116	Ga0373945_0043832	Ga0373945_0043832_130_1026	260
210	3300048929	Ga0496126_0027540	Ga0496126_0027540_1626_2522	260
211	3300049570	Ga0501033_0287657	Ga0501033_0287657_90_974	260
212	3300049577	Ga0501041_0002268	Ga0501041_0002268_7447_8331	260
213	3300049579	Ga0501043_0077379	Ga0501043_0077379_801_1685	260
214	3300049580	Ga0501046_0043384	Ga0501046_0043384_2570_3454	260
215	3300049580	Ga0501046_0242836	Ga0501046_0242836_415_1302	260
216	3300049591	Ga0501075_0080905	Ga0501075_0080905_457_1344	260
217	3300049592	Ga0501076_0004588	Ga0501076_0004588_1427_2311	260
218	3300049593	Ga0501077_0053630	Ga0501077_0053630_323_1210	260
219	3300049741	Ga0501079_0136058	Ga0501079_0136058_417_1304	260
220	3300049742	Ga0501080_0149411	Ga0501080_0149411_389_1273	260
221	3300049743	Ga0501081_0002007	Ga0501081_0002007_5748_6632	260
222	3300049824	Ga0501045_0179213	Ga0501045_0179213_179_1063	260
223	3300050507	nmdc:mga05p37_15883_c1	nmdc:mga05p37_15883_c1_7769_8653	260
224	3300050508	nmdc:mga09592_73577_c1	nmdc:mga09592_73577_c1_278_1162	260
225	3300050511	nmdc:mga08y16_83181_c1	nmdc:mga08y16_83181_c1_1699_2580	260
226	3300050512	nmdc:mga0n895_217483_c1	nmdc:mga0n895_217483_c1_679_1563	260
227	3300050513	nmdc:mga0rr50_6209_c1	nmdc:mga0rr50_6209_c1_1139_2023	260
228	3300050515	nmdc:mga0a205_16698_c1	nmdc:mga0a205_16698_c1_497_1381	260
229	3300054114	Ga0501084_0002999	Ga0501084_0002999_10637_11521	260
230	3300054114	Ga0501084_0256596	Ga0501084_0256596_363_1250	260
231	3300060353	Ga0501082_0012756	Ga0501082_0012756_41_925	260
232	3300005340	Ga0070689_100093751	Ga0070689_1000937512	261
233	3300005341	Ga0070691_10170426	Ga0070691_101704262	261
234	3300005364	Ga0070673_100082142	Ga0070673_1000821422	261
235	3300005406	Ga0070703_10011632	Ga0070703_100116322	261
236	3300005440	Ga0070705_100103288	Ga0070705_1001032882	261
237	3300005444	Ga0070694_100004360	Ga0070694_10000436011	261
238	3300005467	Ga0070706_100203258	Ga0070706_1002032582	261
239	3300005545	Ga0070695_100030571	Ga0070695_1000305712	261
240	3300005563	Ga0068855_100107060	Ga0068855_1001070603	261
241	3300005719	Ga0068861_100149343	Ga0068861_1001493432	261
242	3300005841	Ga0068863_100122637	Ga0068863_1001226372	261
243	3300006038	Ga0075365_10152600	Ga0075365_101526002	261
244	3300006173	Ga0070716_100093733	Ga0070716_1000937332	261
245	3300006175	Ga0070712_100139027	Ga0070712_1001390272	261
246	3300006353	Ga0075370_10138624	Ga0075370_101386242	261
247	3300006844	Ga0075428_100001365	Ga0075428_10000136512	261
248	3300006846	Ga0075430_100008106	Ga0075430_1000081063	261
249	3300006846	Ga0075430_100079600	Ga0075430_1000796002	261
250	3300006846	Ga0075430_100140448	Ga0075430_1001404482	261
251	3300006847	Ga0075431_100000309	Ga0075431_1000003094	261
252	3300006847	Ga0075431_100003560	Ga0075431_10000356010	261
253	3300006847	Ga0075431_100028574	Ga0075431_1000285743	261
254	3300006847	Ga0075431_100050327	Ga0075431_1000503274	261
