F462591

General Info

Members Datasets Scaffolds Average Seq Length
551 252 543 275

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100185761|Ga0097621_1001857612
Length 320
Sequence MQLLVPRTEELPELPVPVTRAGLANLLAWLWICQERPVPTPEAPVPRNKXXXHSKNNGNDQAAVPLKNKEYERELRKLQTKLVQMQEWVRATRAKVVIVFEGRDAAGKGGVIHRILERVSPRVFRHVALPAPTDREKSQLYAQRYIIHMPAAGEVIIFDRSWYNRALVEHVMEFCTDKQYADFMRMVPGFEGLLKNNGIILVKYWFEVSEKEQHRRFLRRIEDPMRRWKLSPMDLESHRRWYDYSRARDAMFAATDTPQSPWYVVQTDDKARARLNCISHLLNVVPWKEIPQEKVNLPKRQKPKGYKAPDWNYRWIPEKY

Samples

Sample ID Description Type Environment
1 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
2 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
3 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
4 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
5 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
6 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
7 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
8 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
184 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
204 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
213 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0.18
Isolates 1.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.45
Nodule 1.27
Rhizoplane 7.44
Rhizosphere 88.57
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10019971 3300003659 Bacteria 1451
2 Ga0070676_10000101 3300005328 Bacteria 30545
3 Ga0070676_10002705 3300005328 Bacteria 9137
4 Ga0070676_10007846 3300005328 Bacteria 5738
5 Ga0070683_100021245 3300005329 Bacteria 5790
6 Ga0070690_100000316 3300005330 Bacteria 24882
7 Ga0070670_100034394 3300005331 Bacteria 4360
8 Ga0070677_10004536 3300005333 Bacteria 4535
9 Ga0070677_10011959 3300005333 Bacteria 3004
10 Ga0068869_100019436 3300005334 Bacteria 4642
11 Ga0070666_10009585 3300005335 Bacteria 6043
12 Ga0070666_10019223 3300005335 Bacteria 4407
13 Ga0070680_100021494 3300005336 Bacteria 5129
14 Ga0070680_100216987 3300005336 Bacteria 1614
15 Ga0070682_100000741 3300005337 Bacteria 19505
16 Ga0070682_100059855 3300005337 Bacteria 2407
17 Ga0070682_100266537 3300005337 Bacteria 1242
18 Ga0068868_100127543 3300005338 Bacteria 2080
19 Ga0070660_100185246 3300005339 Bacteria 1685
20 Ga0070689_100003624 3300005340 Bacteria 10297
21 Ga0070689_100048959 3300005340 Bacteria 3261
22 Ga0070687_100006552 3300005343 Bacteria 4780
23 Ga0070661_100001050 3300005344 Bacteria 19539
24 Ga0070661_100090642 3300005344 Bacteria 2264
25 Ga0070668_100003368 3300005347 Bacteria 11789
26 Ga0070668_100065381 3300005347 Bacteria 2821
27 Ga0070669_100000736 3300005353 Bacteria 23856
28 Ga0070669_100017301 3300005353 Bacteria 5142
29 Ga0070669_100081382 3300005353 Bacteria 2412
30 Ga0070675_100007885 3300005354 Bacteria 8254
31 Ga0070675_100010135 3300005354 Bacteria 7350
32 Ga0070674_100219230 3300005356 Bacteria 1479
33 Ga0070674_100307543 3300005356 Bacteria 1266
34 Ga0070673_100009134 3300005364 Bacteria 6639
35 Ga0070688_100000908 3300005365 Bacteria 14783
36 Ga0070659_100009584 3300005366 Bacteria 7118
37 Ga0070659_100131413 3300005366 Bacteria 2034
38 Ga0070659_100282996 3300005366 Bacteria 1380
39 Ga0070667_100000911 3300005367 Bacteria 27330
40 Ga0070667_100270931 3300005367 Bacteria 1522
41 Ga0070667_100403538 3300005367 Bacteria 1244
42 Ga0070709_10002775 3300005434 Bacteria 9464
43 Ga0070709_10033821 3300005434 Bacteria 3094
