F462471

General Info

Members Datasets Scaffolds Average Seq Length
550 251 1100 294

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10136734|Ga0081455_101367342
Length 306
Sequence MSASADIEIRDPAFTSVVGKQVAIEKIATGFLFTEGPLWHAAERYLLFSDMPGDHLRKWTARDGITTFRKPCAKSNGLAWDAERRLIVCEHATSRLTRTEADGTSTVLASHHGDNELNSPNDVVVKSDGAIYFTDPVYGRKEYFGNPRPLQLDFRGVWRVDPQSGASQGGALTLLADDFGQPNGLCFSLDERCLFVNDTERQHIRIFDVAADGTLRDGRVWAETTGSGRGAPDGIKIDSAGNVYCCGPGGIHVFGTDARCLGVIGMPEPTANFCFGDDDLRSLYITASTSLYRVRVATPGTAQWQT

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
184 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
185 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
186 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
187 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.36
Nodule 0
Rhizoplane 1.09
Rhizosphere 92.36
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10136734 3300005937 Bacteria 1908
2 Ga0065712_10169487 3300005290 Bacteria 1252
3 Ga0070676_10025943 3300005328 Bacteria 3316
4 Ga0070683_100148622 3300005329 Bacteria 2221
5 Ga0070690_100066736 3300005330 Bacteria 2330
6 Ga0070670_100040975 3300005331 Bacteria 3980
7 Ga0070670_100099641 3300005331 Bacteria 2500
8 Ga0070677_10120335 3300005333 Bacteria 1185
9 Ga0068869_100000768 3300005334 Bacteria 18246
10 Ga0068869_100015634 3300005334 Bacteria 5097
11 Ga0068869_100115588 3300005334 Bacteria 2046
12 Ga0070666_10158132 3300005335 Bacteria 1583
13 Ga0070680_100003078 3300005336 Bacteria 12376
14 Ga0070680_100074091 3300005336 Bacteria 2801
15 Ga0070682_100002528 3300005337 Bacteria 10095
16 Ga0068868_100062143 3300005338 Bacteria 2960
17 Ga0070660_100007427 3300005339 Bacteria 7639
18 Ga0070689_100097741 3300005340 Bacteria 2322
19 Ga0070691_10001482 3300005341 Bacteria 10069
20 Ga0070692_10025845 3300005345 Bacteria 2897
21 Ga0070669_100026597 3300005353 Bacteria 4163
22 Ga0070669_100113851 3300005353 Bacteria 2056
23 Ga0070675_100197627 3300005354 Bacteria 1744
24 Ga0070671_100284553 3300005355 Bacteria 1406
25 Ga0070674_100001928 3300005356 Bacteria 11311
26 Ga0070674_100036609 3300005356 Bacteria 3295
27 Ga0070674_100350653 3300005356 Bacteria 1192
28 Ga0070673_100328956 3300005364 Bacteria 1351
29 Ga0070688_100082915 3300005365 Bacteria 2079
30 Ga0070659_100000378 3300005366 Bacteria 33675
31 Ga0070711_100020457 3300005439 Bacteria 4266
32 Ga0070705_100001984 3300005440 Bacteria 10450
33 Ga0070705_100058522 3300005440 Bacteria 2278
34 Ga0070700_100101184 3300005441 Bacteria 1899
35 Ga0070700_100154945 3300005441 Bacteria 1571
36 Ga0070694_100000180 3300005444 Bacteria 32964
37 Ga0070694_100060086 3300005444 Bacteria 2591
38 Ga0070694_100120709 3300005444 Bacteria 1880
39 Ga0070708_100006859 3300005445 Bacteria 9084
40 Ga0070708_100094596 3300005445 Bacteria 2726
41 Ga0070708_100262216 3300005445 Bacteria 1624
42 Ga0070708_100300176 3300005445 Bacteria 1512
43 Ga0070663_100000411 3300005455 Bacteria 22470
44 Ga0070678_100047938 3300005456 Bacteria 3073
45 Ga0070678_100282862 3300005456 Bacteria 1403
46 Ga0070662_100007636 3300005457 Bacteria 7019
47 Ga0070681_10005266 3300005458 Bacteria 12490
48 Ga0068867_100227062 3300005459 Bacteria 1507
49 Ga0070706_100116618 3300005467 Bacteria 2487
50 Ga0070707_100046936 3300005468 Bacteria 4134
51 Ga0070707_100064154 3300005468 Bacteria 3526
52 Ga0070707_100082880 3300005468 Bacteria 3098
53 Ga0070707_100218398 3300005468 Bacteria 1857
54 Ga0070707_100221001 3300005468 Bacteria 1845
55 Ga0070698_100179081 3300005471 Bacteria 2058
56 Ga0070698_100240786 3300005471 Bacteria 1742
57 Ga0070699_100033681 3300005518 Bacteria 4426
58 Ga0070679_100003620 3300005530 Bacteria 14125
59 Ga0070679_100125604 3300005530 Bacteria 2548
60 Ga0070697_100041837 3300005536 Bacteria 3709
61 Ga0070697_100129013 3300005536 Bacteria 2119
62 Ga0070697_100187779 3300005536 Bacteria 1753
63 Ga0070697_100203674 3300005536 Bacteria 1682
64 Ga0068853_100000344 3300005539 Bacteria 32315
65 Ga0070672_100023126 3300005543 Bacteria 4577
66 Ga0070672_100050200 3300005543 Bacteria 3248
67 Ga0070672_100222594 3300005543 Bacteria 1583
68 Ga0070695_100000324 3300005545 Bacteria 24496
69 Ga0070695_100012280 3300005545 Bacteria 5137
70 Ga0070695_100027044 3300005545 Bacteria 3552
71 Ga0070695_100136609 3300005545 Bacteria 1695
72 Ga0070696_100002264 3300005546 Bacteria 12689
73 Ga0070696_100047207 3300005546 Bacteria 2987
74 Ga0070696_100102586 3300005546 Bacteria 2052
75 Ga0070696_100197647 3300005546 Bacteria 1499
76 Ga0070693_100000444 3300005547 Bacteria 18604
77 Ga0070693_100059359 3300005547 Bacteria 2217
78 Ga0070704_100004554 3300005549 Bacteria 8007
79 Ga0070704_100024273 3300005549 Bacteria 3977
80 Ga0070704_100379964 3300005549 Bacteria 1200
81 Ga0068855_100004550 3300005563 Bacteria 16934
82 Ga0068855_100360852 3300005563 Bacteria 1599
83 Ga0068855_100513381 3300005563 Bacteria 1301
84 Ga0070664_100003289 3300005564 Bacteria 13047
85 Ga0068857_100041818 3300005577 Bacteria 4064
86 Ga0068854_100001108 3300005578 Bacteria 16223
87 Ga0068854_100071995 3300005578 Bacteria 2530
88 Ga0068856_100001066 3300005614 Bacteria 29020
89 Ga0068852_100199675 3300005616 Bacteria 1892
90 Ga0068859_100006113 3300005617 Bacteria 12227
91 Ga0068859_100135657 3300005617 Bacteria 2534