255	3300006847	Ga0075431_100146686	Ga0075431_1001466862	261
256	3300006852	Ga0075433_10080881	Ga0075433_100808813	261
257	3300006852	Ga0075433_10162649	Ga0075433_101626492	261
258	3300006871	Ga0075434_100069045	Ga0075434_1000690452	261
259	3300006871	Ga0075434_100123969	Ga0075434_1001239693	261
260	3300006880	Ga0075429_100004919	Ga0075429_1000049195	261
261	3300006880	Ga0075429_100004927	Ga0075429_1000049275	261
262	3300007076	Ga0075435_100014830	Ga0075435_1000148305	261
263	3300007076	Ga0075435_100215666	Ga0075435_1002156662	261
264	3300007265	Ga0099794_10006950	Ga0099794_100069505	261
265	3300009101	Ga0105247_10300078	Ga0105247_103000782	261
266	3300009147	Ga0114129_10002604	Ga0114129_1000260417	261
267	3300009147	Ga0114129_10044316	Ga0114129_100443164	261
268	3300009147	Ga0114129_10056789	Ga0114129_100567894	261
269	3300009147	Ga0114129_10305772	Ga0114129_103057723	261
270	3300009147	Ga0114129_10600362	Ga0114129_106003622	261
271	3300009177	Ga0105248_10167472	Ga0105248_101674723	261
272	3300013308	Ga0157375_10031764	Ga0157375_100317642	261
273	3300017792	Ga0163161_10296578	Ga0163161_102965781	261
274	3300025915	Ga0207693_10052009	Ga0207693_100520093	261
275	3300025922	Ga0207646_10050043	Ga0207646_100500433	261
276	3300025939	Ga0207665_10000522	Ga0207665_100005224	261
277	3300025941	Ga0207711_10181224	Ga0207711_101812242	261
278	3300026023	Ga0207677_10232308	Ga0207677_102323082	261
279	3300026088	Ga0207641_10065111	Ga0207641_100651112	261
280	3300026118	Ga0207675_100164904	Ga0207675_1001649042	261
281	3300027665	Ga0209983_1008156	Ga0209983_10081562	261
282	3300027671	Ga0209588_1003205	Ga0209588_10032053	261
283	3300027682	Ga0209971_1023439	Ga0209971_10234392	261
284	3300027695	Ga0209966_1029230	Ga0209966_10292302	261
285	3300031548	Ga0307408_100014396	Ga0307408_1000143963	261
286	3300031548	Ga0307408_100047261	Ga0307408_1000472612	261
287	3300031901	Ga0307406_10090638	Ga0307406_100906382	261
288	3300032002	Ga0307416_100020346	Ga0307416_1000203464	261
289	3300032002	Ga0307416_100124457	Ga0307416_1001244572	261
290	3300035117	Ga0373953_0116865	Ga0373953_0116865_93_986	261
291	3300035692	Ga0373935_0421911	Ga0373935_0421911_49_942	261
292	3300035695	Ga0373927_0060036	Ga0373927_0060036_1142_2026	261
293	3300035724	Ga0373933_0035959	Ga0373933_0035959_1652_2545	261
294	3300035725	Ga0373947_0024333	Ga0373947_0024333_2317_3210	261
295	3300035725	Ga0373947_0112780	Ga0373947_0112780_524_1405	261
296	3300036401	Ga0373937_0005068	Ga0373937_0005068_77_970	261
297	3300038443	Ga0395901_0360982	Ga0395901_0360982_436_1320	261
298	3300045051	Ga0451576_0005434	Ga0451576_0005434_12052_12942	261
299	3300046454	Ga0495592_0087330	Ga0495592_0087330_255_1148	261
300	3300046472	Ga0495580_0203499	Ga0495580_0203499_408_1289	261
301	3300046499	Ga0495594_0123576	Ga0495594_0123576_238_1119	261
302	3300046499	Ga0495594_0216361	Ga0495594_0216361_69_953	261