44 Ga0070709_10081930 3300005434 Bacteria 2107
45 Ga0070714_100004834 3300005435 Bacteria 10226
46 Ga0070714_100019717 3300005435 Bacteria 5499
47 Ga0070714_100099511 3300005435 Bacteria 2559
48 Ga0070714_100234619 3300005435 Bacteria 1691
49 Ga0070714_100303333 3300005435 Bacteria 1489
50 Ga0070713_100000630 3300005436 Bacteria 22493
51 Ga0070713_100094526 3300005436 Bacteria 2577
52 Ga0070713_100107789 3300005436 Bacteria 2424
53 Ga0070713_100183380 3300005436 Bacteria 1882
54 Ga0070713_100229766 3300005436 Bacteria 1686
55 Ga0070710_10001617 3300005437 Bacteria 10635
56 Ga0070710_10023188 3300005437 Bacteria 3258
57 Ga0070710_10234957 3300005437 Bacteria 1172
58 Ga0070710_10304258 3300005437 Bacteria 1041
59 Ga0070711_100015086 3300005439 Bacteria 4883
60 Ga0070711_100025501 3300005439 Bacteria 3869
61 Ga0070711_100120105 3300005439 Bacteria 1942
62 Ga0070711_100191440 3300005439 Bacteria 1572
63 Ga0070711_100345360 3300005439 Bacteria 1195
64 Ga0070700_100000459 3300005441 Bacteria 20451
65 Ga0070663_100000852 3300005455 Bacteria 16523
66 Ga0070678_100005813 3300005456 Bacteria 7177
67 Ga0070678_100426560 3300005456 Bacteria 1157
68 Ga0070662_100001503 3300005457 Bacteria 14349
69 Ga0070662_100013482 3300005457 Bacteria 5439
70 Ga0070681_10000040 3300005458 Bacteria 92043
71 Ga0070681_10086737 3300005458 Bacteria 3083
72 Ga0068867_100018950 3300005459 Bacteria 4899
73 Ga0068867_100048593 3300005459 Bacteria 3122
74 Ga0068867_100216363 3300005459 Bacteria 1541
75 Ga0070685_10047804 3300005466 Bacteria 2462
76 Ga0070685_10087251 3300005466 Bacteria 1882
77 Ga0070706_100001802 3300005467 Bacteria 22190
78 Ga0070706_100006607 3300005467 Bacteria 10940
79 Ga0070706_100013807 3300005467 Bacteria 7468
80 Ga0070706_100015247 3300005467 Bacteria 7095
81 Ga0070707_100020357 3300005468 Bacteria 6258
82 Ga0070698_100040621 3300005471 Bacteria 4780
83 Ga0070698_100128413 3300005471 Bacteria 2491
84 Ga0070699_100007216 3300005518 Bacteria 9667
85 Ga0070679_100001695 3300005530 Bacteria 19860
86 Ga0070679_100075536 3300005530 Bacteria 3359
87 Ga0070684_100017328 3300005535 Bacteria 5909
88 Ga0070684_100030307 3300005535 Bacteria 4595
89 Ga0070697_100053685 3300005536 Bacteria 3276
90 Ga0068853_100014364 3300005539 Bacteria 6483
91 Ga0068853_100397068 3300005539 Bacteria 1290
92 Ga0070672_100000298 3300005543 Bacteria 28086
93 Ga0070672_100027102 3300005543 Bacteria 4272
94 Ga0070672_100283433 3300005543 Bacteria 1401
95 Ga0070686_100000989 3300005544 Bacteria 16399
96 Ga0070686_100004160 3300005544 Bacteria 7962
97 Ga0070686_100030995 3300005544 Bacteria 3266
98 Ga0070695_100140845 3300005545 Bacteria 1672
99 Ga0070696_100183355 3300005546 Bacteria 1554
100 Ga0070693_100041185 3300005547 Bacteria 2597
101 Ga0070693_100233104 3300005547 Bacteria 1212
102 Ga0070665_100006728 3300005548 Bacteria 11683
103 Ga0068855_100000096 3300005563 Bacteria 106521
104 Ga0068855_100008121 3300005563 Bacteria 12684
105 Ga0068855_100019518 3300005563 Bacteria 8144
106 Ga0068855_100625717 3300005563 Bacteria 1158
107 Ga0070664_100001668 3300005564 Bacteria 17764
108 Ga0070664_100014281 3300005564 Bacteria 6476
109 Ga0070664_100097401 3300005564 Bacteria 2554
110 Ga0070664_100220418 3300005564 Bacteria 1697
111 Ga0068857_100054179 3300005577 Bacteria 3559
112 Ga0068857_100299181 3300005577 Bacteria 1483
113 Ga0068854_100000511 3300005578 Bacteria 23621
114 Ga0068854_100004868 3300005578 Bacteria 8472