92 Ga0068859_100207293 3300005617 Bacteria 2046
93 Ga0068859_100257788 3300005617 Bacteria 1835
94 Ga0068864_100002518 3300005618 Bacteria 15140
95 Ga0068864_100020124 3300005618 Bacteria 5581
96 Ga0068866_10009101 3300005718 Bacteria 4209
97 Ga0068861_100039674 3300005719 Bacteria 3516
98 Ga0068861_100362219 3300005719 Bacteria 1275
99 Ga0068870_10000456 3300005840 Bacteria 15467
100 Ga0068863_100032653 3300005841 Bacteria 4960
101 Ga0068863_100044730 3300005841 Bacteria 4201
102 Ga0068858_100069124 3300005842 Bacteria 3274
103 Ga0068860_100001154 3300005843 Bacteria 28883
104 Ga0068860_100007497 3300005843 Bacteria 10914
105 Ga0068860_100118971 3300005843 Bacteria 2529
106 Ga0068860_100146725 3300005843 Bacteria 2270
107 Ga0068860_100390957 3300005843 Bacteria 1374
108 Ga0068862_100004895 3300005844 Bacteria 11282
109 Ga0068862_100006318 3300005844 Bacteria 9853
110 Ga0068862_100007015 3300005844 Bacteria 9354
111 Ga0068862_100079237 3300005844 Bacteria 2847
112 Ga0081538_10011829 3300005981 Bacteria 7044
113 Ga0081540_1003214 3300005983 Bacteria 13021
114 Ga0081539_10007885 3300005985 Bacteria 9496
115 Ga0081539_10016709 3300005985 Bacteria 5213
116 Ga0075365_10218565 3300006038 Bacteria 1337
117 Ga0075368_10001440 3300006042 Bacteria 7610
118 Ga0075368_10028022 3300006042 Bacteria 2175
119 Ga0075363_100006192 3300006048 Bacteria 5409
120 Ga0075363_100118937 3300006048 Bacteria 1474
121 Ga0075364_10102590 3300006051 Bacteria 1905
122 Ga0070712_100008178 3300006175 Bacteria 6569
123 Ga0075362_10005740 3300006177 Bacteria 4567
124 Ga0075362_10018722 3300006177 Bacteria 2869
125 Ga0075367_10003360 3300006178 Bacteria 7610
126 Ga0075367_10024008 3300006178 Bacteria 3436
127 Ga0075367_10026528 3300006178 Bacteria 3287
128 Ga0075367_10074525 3300006178 Bacteria 2046
129 Ga0075367_10246767 3300006178 Bacteria 1119
130 Ga0075369_10007346 3300006186 Bacteria 4192
131 Ga0075366_10115864 3300006195 Bacteria 1614
132 Ga0097621_100205951 3300006237 Bacteria 1709
133 Ga0075370_10035544 3300006353 Bacteria 2797
134 Ga0068871_100113803 3300006358 Bacteria 2279
135 Ga0075428_100001683 3300006844 Bacteria 23566
136 Ga0075428_100003162 3300006844 Bacteria 17988
137 Ga0075428_100016526 3300006844 Bacteria 8149
138 Ga0075428_100017887 3300006844 Bacteria 7833
139 Ga0075428_100024043 3300006844 Bacteria 6743
140 Ga0075428_100037004 3300006844 Bacteria 5375
141 Ga0075428_100192373 3300006844 Bacteria 2206
142 Ga0075430_100000022 3300006846 Bacteria 81752
143 Ga0075430_100001713 3300006846 Bacteria 17880
144 Ga0075430_100027411 3300006846 Bacteria 4840
145 Ga0075430_100073119 3300006846 Bacteria 2875
146 Ga0075431_100000058 3300006847 Bacteria 61801
147 Ga0075431_100001000 3300006847 Bacteria 25171
148 Ga0075431_100010677 3300006847 Bacteria 9227
149 Ga0075431_100010992 3300006847 Bacteria 9112
150 Ga0075431_100016771 3300006847 Bacteria 7439
151 Ga0075431_100037522 3300006847 Bacteria 4991
152 Ga0075431_100038803 3300006847 Bacteria 4907
153 Ga0075431_100075381 3300006847 Bacteria 3481
154 Ga0075431_100202476 3300006847 Bacteria 2031
155 Ga0075431_100344348 3300006847 Bacteria 1499
156 Ga0075433_10000879 3300006852 Bacteria 21113
157 Ga0075433_10009435 3300006852 Bacteria 7797
158 Ga0075433_10189734 3300006852 Bacteria 1828
159 Ga0075433_10338693 3300006852 Bacteria 1329
160 Ga0075434_100002809 3300006871 Bacteria 15419
161 Ga0075434_100007246 3300006871 Bacteria 10261
162 Ga0075434_100080917 3300006871 Bacteria 3245
163 Ga0075434_100139732 3300006871 Bacteria 2441
164 Ga0075434_100201481 3300006871 Bacteria 2010
165 Ga0075434_100340429 3300006871 Unclassified 1521
166 Ga0075429_100000072 3300006880 Bacteria 50828
167 Ga0075429_100001141 3300006880 Bacteria 21427
168 Ga0075429_100004613 3300006880 Bacteria 11852
169 Ga0075429_100041584 3300006880 Bacteria 4003
170 Ga0075429_100062015 3300006880 Bacteria 3257
171 Ga0075436_100078911 3300006914 Bacteria 2280
172 Ga0075436_100147926 3300006914 Bacteria 1652
173 Ga0075436_100170928 3300006914 Bacteria 1535
174 Ga0097620_100006113 3300006931 Bacteria 12227
175 Ga0097620_100135657 3300006931 Bacteria 2534
176 Ga0097620_100145220 3300006931 Bacteria 2447
177 Ga0097620_100207280 3300006931 Bacteria 2046
178 Ga0097620_100257773 3300006931 Bacteria 1835
179 Ga0075435_100028625 3300007076 Bacteria 4370
180 Ga0075435_100034667 3300007076 Bacteria 4000
181 Ga0075435_100062939 3300007076 Bacteria 3012
182 Ga0075435_100103137 3300007076 Bacteria 2365
183 Ga0075435_100159103 3300007076 Bacteria 1902
184 Ga0099794_10053022 3300007265 Bacteria 1955
185 Ga0099794_10058445 3300007265 Bacteria 1869
186 Ga0111539_10003959 3300009094 Bacteria 19462
187 Ga0111539_10004083 3300009094 Bacteria 19157
188 Ga0111539_10008829 3300009094 Bacteria 12772
189 Ga0105247_10204671 3300009101 Bacteria 1328
190 Ga0114129_10000046 3300009147 Bacteria 105492
191 Ga0114129_10006267 3300009147 Bacteria 16858
192 Ga0114129_10014694 3300009147 Bacteria 11154
193 Ga0114129_10017939 3300009147 Bacteria 10076
194 Ga0114129_10019878 3300009147 Bacteria 9558
195 Ga0114129_10026076 3300009147 Bacteria 8276
196 Ga0114129_10044506 3300009147 Bacteria 6245
197 Ga0114129_10046252 3300009147 Bacteria 6117
198 Ga0114129_10076201 3300009147 Bacteria 4670