303	3300046516	Ga0495628_0096459	Ga0495628_0096459_584_1477	261
304	3300046678	Ga0495599_0041473	Ga0495599_0041473_1640_2533	261
305	3300046683	Ga0495658_0128836	Ga0495658_0128836_237_1121	261
306	3300047319	Ga0495674_0120764	Ga0495674_0120764_276_1169	261
307	3300048911	Ga0496108_0026850	Ga0496108_0026850_1098_1979	261
308	3300048913	Ga0496110_0063298	Ga0496110_0063298_1258_2139	261
309	3300048914	Ga0496111_0090599	Ga0496111_0090599_736_1617	261
310	3300049571	Ga0501034_0005696	Ga0501034_0005696_6302_7189	261
311	3300049571	Ga0501034_0559236	Ga0501034_0559236_155_1036	261
312	3300049575	Ga0501039_0114487	Ga0501039_0114487_698_1582	261
313	3300049578	Ga0501042_0224816	Ga0501042_0224816_260_1141	261
314	3300049580	Ga0501046_0177130	Ga0501046_0177130_35_919	261
315	3300049583	Ga0501067_0014703	Ga0501067_0014703_1207_2091	261
316	3300049584	Ga0501068_0003189	Ga0501068_0003189_2811_3698	261
317	3300049585	Ga0501069_0052978	Ga0501069_0052978_303_1187	261
318	3300049586	Ga0501070_0533406	Ga0501070_0533406_32_919	261
319	3300049587	Ga0501071_0132005	Ga0501071_0132005_102_983	261
320	3300049588	Ga0501072_0104538	Ga0501072_0104538_351_1232	261
321	3300049588	Ga0501072_0121234	Ga0501072_0121234_796_1680	261
322	3300049591	Ga0501075_0129245	Ga0501075_0129245_909_1790	261
323	3300049592	Ga0501076_0542287	Ga0501076_0542287_49_930	261
324	3300049593	Ga0501077_0249450	Ga0501077_0249450_60_941	261
325	3300049741	Ga0501079_0053889	Ga0501079_0053889_696_1580	261
326	3300049744	Ga0501083_0053708	Ga0501083_0053708_593_1474	261
327	3300049824	Ga0501045_0096279	Ga0501045_0096279_417_1301	261
328	3300050507	nmdc:mga05p37_38575_c1	nmdc:mga05p37_38575_c1_3062_3946	261
329	3300050507	nmdc:mga05p37_422611_c1	nmdc:mga05p37_422611_c1_55_963	261
330	3300050507	nmdc:mga05p37_4960_c1	nmdc:mga05p37_4960_c1_10747_11631	261
331	3300050507	nmdc:mga05p37_652662_c1	nmdc:mga05p37_652662_c1_191_1099	261
332	3300050508	nmdc:mga09592_26346_c1	nmdc:mga09592_26346_c1_1558_2442	261
333	3300050508	nmdc:mga09592_7120_c1	nmdc:mga09592_7120_c1_4019_4903	261
334	3300050509	nmdc:mga0qj67_30561_c1	nmdc:mga0qj67_30561_c1_2128_3012	261
335	3300050509	nmdc:mga0qj67_71070_c1	nmdc:mga0qj67_71070_c1_907_1791	261
336	3300050510	nmdc:mga06r32_282795_c1	nmdc:mga06r32_282795_c1_582_1490	261
337	3300050510	nmdc:mga06r32_29463_c1	nmdc:mga06r32_29463_c1_1085_1969	261
338	3300050510	nmdc:mga06r32_4577_c1	nmdc:mga06r32_4577_c1_4020_4904	261
339	3300050510	nmdc:mga06r32_4734_c1	nmdc:mga06r32_4734_c1_2968_3852	261
340	3300050512	nmdc:mga0n895_109937_c1	nmdc:mga0n895_109937_c1_495_1376	261
341	3300050512	nmdc:mga0n895_130456_c1	nmdc:mga0n895_130456_c1_597_1517	261
342	3300050513	nmdc:mga0rr50_15534_c1	nmdc:mga0rr50_15534_c1_3119_4000	261
343	3300050514	nmdc:mga08x19_82235_c1	nmdc:mga08x19_82235_c1_855_1736	261
344	3300050515	nmdc:mga0a205_353862_c1	nmdc:mga0a205_353862_c1_157_1038	261
345	3300050515	nmdc:mga0a205_460716_c1	nmdc:mga0a205_460716_c1_130_1011	261