115 Ga0068854_100020413 3300005578 Bacteria 4482
116 Ga0068854_100117557 3300005578 Bacteria 2014
117 Ga0068856_100000756 3300005614 Bacteria 35122
118 Ga0068856_100004750 3300005614 Bacteria 13482
119 Ga0068856_100005937 3300005614 Bacteria 12021
120 Ga0068856_100008332 3300005614 Bacteria 10100
121 Ga0068856_100022293 3300005614 Bacteria 6157
122 Ga0068852_100009195 3300005616 Bacteria 7322
123 Ga0068852_100081927 3300005616 Bacteria 2866
124 Ga0068852_100678119 3300005616 Bacteria 1040
125 Ga0068859_100002596 3300005617 Bacteria 18386
126 Ga0068859_100005789 3300005617 Bacteria 12557
127 Ga0068859_100007474 3300005617 Bacteria 11092
128 Ga0068859_100014631 3300005617 Bacteria 7882
129 Ga0068864_100006459 3300005618 Bacteria 9604
130 Ga0068864_100054036 3300005618 Bacteria 3466
131 Ga0068866_10002832 3300005718 Bacteria 7147
132 Ga0068866_10188937 3300005718 Bacteria 1222
133 Ga0068851_10002982 3300005834 Bacteria 7478
134 Ga0068863_100000830 3300005841 Bacteria 31001
135 Ga0068863_100000951 3300005841 Bacteria 29079
136 Ga0068863_100082372 3300005841 Bacteria 3049
137 Ga0068858_100001155 3300005842 Bacteria 27330
138 Ga0068858_100006190 3300005842 Bacteria 11669
139 Ga0068858_100006823 3300005842 Bacteria 11107
140 Ga0068858_100023747 3300005842 Bacteria 5712
141 Ga0068858_100042971 3300005842 Bacteria 4191
142 Ga0068858_100046652 3300005842 Bacteria 4016
143 Ga0068860_100000796 3300005843 Bacteria 35406
144 Ga0068860_100021617 3300005843 Bacteria 6229
145 Ga0068862_100025568 3300005844 Bacteria 4957
146 Ga0081538_10007935 3300005981 Bacteria 9085
147 Ga0081540_1000086 3300005983 Bacteria 99615
148 Ga0070717_10000492 3300006028 Bacteria 25105
149 Ga0070717_10000947 3300006028 Bacteria 19311
150 Ga0070717_10055780 3300006028 Bacteria 3261
151 Ga0075365_10022846 3300006038 Bacteria 3924
152 Ga0070715_10005882 3300006163 Bacteria 4129
153 Ga0070716_100017097 3300006173 Bacteria 3754
154 Ga0070716_100029051 3300006173 Bacteria 2985
155 Ga0070716_100060060 3300006173 Bacteria 2194
156 Ga0070716_100113702 3300006173 Unclassified 1682
157 Ga0070712_100005241 3300006175 Bacteria 8019
158 Ga0070712_100011522 3300006175 Bacteria 5609
159 Ga0070712_100017619 3300006175 Bacteria 4626
160 Ga0070712_100120682 3300006175 Unclassified 1972
161 Ga0070712_100413186 3300006175 Unclassified 1117
162 Ga0075367_10108288 3300006178 Bacteria 1703
163 Ga0097621_100001314 3300006237 Bacteria 17096
164 Ga0097621_100002377 3300006237 Bacteria 12896
165 Ga0097621_100004753 3300006237 Bacteria 9498
166 Ga0097621_100005174 3300006237 Bacteria 9165
167 Ga0097621_100006541 3300006237 Bacteria 8279
168 Ga0097621_100041120 3300006237 Bacteria 3719
169 Ga0097621_100185761 3300006237 Unclassified 1798
170 Ga0097621_100392444 3300006237 Bacteria 1241
171 Ga0068871_100000226 3300006358 Bacteria 39929
172 Ga0068871_100001612 3300006358 Bacteria 15186
173 Ga0068871_100002435 3300006358 Bacteria 12720
174 Ga0068871_100025860 3300006358 Bacteria 4573
175 Ga0068865_100032599 3300006881 Bacteria 3482
176 Ga0068865_100070967 3300006881 Bacteria 2469
177 Ga0097620_100002596 3300006931 Bacteria 18386
178 Ga0097620_100005789 3300006931 Bacteria 12557
179 Ga0097620_100007475 3300006931 Bacteria 11092
180 Ga0097620_100014631 3300006931 Bacteria 7882
181 Ga0075435_100118279 3300007076 Bacteria 2209
182 Ga0075435_100225571 3300007076 Bacteria 1591
183 Ga0099795_10023321 3300007788 Bacteria 2053