199 Ga0114129_10162561 3300009147 Bacteria 3049
200 Ga0114129_10172482 3300009147 Bacteria 2948
201 Ga0114129_10227106 3300009147 Bacteria 2515
202 Ga0114129_10797107 3300009147 Bacteria 1205
203 Ga0105243_10244479 3300009148 Bacteria 1599
204 Ga0105243_10293675 3300009148 Bacteria 1470
205 Ga0105241_10001830 3300009174 Bacteria 16133
206 Ga0105242_10240129 3300009176 Bacteria 1628
207 Ga0105248_10070491 3300009177 Bacteria 3925
208 Ga0105249_10019891 3300009553 Bacteria 5996
209 Ga0105249_10134868 3300009553 Bacteria 2361
210 Ga0105249_10237892 3300009553 Bacteria 1799
211 Ga0105239_10219798 3300010375 Bacteria 2130
212 Ga0105246_10376588 3300011119 Bacteria 1171
213 Ga0157373_10000079 3300013100 Bacteria 82786
214 Ga0157371_10053670 3300013102 Bacteria 2862
215 Ga0157371_10141055 3300013102 Bacteria 1716
216 Ga0157370_10443774 3300013104 Bacteria 1193
217 Ga0157369_10142590 3300013105 Bacteria 2534
218 Ga0157378_10017264 3300013297 Bacteria 6329
219 Ga0157378_10150125 3300013297 Bacteria 2171
220 Ga0157378_10701778 3300013297 Bacteria 1031
221 Ga0163162_10002583 3300013306 Bacteria 17140
222 Ga0157372_10002520 3300013307 Bacteria 19860
223 Ga0157372_10246723 3300013307 Bacteria 2072
224 Ga0157380_10007817 3300014326 Bacteria 7610
225 Ga0157380_10110736 3300014326 Bacteria 2307
226 Ga0157380_10543931 3300014326 Bacteria 1138
227 Ga0182008_10024489 3300014497 Bacteria 3073
228 Ga0157379_10011203 3300014968 Bacteria 7812
229 Ga0163161_10077149 3300017792 Bacteria 2447
230 Ga0207653_10014457 3300025885 Bacteria 2477
231 Ga0207682_10022493 3300025893 Bacteria 2484
232 Ga0207710_10136935 3300025900 Bacteria 1180
233 Ga0207688_10060773 3300025901 Bacteria 2129
234 Ga0207645_10001323 3300025907 Bacteria 20353
235 Ga0207645_10023741 3300025907 Bacteria 3982
236 Ga0207645_10040967 3300025907 Bacteria 2966
237 Ga0207643_10000087 3300025908 Bacteria 61041
238 Ga0207643_10052852 3300025908 Bacteria 2308
239 Ga0207684_10018567 3300025910 Bacteria 5954
240 Ga0207684_10020517 3300025910 Bacteria 5647
241 Ga0207684_10027632 3300025910 Bacteria 4832
242 Ga0207684_10052823 3300025910 Bacteria 3449
243 Ga0207684_10196651 3300025910 Bacteria 1739
244 Ga0207707_10000197 3300025912 Bacteria 63923
245 Ga0207671_10169819 3300025914 Bacteria 1693
246 Ga0207693_10029816 3300025915 Bacteria 4306
247 Ga0207660_10000872 3300025917 Bacteria 19953
248 Ga0207660_10056229 3300025917 Bacteria 2815
249 Ga0207657_10000264 3300025919 Bacteria 55674
250 Ga0207649_10006541 3300025920 Bacteria 6329
251 Ga0207652_10000553 3300025921 Bacteria 37682
252 Ga0207652_10018257 3300025921 Bacteria 5752
253 Ga0207646_10001806 3300025922 Bacteria 25880
254 Ga0207646_10018188 3300025922 Bacteria 6559
255 Ga0207646_10038411 3300025922 Bacteria 4313
256 Ga0207646_10083163 3300025922 Bacteria 2863
257 Ga0207681_10067350 3300025923 Bacteria 2482
258 Ga0207650_10079666 3300025925 Bacteria 2481
259 Ga0207690_10001929 3300025932 Bacteria 12708
260 Ga0207690_10297492 3300025932 Bacteria 1262
261 Ga0207706_10099356 3300025933 Bacteria 2560
262 Ga0207686_10020189 3300025934 Bacteria 3802
263 Ga0207709_10062793 3300025935 Bacteria 2326
264 Ga0207709_10134045 3300025935 Bacteria 1692
265 Ga0207670_10370650 3300025936 Bacteria 1138
266 Ga0207669_10005763 3300025937 Bacteria 5592
267 Ga0207669_10037862 3300025937 Bacteria 2772
268 Ga0207665_10009359 3300025939 Bacteria 6431
269 Ga0207691_10010131 3300025940 Bacteria 9047
270 Ga0207691_10024908 3300025940 Bacteria 5622
271 Ga0207691_10180288 3300025940 Bacteria 1846
272 Ga0207689_10000141 3300025942 Bacteria 61620
273 Ga0207689_10023925 3300025942 Bacteria 5124
274 Ga0207689_10106864 3300025942 Bacteria 2300
275 Ga0207689_10435952 3300025942 Bacteria 1094
276 Ga0207661_10151338 3300025944 Unclassified 2006
277 Ga0207679_10000465 3300025945 Bacteria 28496
278 Ga0207667_10001531 3300025949 Bacteria 29047
279 Ga0207667_10495890 3300025949 Bacteria 1239
280 Ga0207640_10000986 3300025981 Bacteria 15781
281 Ga0207640_10398332 3300025981 Bacteria 1120
282 Ga0207677_10039759 3300026023 Bacteria 3095
283 Ga0207703_10149008 3300026035 Bacteria 2038
284 Ga0207703_10294134 3300026035 Bacteria 1479
285 Ga0207639_10002524 3300026041 Bacteria 12276
286 Ga0207678_10002927 3300026067 Bacteria 15486
287 Ga0207708_10051647 3300026075 Bacteria 3130
288 Ga0207708_10116407 3300026075 Bacteria 2079
289 Ga0207702_10000986 3300026078 Bacteria 29140
290 Ga0207648_10002144 3300026089 Bacteria 21456
291 Ga0207648_10030413 3300026089 Bacteria 4782
292 Ga0207648_10184330 3300026089 Bacteria 1848
293 Ga0207648_10235302 3300026089 Bacteria 1630
294 Ga0207676_10011924 3300026095 Bacteria 6220
295 Ga0207676_10018630 3300026095 Bacteria 5052
296 Ga0207674_10000412 3300026116 Bacteria 55670
297 Ga0207675_100003572 3300026118 Bacteria 15148
298 Ga0207675_100083825 3300026118 Bacteria 2990
299 Ga0207683_10009008 3300026121 Bacteria 8502
300 Ga0207683_10318587 3300026121 Bacteria 1424
301 Ga0207698_10135825 3300026142 Bacteria 2110
302 Ga0209996_1000182 3300027395 Bacteria 8068
303 Ga0210000_1012766 3300027462 Bacteria 1250
304 Ga0209995_1001968 3300027471 Bacteria 3218
305 Ga0209999_1004352 3300027543 Bacteria 2548
306 Ga0209970_1000754 3300027614 Bacteria 5641
307 Ga0209983_1005965 3300027665 Bacteria 2513