346	3300050515	nmdc:mga0a205_98794_c1	nmdc:mga0a205_98794_c1_871_1752	261
347	3300053085	Ga0495619_0035758	Ga0495619_0035758_2202_3086	261
348	3300054114	Ga0501084_0029766	Ga0501084_0029766_2377_3261	261
349	3300059421	Ga0590071_019838	Ga0590071_019838_489_1394	261
350	3300059424	Ga0590075_018354	Ga0590075_018354_463_1368	261
351	3300059504	Ga0587082_011752	Ga0587082_011752_175_1068	261
352	3300003203	JGI25406J46586_10057238	JGI25406J46586_100572382	262
353	3300005334	Ga0068869_100010180	Ga0068869_1000101804	262
354	3300005336	Ga0070680_100023019	Ga0070680_1000230192	262
355	3300005336	Ga0070680_100283095	Ga0070680_1002830952	262
356	3300005341	Ga0070691_10001306	Ga0070691_100013068	262
357	3300005341	Ga0070691_10041358	Ga0070691_100413582	262
358	3300005344	Ga0070661_100036789	Ga0070661_1000367892	262
359	3300005366	Ga0070659_100220917	Ga0070659_1002209172	262
360	3300005406	Ga0070703_10015466	Ga0070703_100154662	262
361	3300005435	Ga0070714_100094967	Ga0070714_1000949672	262
362	3300005438	Ga0070701_10004446	Ga0070701_100044463	262
363	3300005440	Ga0070705_100013022	Ga0070705_1000130221	262
364	3300005440	Ga0070705_100101479	Ga0070705_1001014792	262
365	3300005441	Ga0070700_100036815	Ga0070700_1000368152	262
366	3300005444	Ga0070694_100047963	Ga0070694_1000479633	262
367	3300005444	Ga0070694_100057177	Ga0070694_1000571771	262
368	3300005444	Ga0070694_100144773	Ga0070694_1001447732	262
369	3300005457	Ga0070662_100068033	Ga0070662_1000680333	262
370	3300005458	Ga0070681_10227042	Ga0070681_102270421	262
371	3300005459	Ga0068867_100049511	Ga0068867_1000495112	262
372	3300005459	Ga0068867_100218019	Ga0068867_1002180192	262
373	3300005467	Ga0070706_100029003	Ga0070706_1000290032	262
374	3300005467	Ga0070706_100041777	Ga0070706_1000417772	262
375	3300005467	Ga0070706_100073920	Ga0070706_1000739202	262
376	3300005468	Ga0070707_100004668	Ga0070707_1000046682	262
377	3300005468	Ga0070707_100042921	Ga0070707_1000429215	262
378	3300005468	Ga0070707_100117242	Ga0070707_1001172422	262
379	3300005468	Ga0070707_100182610	Ga0070707_1001826102	262
380	3300005471	Ga0070698_100073429	Ga0070698_1000734292	262
381	3300005471	Ga0070698_100081656	Ga0070698_1000816562	262
382	3300005471	Ga0070698_100445921	Ga0070698_1004459211	262
383	3300005518	Ga0070699_100029439	Ga0070699_1000294392	262
384	3300005518	Ga0070699_100030865	Ga0070699_1000308656	262
385	3300005530	Ga0070679_100081658	Ga0070679_1000816583	262
386	3300005535	Ga0070684_100003405	Ga0070684_1000034053	262
387	3300005536	Ga0070697_100102244	Ga0070697_1001022442	262
388	3300005539	Ga0068853_100467448	Ga0068853_1004674482	262
389	3300005545	Ga0070695_100005906	Ga0070695_1000059064	262
390	3300005545	Ga0070695_100006683	Ga0070695_1000066834	262
391	3300005545	Ga0070695_100006977	Ga0070695_1000069776	262
392	3300005546	Ga0070696_100006808	Ga0070696_1000068082	262