184 Ga0105251_10089360 3300009011 Bacteria 1417
185 Ga0105244_10137302 3300009036 Bacteria 1178
186 Ga0105240_10000820 3300009093 Bacteria 56524
187 Ga0105240_10002935 3300009093 Bacteria 26898
188 Ga0105240_10070607 3300009093 Bacteria 4320
189 Ga0105240_10105397 3300009093 Bacteria 3423
190 Ga0111539_10393846 3300009094 Bacteria 1613
191 Ga0111539_10755047 3300009094 Bacteria 1132
192 Ga0111539_10897954 3300009094 Bacteria 1031
193 Ga0105245_10004827 3300009098 Bacteria 11885
194 Ga0105245_10012267 3300009098 Bacteria 7456
195 Ga0105247_10001142 3300009101 Bacteria 19668
196 Ga0105247_10204729 3300009101 Bacteria 1328
197 Ga0114129_10901665 3300009147 Bacteria 1120
198 Ga0105243_10005098 3300009148 Bacteria 10309
199 Ga0105243_10186796 3300009148 Bacteria 1807
200 Ga0105241_10022224 3300009174 Unclassified 4697
201 Ga0105241_10147583 3300009174 Bacteria 1921
202 Ga0105241_10585235 3300009174 Bacteria 1006
203 Ga0105248_10003754 3300009177 Bacteria 16832
204 Ga0105248_10004230 3300009177 Bacteria 15879
205 Ga0105248_10011571 3300009177 Bacteria 9720
206 Ga0105248_10026078 3300009177 Bacteria 6503
207 Ga0105248_10073281 3300009177 Bacteria 3849
208 Ga0105248_10298890 3300009177 Unclassified 1813
209 Ga0105237_10029342 3300009545 Bacteria 5593
210 Ga0105237_10289705 3300009545 Bacteria 1640
211 Ga0105237_10538786 3300009545 Unclassified 1174
212 Ga0105238_10000548 3300009551 Bacteria 39283
213 Ga0105238_10024369 3300009551 Bacteria 6168
214 Ga0105238_10121197 3300009551 Bacteria 2595
215 Ga0105238_10172436 3300009551 Bacteria 2139
216 Ga0105249_10016745 3300009553 Bacteria 6505
217 Ga0105032_101960 3300009979 Bacteria 1860
218 Ga0105239_10031370 3300010375 Bacteria 5846
219 Ga0105239_10037990 3300010375 Bacteria 5276
220 Ga0105239_10122614 3300010375 Bacteria 2888
221 Ga0105239_10152972 3300010375 Bacteria 2575
222 Ga0105246_10016586 3300011119 Bacteria 4665
223 Ga0105246_10103764 3300011119 Bacteria 2075
224 Ga0157373_10033694 3300013100 Bacteria 3682
225 Ga0157371_10271057 3300013102 Bacteria 1225
226 Ga0157371_10289852 3300013102 Bacteria 1183
227 Ga0157369_10000041 3300013105 Bacteria 181798
228 Ga0157369_10001859 3300013105 Bacteria 25438
229 Ga0157369_10054472 3300013105 Bacteria 4319
230 Ga0157369_10168208 3300013105 Bacteria 2311
231 Ga0157374_10000078 3300013296 Bacteria 97051
232 Ga0157374_10004157 3300013296 Bacteria 12146
233 Ga0157374_10004200 3300013296 Bacteria 12102
234 Ga0157374_10098935 3300013296 Bacteria 2793
235 Ga0157374_10164640 3300013296 Bacteria 2161
236 Ga0157378_10002970 3300013297 Bacteria 15072
237 Ga0157378_10005309 3300013297 Bacteria 11312
238 Ga0157378_10013891 3300013297 Bacteria 7042
239 Ga0157378_10020009 3300013297 Bacteria 5884
240 Ga0157378_10078362 3300013297 Bacteria 2980
241 Ga0157378_10202937 3300013297 Unclassified 1876
242 Ga0163162_10008849 3300013306 Bacteria 9789
243 Ga0163162_10009457 3300013306 Bacteria 9478
244 Ga0163162_10013536 3300013306 Bacteria 7965
245 Ga0163162_10024609 3300013306 Bacteria 5945
246 Ga0163162_10115293 3300013306 Bacteria 2787
247 Ga0163162_10302070 3300013306 Bacteria 1733
248 Ga0157372_10000431 3300013307 Bacteria 46220
249 Ga0157372_10006059 3300013307 Bacteria 12846
250 Ga0157372_10008205 3300013307 Bacteria 11100
251 Ga0157372_10011026 3300013307 Bacteria 9620
252 Ga0157372_10146428 3300013307 Bacteria 2724
253 Ga0157372_10226307 3300013307 Unclassified 2168