308 Ga0209971_1000336 3300027682 Bacteria 12991
309 Ga0209966_1000098 3300027695 Bacteria 38805
310 Ga0209998_10000256 3300027717 Bacteria 17465
311 Ga0209813_10010209 3300027866 Bacteria 2421
312 Ga0209813_10023032 3300027866 Bacteria 1768
313 Ga0209974_10000509 3300027876 Bacteria 12986
314 Ga0209974_10026051 3300027876 Bacteria 1936
315 Ga0207428_10000009 3300027907 Bacteria 410565
316 Ga0207428_10000272 3300027907 Bacteria 69872
317 Ga0207428_10003480 3300027907 Bacteria 15273
318 Ga0207428_10028377 3300027907 Bacteria 4650
319 Ga0268265_10006793 3300028380 Bacteria 7744
320 Ga0268265_10014073 3300028380 Bacteria 5452
321 Ga0268265_10029115 3300028380 Bacteria 3961
322 Ga0268265_10689190 3300028380 Bacteria 986
323 Ga0268264_10020831 3300028381 Bacteria 5358
324 Ga0268264_10040476 3300028381 Bacteria 3851
325 Ga0268264_10430454 3300028381 Bacteria 1274
326 Ga0265338_10042706 3300028800 Bacteria 4218
327 Ga0307408_100021416 3300031548 Bacteria 4375
328 Ga0307408_100147040 3300031548 Unclassified 1856
329 Ga0307516_10050069 3300031730 Bacteria 4100
330 Ga0307407_10169596 3300031903 Bacteria 1436
331 Ga0307416_100161260 3300032002 Unclassified 2073
332 Ga0307416_100387212 3300032002 Bacteria 1431
333 Ga0373948_0017161 3300034817 Bacteria 1346
334 Ga0373940_0002321 3300035088 Bacteria 3677
335 Ga0373949_0014727 3300035090 Bacteria 1743
336 Ga0373932_0055966 3300035112 Bacteria 1185
337 Ga0373941_0022073 3300035115 Bacteria 1803
338 Ga0373961_0010825 3300035241 Bacteria 2254
339 Ga0373962_0001746 3300035242 Bacteria 5170
340 Ga0373931_0007012 3300035691 Bacteria 5302
341 Ga0373935_0100187 3300035692 Bacteria 1909
342 Ga0373927_0035863 3300035695 Bacteria 3227
343 Ga0373925_0385740 3300037068 Bacteria 1141
344 Ga0395899_0079002 3300037312 Bacteria 2397
345 Ga0395900_0005351 3300037418 Bacteria 13450
346 Ga0395900_0083626 3300037418 Bacteria 3279
347 Ga0395898_0060256 3300037466 Bacteria 3689
348 Ga0395901_0024766 3300038443 Bacteria 6161
349 Ga0395901_0111961 3300038443 Bacteria 2867
350 Ga0439453_0001239 3300041408 Bacteria 3221
351 Ga0439441_003031 3300042001 Bacteria 2430
352 Ga0439443_002891 3300042003 Bacteria 2107
353 Ga0439455_0005946 3300042012 Bacteria 2507
354 Ga0439459_0003571 3300042438 Bacteria 2474
355 Ga0439464_0002156 3300042439 Bacteria 4811
356 Ga0439460_0000204 3300042461 Bacteria 11677
357 Ga0451577_0135300 3300042876 Bacteria 2213
358 Ga0451577_0137986 3300042876 Bacteria 2190
359 Ga0451577_0167056 3300042876 Bacteria 1982
360 Ga0451577_0199948 3300042876 Bacteria 1804
361 Ga0453683_0033101 3300044673 Bacteria 3260
362 Ga0453683_0076166 3300044673 Bacteria 2100
363 Ga0453684_0084317 3300044712 Bacteria 3952
364 Ga0453684_0691149 3300044712 Bacteria 1109
365 Ga0451576_0008864 3300045051 Bacteria 11747
366 Ga0451576_0052087 3300045051 Bacteria 4289
367 Ga0451576_0242233 3300045051 Unclassified 1884
368 Ga0451576_0244795 3300045051 Bacteria 1873
369 Ga0451576_0607434 3300045051 Bacteria 1149
370 Ga0451576_0643565 3300045051 Bacteria 1114
371 Ga0495580_0000221 3300046472 Bacteria 44116
372 Ga0495621_0039423 3300046539 Bacteria 1652
373 Ga0495656_0035904 3300046615 Bacteria 2039
374 Ga0496102_0020506 3300048905 Bacteria 5841
375 Ga0496104_0028286 3300048907 Bacteria 5196
376 Ga0496104_0175893 3300048907 Bacteria 2051
377 Ga0496106_0198241 3300048909 Bacteria 1597
378 Ga0496112_0129753 3300048915 Bacteria 2492
379 Ga0496112_0154110 3300048915 Bacteria 2265
380 Ga0501033_0302765 3300049570 Bacteria 1125
381 Ga0501034_0040424 3300049571 Bacteria 4721
382 Ga0501036_0032041 3300049572 Bacteria 4441
383 Ga0501036_0041842 3300049572 Bacteria 3877
384 Ga0501036_0229841 3300049572 Bacteria 1557
385 Ga0501038_0089933 3300049574 Bacteria 2574
386 Ga0501038_0115514 3300049574 Bacteria 2219
387 Ga0501039_0032424 3300049575 Bacteria 4028
388 Ga0501039_0220535 3300049575 Bacteria 1491
389 Ga0501040_0003262 3300049576 Bacteria 10480
390 Ga0501040_0027555 3300049576 Bacteria 3827
391 Ga0501040_0062750 3300049576 Bacteria 2556
392 Ga0501040_0080580 3300049576 Bacteria 2255
393 Ga0501040_0302675 3300049576 Bacteria 1143
394 Ga0501040_0413197 3300049576 Bacteria 969
395 Ga0501041_0006609 3300049577 Bacteria 6789
396 Ga0501041_0061671 3300049577 Bacteria 2295
397 Ga0501042_0004324 3300049578 Bacteria 9054
398 Ga0501042_0012245 3300049578 Bacteria 5805
399 Ga0501042_0017831 3300049578 Bacteria 4904
400 Ga0501043_0109367 3300049579 Bacteria 2171
401 Ga0501046_0000467 3300049580 Bacteria 40463
402 Ga0501046_0181665 3300049580 Bacteria 1573
403 Ga0501046_0218907 3300049580 Bacteria 1410
404 Ga0501047_0056687 3300049581 Bacteria 3790
405 Ga0501048_0027088 3300049582 Bacteria 4169
406 Ga0501048_0140692 3300049582 Bacteria 1706
407 Ga0501067_0007368 3300049583 Bacteria 6111
408 Ga0501067_0090497 3300049583 Bacteria 1698
409 Ga0501068_0017400 3300049584 Bacteria 4157
410 Ga0501068_0066139 3300049584 Bacteria 2201
411 Ga0501069_0038108 3300049585 Bacteria 2653
412 Ga0501070_0035858 3300049586 Bacteria 4142
413 Ga0501071_0012283 3300049587 Bacteria 5803
414 Ga0501071_0016561 3300049587 Bacteria 5072
415 Ga0501071_0056471 3300049587 Bacteria 2836
416 Ga0501071_0240089 3300049587 Bacteria 1366
417 Ga0501072_0002766 3300049588 Bacteria 13186
418 Ga0501072_0019996 3300049588 Bacteria 5184