393	3300005549	Ga0070704_100023823	Ga0070704_1000238233	262
394	3300005549	Ga0070704_100037034	Ga0070704_1000370343	262
395	3300005549	Ga0070704_100059931	Ga0070704_1000599313	262
396	3300005549	Ga0070704_100159070	Ga0070704_1001590702	262
397	3300005549	Ga0070704_100164686	Ga0070704_1001646862	262
398	3300005563	Ga0068855_100047139	Ga0068855_1000471394	262
399	3300005577	Ga0068857_100004916	Ga0068857_1000049167	262
400	3300005614	Ga0068856_100029378	Ga0068856_1000293784	262
401	3300005616	Ga0068852_100019640	Ga0068852_1000196403	262
402	3300005718	Ga0068866_10160323	Ga0068866_101603232	262
403	3300005844	Ga0068862_100054736	Ga0068862_1000547362	262
404	3300005844	Ga0068862_100065352	Ga0068862_1000653522	262
405	3300005844	Ga0068862_100164322	Ga0068862_1001643223	262
406	3300005937	Ga0081455_10000666	Ga0081455_1000066629	262
407	3300005985	Ga0081539_10000020	Ga0081539_1000002049	262
408	3300006186	Ga0075369_10105602	Ga0075369_101056022	262
409	3300006844	Ga0075428_100004121	Ga0075428_10000412111	262
410	3300006844	Ga0075428_100213671	Ga0075428_1002136712	262
411	3300006844	Ga0075428_100609597	Ga0075428_1006095972	262
412	3300006847	Ga0075431_100000038	Ga0075431_10000003811	262
413	3300006847	Ga0075431_100003208	Ga0075431_1000032084	262
414	3300006852	Ga0075433_10212773	Ga0075433_102127732	262
415	3300006852	Ga0075433_10264177	Ga0075433_102641773	262
416	3300006852	Ga0075433_10272616	Ga0075433_102726162	262
417	3300006871	Ga0075434_100030497	Ga0075434_1000304974	262
418	3300006871	Ga0075434_100163274	Ga0075434_1001632743	262
419	3300006880	Ga0075429_100029569	Ga0075429_1000295695	262
420	3300007076	Ga0075435_100034131	Ga0075435_1000341312	262
421	3300009094	Ga0111539_10000552	Ga0111539_100005524	262
422	3300009094	Ga0111539_10128679	Ga0111539_101286793	262
423	3300009094	Ga0111539_10852033	Ga0111539_108520332	262
424	3300009098	Ga0105245_10391694	Ga0105245_103916942	262
425	3300009147	Ga0114129_10009756	Ga0114129_100097565	262
426	3300009147	Ga0114129_10857813	Ga0114129_108578132	262
427	3300009148	Ga0105243_10034011	Ga0105243_100340113	262
428	3300009148	Ga0105243_10146589	Ga0105243_101465892	262
429	3300009174	Ga0105241_10049300	Ga0105241_100493002	262
430	3300009176	Ga0105242_10013272	Ga0105242_100132722	262
431	3300009551	Ga0105238_10013568	Ga0105238_100135684	262
432	3300009553	Ga0105249_10257934	Ga0105249_102579342	262
433	3300011119	Ga0105246_10210075	Ga0105246_102100751	262
434	3300013102	Ga0157371_10047325	Ga0157371_100473253	262
435	3300013105	Ga0157369_10038752	Ga0157369_100387523	262
436	3300013297	Ga0157378_10085835	Ga0157378_100858353	262
437	3300013307	Ga0157372_10114313	Ga0157372_101143133	262
438	3300013307	Ga0157372_10888242	Ga0157372_108882422	262
439	3300020070	Ga0206356_10548587	Ga0206356_105485872	262
440	3300021384	Ga0213876_10237204	Ga0213876_102372041	262
441	3300025302	Ga0207426_1046375	Ga0207426_10463751	262
442	3300025885	Ga0207653_10021994	Ga0207653_100219942	262
443	3300025885	Ga0207653_10049843	Ga0207653_100498431	262
444	3300025904	Ga0207647_10064617	Ga0207647_100646172	262
445	3300025904	Ga0207647_10141531	Ga0207647_101415312	262
446	3300025905	Ga0207685_10013532	Ga0207685_100135323	262
447	3300025908	Ga0207643_10062898	Ga0207643_100628982	262
448	3300025910	Ga0207684_10030532	Ga0207684_100305322	262
449	3300025910	Ga0207684_10040928	Ga0207684_100409283	262
450	3300025910	Ga0207684_10041705	Ga0207684_100417052	262
451	3300025915	Ga0207693_10111503	Ga0207693_101115032	262
452	3300025917	Ga0207660_10366235	Ga0207660_103662352	262
453	3300025919	Ga0207657_10116574	Ga0207657_101165742	262
454	3300025920	Ga0207649_10022741	Ga0207649_100227413	262
455	3300025921	Ga0207652_10050772	Ga0207652_100507723	262
456	3300025922	Ga0207646_10035476	Ga0207646_100354762	262
457	3300025922	Ga0207646_10058200	Ga0207646_100582004	262
458	3300025924	Ga0207694_10032416	Ga0207694_100324162	262
459	3300025933	Ga0207706_10031319	Ga0207706_100313193	262
460	3300025933	Ga0207706_10055724	Ga0207706_100557243	262
461	3300025934	Ga0207686_10049117	Ga0207686_100491172	262
462	3300025942	Ga0207689_10005613	Ga0207689_100056136	262
463	3300025942	Ga0207689_10012502	Ga0207689_100125023	262
464	3300025944	Ga0207661_10020435	Ga0207661_100204352	262
465	3300025945	Ga0207679_10011214	Ga0207679_100112146	262
466	3300025961	Ga0207712_10220247	Ga0207712_102202472	262
467	3300025972	Ga0207668_10337103	Ga0207668_103371032	262
468	3300026041	Ga0207639_10031224	Ga0207639_100312244	262
469	3300026078	Ga0207702_10006161	Ga0207702_100061616	262
470	3300026089	Ga0207648_10153788	Ga0207648_101537882	262
471	3300026089	Ga0207648_10188273	Ga0207648_101882732	262
472	3300026116	Ga0207674_10003977	Ga0207674_100039779	262
473	3300026116	Ga0207674_10523885	Ga0207674_105238852	262
474	3300026142	Ga0207698_10021425	Ga0207698_100214254	262
475	3300027378	Ga0209981_1001844	Ga0209981_10018442	262
476	3300027552	Ga0209982_1002551	Ga0209982_10025512	262
477	3300027614	Ga0209970_1000999	Ga0209970_10009993	262
478	3300027617	Ga0210002_1003634	Ga0210002_10036342	262
479	3300027665	Ga0209983_1000359	Ga0209983_10003599	262
480	3300027682	Ga0209971_1000091	Ga0209971_100009116	262
481	3300027695	Ga0209966_1000471	Ga0209966_10004719	262
482	3300027717	Ga0209998_10000487	Ga0209998_100004872	262
483	3300027876	Ga0209974_10000497	Ga0209974_100004974	262
484	3300027907	Ga0207428_10000173	Ga0207428_1000017368	262
485	3300028380	Ga0268265_10045342	Ga0268265_100453423	262
486	3300028380	Ga0268265_10057568	Ga0268265_100575684	262
487	3300032002	Ga0307416_100379428	Ga0307416_1003794282	262
488	3300037418	Ga0395900_0015260	Ga0395900_0015260_4951_5853	262
489	3300038443	Ga0395901_0015493	Ga0395901_0015493_3002_3904	262
490	3300038996	Ga0242420_006449	Ga0242420_006449_913_1797	262
491	3300039437	Ga0436365_1637095	Ga0436365_1637095_1332_2243	262