419 Ga0501072_0040970 3300049588 Bacteria 3637
420 Ga0501072_0055653 3300049588 Bacteria 3117
421 Ga0501073_0005180 3300049589 Bacteria 9777
422 Ga0501073_0042321 3300049589 Bacteria 3215
423 Ga0501074_0040982 3300049590 Bacteria 3353
424 Ga0501075_0000822 3300049591 Bacteria 19492
425 Ga0501075_0043237 3300049591 Bacteria 3379
426 Ga0501075_0082658 3300049591 Bacteria 2432
427 Ga0501075_0087787 3300049591 Bacteria 2357
428 Ga0501075_0090368 3300049591 Bacteria 2323
429 Ga0501075_0332307 3300049591 Bacteria 1158
430 Ga0501076_0000350 3300049592 Bacteria 28487
431 Ga0501076_0004894 3300049592 Bacteria 9580
432 Ga0501076_0026791 3300049592 Bacteria 4468
433 Ga0501076_0046659 3300049592 Bacteria 3423
434 Ga0501076_0200841 3300049592 Bacteria 1628
435 Ga0501076_0309167 3300049592 Bacteria 1296
436 Ga0501076_0519758 3300049592 Bacteria 981
437 Ga0501077_0025426 3300049593 Bacteria 3761
438 Ga0501077_0087062 3300049593 Bacteria 1980
439 Ga0501077_0095435 3300049593 Bacteria 1885
440 Ga0501079_0011540 3300049741 Bacteria 6745
441 Ga0501079_0013584 3300049741 Bacteria 6211
442 Ga0501079_0014248 3300049741 Bacteria 6062
443 Ga0501079_0015415 3300049741 Bacteria 5832
444 Ga0501079_0083843 3300049741 Bacteria 2466
445 Ga0501080_0006728 3300049742 Bacteria 10353
446 Ga0501080_0080047 3300049742 Bacteria 3037
447 Ga0501080_0116342 3300049742 Bacteria 2479
448 Ga0501080_0140044 3300049742 Bacteria 2237
449 Ga0501080_0293235 3300049742 Bacteria 1477
450 Ga0501081_0004549 3300049743 Bacteria 8905
451 Ga0501081_0005117 3300049743 Bacteria 8439
452 Ga0501081_0008068 3300049743 Bacteria 6834
453 Ga0501081_0025004 3300049743 Bacteria 4014
454 Ga0501081_0128303 3300049743 Bacteria 1810
455 Ga0501083_0009494 3300049744 Bacteria 6872
456 Ga0501083_0019419 3300049744 Bacteria 4736
457 Ga0501083_0045577 3300049744 Bacteria 2966
458 Ga0501035_0071513 3300049822 Bacteria 3071
459 Ga0501045_0002799 3300049824 Bacteria 11923
460 Ga0501045_0013597 3300049824 Bacteria 5751
461 Ga0501045_0020911 3300049824 Bacteria 4679
462 Ga0501045_0024543 3300049824 Bacteria 4329
463 Ga0501045_0137738 3300049824 Bacteria 1815
464 nmdc:mga03683_6005_c1 3300050489 Bacteria 3597
465 nmdc:mga03683_80476_c1 3300050489 Bacteria 1406
466 nmdc:mga03n38_150937_c1 3300050490 Bacteria 1169
467 nmdc:mga03n38_4418_c1 3300050490 Bacteria 4658
468 nmdc:mga00v17_103412_c1 3300050491 Unclassified 1800
469 nmdc:mga0yw44_201066_c1 3300050492 Bacteria 1316
470 nmdc:mga0yw44_310596_c1 3300050492 Bacteria 1058
471 nmdc:mga0k408_132446_c1 3300050493 Bacteria 1480
472 nmdc:mga0k408_243382_c1 3300050493 Bacteria 1074
473 nmdc:mga06z11_17831_c1 3300050494 Bacteria 3232
474 nmdc:mga06z11_2941_c1 3300050494 Bacteria 6558
475 nmdc:mga06z11_3195_c1 3300050494 Bacteria 6330
476 nmdc:mga06z11_58521_c1 3300050494 Bacteria 2000
477 nmdc:mga04h51_453_c1 3300050495 Bacteria 9862
478 nmdc:mga07m45_2850_c1 3300050496 Bacteria 5629
479 nmdc:mga05p37_127362_c1 3300050507 Bacteria 2612
480 nmdc:mga05p37_133941_c1 3300050507 Bacteria 3040
481 nmdc:mga05p37_138_c1 3300050507 Bacteria 67838
482 nmdc:mga05p37_15169_c1 3300050507 Bacteria 9252
483 nmdc:mga05p37_190816_c1 3300050507 Bacteria 2488
484 nmdc:mga05p37_2361_c1 3300050507 Bacteria 21958
485 nmdc:mga05p37_237178_c1 3300050507 Bacteria 2195
486 nmdc:mga05p37_25130_c1 3300050507 Bacteria 5800
487 nmdc:mga05p37_3179_c1 3300050507 Bacteria 19103
488 nmdc:mga05p37_31917_c1 3300050507 Bacteria 6438
489 nmdc:mga05p37_334107_c1 3300050507 Bacteria 1789
490 nmdc:mga05p37_522985_c1 3300050507 Bacteria 1357
491 nmdc:mga05p37_68479_c1 3300050507 Bacteria 4364
492 nmdc:mga09592_1011_c1 3300050508 Bacteria 22343
493 nmdc:mga09592_1036_c1 3300050508 Bacteria 22060
494 nmdc:mga09592_254131_c1 3300050508 Bacteria 1523
495 nmdc:mga09592_494_c1 3300050508 Bacteria 29628
496 nmdc:mga09592_580760_c1 3300050508 Bacteria 961
497 nmdc:mga09592_75110_c1 3300050508 Bacteria 2873
498 nmdc:mga09592_79945_c1 3300050508 Bacteria 2784
499 nmdc:mga09592_83496_c1 3300050508 Bacteria 2723
500 nmdc:mga0qj67_1746_c1 3300050509 Bacteria 15360
501 nmdc:mga0qj67_4291_c1 3300050509 Bacteria 10334
502 nmdc:mga0qj67_98_c1 3300050509 Bacteria 57947
503 nmdc:mga06r32_124571_c1 3300050510 Bacteria 2544
504 nmdc:mga06r32_1405_c2 3300050510 Bacteria 21388
505 nmdc:mga06r32_15_c1 3300050510 Bacteria 106010
506 nmdc:mga06r32_175787_c1 3300050510 Bacteria 2125
507 nmdc:mga06r32_315_c1 3300050510 Bacteria 40418
508 nmdc:mga06r32_38498_c1 3300050510 Bacteria 4531
509 nmdc:mga06r32_45732_c1 3300050510 Bacteria 4174
510 nmdc:mga06r32_5202_c1 3300050510 Bacteria 11692
511 nmdc:mga06r32_5641_c1 3300050510 Bacteria 11260
512 nmdc:mga06r32_621148_c1 3300050510 Bacteria 1050
513 nmdc:mga08y16_1498_c1 3300050511 Bacteria 23520
514 nmdc:mga08y16_22839_c1 3300050511 Bacteria 6602
515 nmdc:mga08y16_40_c1 3300050511 Bacteria 130773
516 nmdc:mga08y16_91_c1 3300050511 Bacteria 19179
517 nmdc:mga0n895_141706_c1 3300050512 Unclassified 2433
518 nmdc:mga0n895_26155_c1 3300050512 Bacteria 5523
519 nmdc:mga0n895_2846_c1 3300050512 Bacteria 13710
520 nmdc:mga0n895_29315_c1 3300050512 Bacteria 5248
521 nmdc:mga0n895_56158_c1 3300050512 Bacteria 3878
522 nmdc:mga0n895_61625_c1 3300050512 Bacteria 3704