492	3300039453	Ga0436362_0597598	Ga0436362_0597598_46_957	262
493	3300042461	Ga0439460_0003075	Ga0439460_0003075_2285_3169	262
494	3300042876	Ga0451577_0002345	Ga0451577_0002345_11508_12392	262
495	3300042876	Ga0451577_0030609	Ga0451577_0030609_3941_4825	262
496	3300044673	Ga0453683_0014510	Ga0453683_0014510_1380_2264	262
497	3300044673	Ga0453683_0021239	Ga0453683_0021239_2666_3550	262
498	3300044712	Ga0453684_0021719	Ga0453684_0021719_8274_9158	262
499	3300045051	Ga0451576_0144686	Ga0451576_0144686_48_932	262
500	3300046491	Ga0495584_0080535	Ga0495584_0080535_381_1265	262
501	3300046684	Ga0495669_0050276	Ga0495669_0050276_159_1061	262
502	3300049568	Ga0501031_0063074	Ga0501031_0063074_1165_2049	262
503	3300049570	Ga0501033_0055416	Ga0501033_0055416_473_1357	262
504	3300049570	Ga0501033_0251018	Ga0501033_0251018_197_1087	262
505	3300049571	Ga0501034_0001551	Ga0501034_0001551_3475_4377	262
506	3300049571	Ga0501034_0593761	Ga0501034_0593761_79_969	262
507	3300049572	Ga0501036_0244287	Ga0501036_0244287_101_985	262
508	3300049574	Ga0501038_0204474	Ga0501038_0204474_462_1346	262
509	3300049575	Ga0501039_0010436	Ga0501039_0010436_2274_3158	262
510	3300049576	Ga0501040_0184780	Ga0501040_0184780_583_1467	262
511	3300049578	Ga0501042_0004738	Ga0501042_0004738_111_995	262
512	3300049580	Ga0501046_0000256	Ga0501046_0000256_4968_5852	262
513	3300049581	Ga0501047_0031300	Ga0501047_0031300_768_1652	262
514	3300049582	Ga0501048_0015816	Ga0501048_0015816_707_1591	262
515	3300049585	Ga0501069_0048946	Ga0501069_0048946_1133_2017	262
516	3300049587	Ga0501071_0031991	Ga0501071_0031991_1361_2245	262
517	3300049590	Ga0501074_0034129	Ga0501074_0034129_462_1346	262
518	3300049591	Ga0501075_0003599	Ga0501075_0003599_7637_8521	262
519	3300049592	Ga0501076_0002735	Ga0501076_0002735_7620_8504	262
520	3300049592	Ga0501076_0188170	Ga0501076_0188170_251_1135	262
521	3300049741	Ga0501079_0002601	Ga0501079_0002601_4236_5120	262
522	3300049741	Ga0501079_0236116	Ga0501079_0236116_369_1253	262
523	3300049742	Ga0501080_0087696	Ga0501080_0087696_170_1054	262
524	3300049743	Ga0501081_0129196	Ga0501081_0129196_343_1227	262
525	3300049743	Ga0501081_0210372	Ga0501081_0210372_402_1286	262
526	3300049744	Ga0501083_0004985	Ga0501083_0004985_3947_4831	262
527	3300049824	Ga0501045_0000178	Ga0501045_0000178_23709_24593	262
528	3300050489	nmdc:mga03683_56283_c1	nmdc:mga03683_56283_c1_261_1148	262
529	3300050507	nmdc:mga05p37_113254_c1	nmdc:mga05p37_113254_c1_398_1285	262
530	3300050507	nmdc:mga05p37_29407_c1	nmdc:mga05p37_29407_c1_3668_4552	262
531	3300050510	nmdc:mga06r32_37763_c1	nmdc:mga06r32_37763_c1_2762_3649	262
532	3300050510	nmdc:mga06r32_75773_c1	nmdc:mga06r32_75773_c1_230_1114	262
533	3300050510	nmdc:mga06r32_966_c1	nmdc:mga06r32_966_c1_7380_8285	262
534	3300050511	nmdc:mga08y16_164755_c1	nmdc:mga08y16_164755_c1_1192_2097	262
535	3300050511	nmdc:mga08y16_2085_c1	nmdc:mga08y16_2085_c1_13182_14066	262
536	3300050512	nmdc:mga0n895_50835_c1	nmdc:mga0n895_50835_c1_3111_4025	262
537	3300050512	nmdc:mga0n895_567804_c1	nmdc:mga0n895_567804_c1_112_1011	262
538	3300050514	nmdc:mga08x19_88983_c1	nmdc:mga08x19_88983_c1_865_1764	262
539	3300050515	nmdc:mga0a205_12064_c1	nmdc:mga0a205_12064_c1_5600_6484	262
540	3300050515	nmdc:mga0a205_148663_c1	nmdc:mga0a205_148663_c1_109_1023	262
541	3300050515	nmdc:mga0a205_342726_c1	nmdc:mga0a205_342726_c1_187_1092	262
542	3300050515	nmdc:mga0a205_4755_c1	nmdc:mga0a205_4755_c1_11194_12078	262
543	3300050515	nmdc:mga0a205_85448_c1	nmdc:mga0a205_85448_c1_36_947	262
544	3300050516	nmdc:mga0sz30_51673_c1	nmdc:mga0sz30_51673_c1_231_1118	262
545	3300054114	Ga0501084_0013238	Ga0501084_0013238_3832_4716	262
546	3300060353	Ga0501082_0005151	Ga0501082_0005151_5979_6863	262
547	3300060353	Ga0501082_0053769	Ga0501082_0053769_856_1740	262
548	3300061734	Ga0530510_0000152	Ga0530510_0000152_28872_29756	262
549	3300061734	Ga0530510_0144342	Ga0530510_0144342_689_1600	262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

118

303

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3tuz-assembly2.cif.gz_F	inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form	0.579	85	256
3tuz-assembly2.cif.gz_F	inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form	0.4741	85	256
8hps-assembly1.cif.gz_A	lpqy-sugabc in state 5	0.4687	68	252
4tqu-assembly1.cif.gz_M	crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate	0.4611	143	254
8hps-assembly1.cif.gz_A	lpqy-sugabc in state 5	0.3605	68	252

ID	Description	Score	Start	End	Superfamily
af_P77463_85_288_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.6196	91	252	1.10.3720.10
af_Q2FVE9_63_269_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.5973	65	254	1.10.3720.10
af_P0AGH3_48_312_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.5959	127	257	1.10.3720.10
af_P45767_178_390_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.5948	129	256	1.10.3720.10
af_P0AGH5_85_292_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.5941	65	255	1.10.3720.10

ID	Description	Score	Start	End	GO Terms
AF-W9V1L6-F1-model_v4	Dipeptide transport system permease protein dppC	0.8909	110	251	GO:0005886 GO:0071916
AF-F3FVR9-F1-model_v4	Binding-protein dependent transport system inner membrane protein	0.8745	105	219	GO:0005886 GO:0055085
AF-F3FVR9-F1-model_v4	Binding-protein dependent transport system inner membrane protein	0.8676	105	219	GO:0005886 GO:0055085
AF-W9V1L6-F1-model_v4	Dipeptide transport system permease protein dppC	0.8631	110	251	GO:0005886 GO:0071916
AF-A0A5N9GED5-F1-model_v4	ABC transporter permease	0.8153	138	260	GO:0005886 GO:0055085

Feature Viewer

pLDDT	pTM	Quality
75.92	0.5	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F462344

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

118

303

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map