523 nmdc:mga0rr50_112715_c1 3300050513 Bacteria 2154
524 nmdc:mga0rr50_132705_c1 3300050513 Bacteria 1996
525 nmdc:mga0rr50_215812_c1 3300050513 Bacteria 1582
526 nmdc:mga0rr50_220980_c1 3300050513 Bacteria 1564
527 nmdc:mga0rr50_3084_c1 3300050513 Bacteria 9536
528 nmdc:mga0rr50_72225_c1 3300050513 Bacteria 2635
529 nmdc:mga08x19_121728_c1 3300050514 Bacteria 1750
530 nmdc:mga08x19_12184_c1 3300050514 Bacteria 5176
531 nmdc:mga08x19_14025_c1 3300050514 Bacteria 4856
532 nmdc:mga0a205_114204_c1 3300050515 Bacteria 2599
533 nmdc:mga0a205_240131_c1 3300050515 Bacteria 1693
534 nmdc:mga0a205_444_c1 3300050515 Bacteria 31211
535 nmdc:mga0a205_483747_c1 3300050515 Bacteria 1096
536 nmdc:mga0sz30_521_c1 3300050516 Bacteria 14404
537 Ga0500641_0007258 3300053096 Bacteria 3951
538 Ga0501084_0032152 3300054114 Bacteria 4388
539 Ga0501084_0052913 3300054114 Bacteria 3396
540 Ga0501084_0075425 3300054114 Bacteria 2825
541 Ga0501084_0613609 3300054114 Bacteria 919
542 Ga0501082_0024663 3300060353 Bacteria 5183
543 Ga0501082_0025892 3300060353 Bacteria 5056
544 Ga0501082_0048487 3300060353 Bacteria 3660
545 Ga0530510_0032654 3300061734 Bacteria 3746
546 Ga0530510_0060205 3300061734 Bacteria 2748
547 Ga0530510_0064377 3300061734 Bacteria 2656
548 Ga0530510_0074711 3300061734 Bacteria 2461
549 Ga0530510_0207943 3300061734 Bacteria 1454
550 Ga0530510_0359939 3300061734 Bacteria 1093
551 Ga0081455_10136734
552 Ga0065712_10169487
553 Ga0070676_10025943
554 Ga0070683_100148622
555 Ga0070690_100066736
556 Ga0070670_100040975
557 Ga0070670_100099641
558 Ga0070677_10120335
559 Ga0068869_100000768
560 Ga0068869_100015634
561 Ga0068869_100115588
562 Ga0070666_10158132
563 Ga0070680_100003078
564 Ga0070680_100074091
565 Ga0070682_100002528
566 Ga0068868_100062143
567 Ga0070660_100007427
568 Ga0070689_100097741
569 Ga0070691_10001482
570 Ga0070692_10025845
571 Ga0070669_100026597
572 Ga0070669_100113851
573 Ga0070675_100197627
574 Ga0070671_100284553
575 Ga0070674_100001928
576 Ga0070674_100036609
577 Ga0070674_100350653
578 Ga0070673_100328956
579 Ga0070688_100082915
580 Ga0070659_100000378
581 Ga0070711_100020457
582 Ga0070705_100001984
583 Ga0070705_100058522
584 Ga0070700_100101184
585 Ga0070700_100154945
586 Ga0070694_100000180
587 Ga0070694_100060086
588 Ga0070694_100120709
589 Ga0070708_100006859
590 Ga0070708_100094596
591 Ga0070708_100262216
592 Ga0070708_100300176
593 Ga0070663_100000411
594 Ga0070678_100047938
595 Ga0070678_100282862
596 Ga0070662_100007636
597 Ga0070681_10005266
598 Ga0068867_100227062
599 Ga0070706_100116618
600 Ga0070707_100046936
601 Ga0070707_100064154
602 Ga0070707_100082880
603 Ga0070707_100218398
604 Ga0070707_100221001
605 Ga0070698_100179081
606 Ga0070698_100240786
607 Ga0070699_100033681
608 Ga0070679_100003620
609 Ga0070679_100125604
610 Ga0070697_100041837
611 Ga0070697_100129013
612 Ga0070697_100187779
613 Ga0070697_100203674
614 Ga0068853_100000344
615 Ga0070672_100023126
616 Ga0070672_100050200
617 Ga0070672_100222594
618 Ga0070695_100000324
619 Ga0070695_100012280
620 Ga0070695_100027044
621 Ga0070695_100136609
622 Ga0070696_100002264
623 Ga0070696_100047207
624 Ga0070696_100102586
625 Ga0070696_100197647
626 Ga0070693_100000444
627 Ga0070693_100059359
628 Ga0070704_100004554
629 Ga0070704_100024273
630 Ga0070704_100379964
631 Ga0068855_100004550
632 Ga0068855_100360852
633 Ga0068855_100513381
634 Ga0070664_100003289
635 Ga0068857_100041818
636 Ga0068854_100001108
637 Ga0068854_100071995
638 Ga0068856_100001066
639 Ga0068852_100199675
640 Ga0068859_100006113
641 Ga0068859_100135657
642 Ga0068859_100207293
643 Ga0068859_100257788
644 Ga0068864_100002518
645 Ga0068864_100020124
646 Ga0068866_10009101
647 Ga0068861_100039674
648 Ga0068861_100362219
649 Ga0068870_10000456
650 Ga0068863_100032653
651 Ga0068863_100044730
652 Ga0068858_100069124
653 Ga0068860_100001154
654 Ga0068860_100007497
655 Ga0068860_100118971
656 Ga0068860_100146725
657 Ga0068860_100390957
658 Ga0068862_100004895
659 Ga0068862_100006318
660 Ga0068862_100007015
661 Ga0068862_100079237
662 Ga0081538_10011829
663 Ga0081540_1003214
664 Ga0081539_10007885
665 Ga0081539_10016709
666 Ga0075365_10218565
667 Ga0075368_10001440
668 Ga0075368_10028022
669 Ga0075363_100006192
670 Ga0075363_100118937
671 Ga0075364_10102590
672 Ga0070712_100008178
673 Ga0075362_10005740
674 Ga0075362_10018722
675 Ga0075367_10003360
676 Ga0075367_10024008
677 Ga0075367_10026528
678 Ga0075367_10074525
679 Ga0075367_10246767
680 Ga0075369_10007346
681 Ga0075366_10115864
682 Ga0097621_100205951
683 Ga0075370_10035544
684 Ga0068871_100113803
685 Ga0075428_100001683
686 Ga0075428_100003162
687 Ga0075428_100016526
688 Ga0075428_100017887
689 Ga0075428_100024043
690 Ga0075428_100037004
691 Ga0075428_100192373
692 Ga0075430_100000022
693 Ga0075430_100001713
694 Ga0075430_100027411
695 Ga0075430_100073119
696 Ga0075431_100000058
697 Ga0075431_100001000
698 Ga0075431_100010677
699 Ga0075431_100010992
700 Ga0075431_100016771
701 Ga0075431_100037522
702 Ga0075431_100038803
703 Ga0075431_100075381
704 Ga0075431_100202476
705 Ga0075431_100344348
706 Ga0075433_10000879
707 Ga0075433_10009435
708 Ga0075433_10189734
709 Ga0075433_10338693
710 Ga0075434_100002809
711 Ga0075434_100007246
712 Ga0075434_100080917
713 Ga0075434_100139732
714 Ga0075434_100201481
715 Ga0075434_100340429
716 Ga0075429_100000072
717 Ga0075429_100001141
718 Ga0075429_100004613
719 Ga0075429_100041584
720 Ga0075429_100062015
721 Ga0075436_100078911
722 Ga0075436_100147926
723 Ga0075436_100170928
724 Ga0097620_100006113
725 Ga0097620_100135657
726 Ga0097620_100145220
727 Ga0097620_100207280
728 Ga0097620_100257773
729 Ga0075435_100028625
730 Ga0075435_100034667
731 Ga0075435_100062939
732 Ga0075435_100103137
733 Ga0075435_100159103
734 Ga0099794_10053022
735 Ga0099794_10058445
736 Ga0111539_10003959
737 Ga0111539_10004083
738 Ga0111539_10008829
739 Ga0105247_10204671
740 Ga0114129_10000046
741 Ga0114129_10006267
742 Ga0114129_10014694
743 Ga0114129_10017939
744 Ga0114129_10019878
745 Ga0114129_10026076
746 Ga0114129_10044506
747 Ga0114129_10046252
748 Ga0114129_10076201
749 Ga0114129_10162561
750 Ga0114129_10172482
751 Ga0114129_10227106
752 Ga0114129_10797107
753 Ga0105243_10244479
754 Ga0105243_10293675
755 Ga0105241_10001830
756 Ga0105242_10240129
757 Ga0105248_10070491
758 Ga0105249_10019891
759 Ga0105249_10134868
760 Ga0105249_10237892
761 Ga0105239_10219798
762 Ga0105246_10376588
763 Ga0157373_10000079
764 Ga0157371_10053670
765 Ga0157371_10141055
766 Ga0157370_10443774
767 Ga0157369_10142590
768 Ga0157378_10017264
769 Ga0157378_10150125
770 Ga0157378_10701778
771 Ga0163162_10002583
772 Ga0157372_10002520
773 Ga0157372_10246723
774 Ga0157380_10007817
775 Ga0157380_10110736
776 Ga0157380_10543931
777 Ga0182008_10024489
778 Ga0157379_10011203
779 Ga0163161_10077149
780 Ga0207653_10014457
781 Ga0207682_10022493
782 Ga0207710_10136935
783 Ga0207688_10060773
784 Ga0207645_10001323
785 Ga0207645_10023741
786 Ga0207645_10040967
787 Ga0207643_10000087
788 Ga0207643_10052852
789 Ga0207684_10018567
790 Ga0207684_10020517
791 Ga0207684_10027632
792 Ga0207684_10052823
793 Ga0207684_10196651
794 Ga0207707_10000197
795 Ga0207671_10169819
796 Ga0207693_10029816
797 Ga0207660_10000872
798 Ga0207660_10056229
799 Ga0207657_10000264
800 Ga0207649_10006541
801 Ga0207652_10000553
802 Ga0207652_10018257
803 Ga0207646_10001806
804 Ga0207646_10018188
805 Ga0207646_10038411
806 Ga0207646_10083163
807 Ga0207681_10067350
808 Ga0207650_10079666
809 Ga0207690_10001929
810 Ga0207690_10297492
811 Ga0207706_10099356
812 Ga0207686_10020189
813 Ga0207709_10062793
814 Ga0207709_10134045
815 Ga0207670_10370650
816 Ga0207669_10005763
817 Ga0207669_10037862
818 Ga0207665_10009359
819 Ga0207691_10010131
820 Ga0207691_10024908
821 Ga0207691_10180288
822 Ga0207689_10000141
823 Ga0207689_10023925
824 Ga0207689_10106864
825 Ga0207689_10435952
826 Ga0207661_10151338
827 Ga0207679_10000465
828 Ga0207667_10001531
829 Ga0207667_10495890
830 Ga0207640_10000986
831 Ga0207640_10398332
832 Ga0207677_10039759
833 Ga0207703_10149008
834 Ga0207703_10294134
835 Ga0207639_10002524
836 Ga0207678_10002927
837 Ga0207708_10051647
838 Ga0207708_10116407
839 Ga0207702_10000986
840 Ga0207648_10002144
841 Ga0207648_10030413
842 Ga0207648_10184330
843 Ga0207648_10235302
844 Ga0207676_10011924
845 Ga0207676_10018630
846 Ga0207674_10000412
847 Ga0207675_100003572
848 Ga0207675_100083825
849 Ga0207683_10009008
850 Ga0207683_10318587
851 Ga0207698_10135825
852 Ga0209996_1000182
853 Ga0210000_1012766
854 Ga0209995_1001968
855 Ga0209999_1004352
856 Ga0209970_1000754
857 Ga0209983_1005965
858 Ga0209971_1000336
859 Ga0209966_1000098
860 Ga0209998_10000256
861 Ga0209813_10010209
862 Ga0209813_10023032
863 Ga0209974_10000509
864 Ga0209974_10026051
865 Ga0207428_10000009
866 Ga0207428_10000272
867 Ga0207428_10003480
868 Ga0207428_10028377
869 Ga0268265_10006793
870 Ga0268265_10014073
871 Ga0268265_10029115
872 Ga0268265_10689190
873 Ga0268264_10020831
874 Ga0268264_10040476
875 Ga0268264_10430454
876 Ga0265338_10042706
877 Ga0307408_100021416
878 Ga0307408_100147040
879 Ga0307516_10050069
880 Ga0307407_10169596
881 Ga0307416_100161260
882 Ga0307416_100387212
883 Ga0373948_0017161
884 Ga0373940_0002321
885 Ga0373949_0014727
886 Ga0373932_0055966
887 Ga0373941_0022073
888 Ga0373961_0010825
889 Ga0373962_0001746
890 Ga0373931_0007012
891 Ga0373935_0100187
892 Ga0373927_0035863
893 Ga0373925_0385740
894 Ga0395899_0079002
895 Ga0395900_0005351
896 Ga0395900_0083626
897 Ga0395898_0060256
898 Ga0395901_0024766
899 Ga0395901_0111961
900 Ga0439453_0001239
901 Ga0439441_003031
902 Ga0439443_002891
903 Ga0439455_0005946
904 Ga0439459_0003571
905 Ga0439464_0002156
906 Ga0439460_0000204
907 Ga0451577_0135300
908 Ga0451577_0137986
909 Ga0451577_0167056
910 Ga0451577_0199948
911 Ga0453683_0033101
912 Ga0453683_0076166
913 Ga0453684_0084317
914 Ga0453684_0691149
915 Ga0451576_0008864
916 Ga0451576_0052087
917 Ga0451576_0242233
918 Ga0451576_0244795
919 Ga0451576_0607434
920 Ga0451576_0643565
921 Ga0495580_0000221
922 Ga0495621_0039423
923 Ga0495656_0035904
924 Ga0496102_0020506
925 Ga0496104_0028286
926 Ga0496104_0175893
927 Ga0496106_0198241
928 Ga0496112_0129753
929 Ga0496112_0154110
930 Ga0501033_0302765
931 Ga0501034_0040424
932 Ga0501036_0032041
933 Ga0501036_0041842
934 Ga0501036_0229841
935 Ga0501038_0089933
936 Ga0501038_0115514
937 Ga0501039_0032424
938 Ga0501039_0220535
939 Ga0501040_0003262
940 Ga0501040_0027555
941 Ga0501040_0062750
942 Ga0501040_0080580
943 Ga0501040_0302675
944 Ga0501040_0413197
945 Ga0501041_0006609
946 Ga0501041_0061671
947 Ga0501042_0004324
948 Ga0501042_0012245
949 Ga0501042_0017831
950 Ga0501043_0109367
951 Ga0501046_0000467
952 Ga0501046_0181665
953 Ga0501046_0218907
954 Ga0501047_0056687
955 Ga0501048_0027088
956 Ga0501048_0140692
957 Ga0501067_0007368
958 Ga0501067_0090497
959 Ga0501068_0017400
960 Ga0501068_0066139
961 Ga0501069_0038108
962 Ga0501070_0035858
963 Ga0501071_0012283
964 Ga0501071_0016561
965 Ga0501071_0056471
966 Ga0501071_0240089
967 Ga0501072_0002766
968 Ga0501072_0019996
969 Ga0501072_0040970
970 Ga0501072_0055653
971 Ga0501073_0005180
972 Ga0501073_0042321
973 Ga0501074_0040982
974 Ga0501075_0000822
975 Ga0501075_0043237
976 Ga0501075_0082658
977 Ga0501075_0087787
978 Ga0501075_0090368
979 Ga0501075_0332307
980 Ga0501076_0000350
981 Ga0501076_0004894
982 Ga0501076_0026791
983 Ga0501076_0046659
984 Ga0501076_0200841
985 Ga0501076_0309167
986 Ga0501076_0519758
987 Ga0501077_0025426
988 Ga0501077_0087062
989 Ga0501077_0095435
990 Ga0501079_0011540
991 Ga0501079_0013584
992 Ga0501079_0014248
993 Ga0501079_0015415
994 Ga0501079_0083843
995 Ga0501080_0006728
996 Ga0501080_0080047
997 Ga0501080_0116342
998 Ga0501080_0140044
999 Ga0501080_0293235
1000 Ga0501081_0004549
1001 Ga0501081_0005117
1002 Ga0501081_0008068
1003 Ga0501081_0025004
1004 Ga0501081_0128303
1005 Ga0501083_0009494
1006 Ga0501083_0019419
1007 Ga0501083_0045577
1008 Ga0501035_0071513
1009 Ga0501045_0002799
1010 Ga0501045_0013597
1011 Ga0501045_0020911
1012 Ga0501045_0024543
1013 Ga0501045_0137738
1014 nmdc:mga03683_6005_c1
1015 nmdc:mga03683_80476_c1
1016 nmdc:mga03n38_150937_c1
1017 nmdc:mga03n38_4418_c1
1018 nmdc:mga00v17_103412_c1
1019 nmdc:mga0yw44_201066_c1
1020 nmdc:mga0yw44_310596_c1
1021 nmdc:mga0k408_132446_c1
1022 nmdc:mga0k408_243382_c1
1023 nmdc:mga06z11_17831_c1
1024 nmdc:mga06z11_2941_c1
1025 nmdc:mga06z11_3195_c1
1026 nmdc:mga06z11_58521_c1
1027 nmdc:mga04h51_453_c1
1028 nmdc:mga07m45_2850_c1
1029 nmdc:mga05p37_127362_c1
1030 nmdc:mga05p37_133941_c1
1031 nmdc:mga05p37_138_c1
1032 nmdc:mga05p37_15169_c1
1033 nmdc:mga05p37_190816_c1
1034 nmdc:mga05p37_2361_c1
1035 nmdc:mga05p37_237178_c1
1036 nmdc:mga05p37_25130_c1
1037 nmdc:mga05p37_3179_c1
1038 nmdc:mga05p37_31917_c1
1039 nmdc:mga05p37_334107_c1
1040 nmdc:mga05p37_522985_c1
1041 nmdc:mga05p37_68479_c1
1042 nmdc:mga09592_1011_c1
1043 nmdc:mga09592_1036_c1
1044 nmdc:mga09592_254131_c1
1045 nmdc:mga09592_494_c1
1046 nmdc:mga09592_580760_c1
1047 nmdc:mga09592_75110_c1
1048 nmdc:mga09592_79945_c1
1049 nmdc:mga09592_83496_c1
1050 nmdc:mga0qj67_1746_c1
1051 nmdc:mga0qj67_4291_c1
1052 nmdc:mga0qj67_98_c1
1053 nmdc:mga06r32_124571_c1
1054 nmdc:mga06r32_1405_c2
1055 nmdc:mga06r32_15_c1
1056 nmdc:mga06r32_175787_c1
1057 nmdc:mga06r32_315_c1
1058 nmdc:mga06r32_38498_c1
1059 nmdc:mga06r32_45732_c1
1060 nmdc:mga06r32_5202_c1
1061 nmdc:mga06r32_5641_c1
1062 nmdc:mga06r32_621148_c1
1063 nmdc:mga08y16_1498_c1
1064 nmdc:mga08y16_22839_c1
1065 nmdc:mga08y16_40_c1
1066 nmdc:mga08y16_91_c1
1067 nmdc:mga0n895_141706_c1
1068 nmdc:mga0n895_26155_c1
1069 nmdc:mga0n895_2846_c1
1070 nmdc:mga0n895_29315_c1
1071 nmdc:mga0n895_56158_c1
1072 nmdc:mga0n895_61625_c1
1073 nmdc:mga0rr50_112715_c1
1074 nmdc:mga0rr50_132705_c1
1075 nmdc:mga0rr50_215812_c1
1076 nmdc:mga0rr50_220980_c1
1077 nmdc:mga0rr50_3084_c1
1078 nmdc:mga0rr50_72225_c1
1079 nmdc:mga08x19_121728_c1
1080 nmdc:mga08x19_12184_c1
1081 nmdc:mga08x19_14025_c1
1082 nmdc:mga0a205_114204_c1
1083 nmdc:mga0a205_240131_c1
1084 nmdc:mga0a205_444_c1
1085 nmdc:mga0a205_483747_c1
1086 nmdc:mga0sz30_521_c1
1087 Ga0500641_0007258
1088 Ga0501084_0032152
1089 Ga0501084_0052913
1090 Ga0501084_0075425
1091 Ga0501084_0613609
1092 Ga0501082_0024663
1093 Ga0501082_0025892
1094 Ga0501082_0048487
1095 Ga0530510_0032654
1096 Ga0530510_0060205
1097 Ga0530510_0064377
1098 Ga0530510_0074711
1099 Ga0530510_0207943
1100 Ga0530510_0359939

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

33

289

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.9331 15 303
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.9177 15 303
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9173 2 299
3dr2-assembly1.cif.gz_A structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9166 2 299
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9055 2 299
ID Description Score Start End Superfamily
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9317 15 303 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9166 2 299 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9162 15 303 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9019 2 299 2.120.10.30
af_A0A2R8Q900_1_232_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8529 42 281 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A5C5SUN2-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9951 14 303 GO:0016787
GO:0046872
AF-A0A6A7MFV0-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9947 15 303 GO:0016787
GO:0046872
AF-A0A6B1G4I9-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9928 15 303 GO:0016787
GO:0046872
AF-A0A530BNP2-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9915 89 303 GO:0016787
AF-A0A2V7TU92-F1-model_v4 Gluconolactonase 0.9905 59 303 GO:0016787

Map