254 Ga0157372_10267779 3300013307 Bacteria 1985
255 Ga0157372_10318689 3300013307 Bacteria 1810
256 Ga0157375_10001027 3300013308 Bacteria 24079
257 Ga0157375_10003850 3300013308 Bacteria 13020
258 Ga0157375_10026976 3300013308 Bacteria 5363
259 Ga0163163_10011593 3300014325 Bacteria 8007
260 Ga0163163_10232067 3300014325 Bacteria 1894
261 Ga0157380_10000360 3300014326 Bacteria 27339
262 Ga0157380_10179907 3300014326 Bacteria 1857
263 Ga0157380_10627594 3300014326 Bacteria 1068
264 Ga0182008_10025824 3300014497 Bacteria 2982
265 Ga0157377_10126241 3300014745 Unclassified 1557
266 Ga0157379_10004258 3300014968 Bacteria 12219
267 Ga0157379_10005735 3300014968 Bacteria 10682
268 Ga0157379_10059545 3300014968 Bacteria 3414
269 Ga0157379_10158179 3300014968 Unclassified 2045
270 Ga0157379_10183967 3300014968 Bacteria 1888
271 Ga0157376_10015161 3300014969 Bacteria 5813
272 Ga0157376_10017042 3300014969 Bacteria 5532
273 Ga0157376_10125928 3300014969 Bacteria 2279
274 Ga0163161_10011240 3300017792 Bacteria 6203
275 Ga0207697_10000796 3300025315 Bacteria 17885
276 Ga0207656_10138913 3300025321 Bacteria 1144
277 Ga0207655_1003545 3300025728 Bacteria 11558
278 Ga0207713_1076030 3300025735 Bacteria 1223
279 Ga0207692_10075187 3300025898 Bacteria 1791
280 Ga0207692_10084588 3300025898 Bacteria 1705
281 Ga0207692_10233931 3300025898 Unclassified 1094
282 Ga0207680_10003866 3300025903 Bacteria 7056
283 Ga0207680_10025629 3300025903 Bacteria 3255
284 Ga0207680_10059983 3300025903 Bacteria 2314
285 Ga0207699_10040480 3300025906 Bacteria 2685
286 Ga0207699_10042899 3300025906 Bacteria 2624
287 Ga0207699_10072613 3300025906 Bacteria 2108
288 Ga0207645_10002303 3300025907 Bacteria 15085
289 Ga0207645_10005194 3300025907 Bacteria 9506
290 Ga0207645_10027038 3300025907 Bacteria 3707
291 Ga0207684_10001829 3300025910 Bacteria 22210
292 Ga0207684_10026227 3300025910 Bacteria 4968
293 Ga0207684_10285922 3300025910 Bacteria 1422
294 Ga0207654_10005026 3300025911 Bacteria 6683
295 Ga0207654_10041014 3300025911 Unclassified 2611
296 Ga0207654_10335345 3300025911 Bacteria 1037
297 Ga0207707_10000194 3300025912 Bacteria 64241
298 Ga0207707_10082632 3300025912 Bacteria 2804
299 Ga0207695_10014360 3300025913 Bacteria 9389
300 Ga0207695_10024621 3300025913 Bacteria 6764
301 Ga0207695_10166608 3300025913 Bacteria 2131
302 Ga0207695_10281579 3300025913 Bacteria 1556
303 Ga0207671_10245967 3300025914 Bacteria 1406
304 Ga0207693_10000286 3300025915 Bacteria 47012
305 Ga0207693_10004130 3300025915 Bacteria 12327
306 Ga0207693_10004585 3300025915 Bacteria 11658
307 Ga0207693_10005273 3300025915 Bacteria 10812
308 Ga0207693_10026242 3300025915 Bacteria 4611
309 Ga0207693_10134477 3300025915 Unclassified 1944
310 Ga0207693_10250572 3300025915 Bacteria 1389
311 Ga0207663_10001808 3300025916 Bacteria 10102
312 Ga0207663_10034135 3300025916 Bacteria 3039
313 Ga0207663_10034220 3300025916 Bacteria 3036
314 Ga0207663_10082853 3300025916 Bacteria 2105
315 Ga0207663_10271278 3300025916 Bacteria 1257
316 Ga0207660_10186237 3300025917 Bacteria 1615
317 Ga0207662_10009401 3300025918 Bacteria 5377
318 Ga0207657_10002061 3300025919 Bacteria 21741
319 Ga0207649_10052895 3300025920 Bacteria 2521
320 Ga0207652_10329020 3300025921 Bacteria 1380
321 Ga0207646_10000469 3300025922 Bacteria 53872
322 Ga0207646_10295955 3300025922 Bacteria 1462
323 Ga0207681_10000592 3300025923 Bacteria 24653
324 Ga0207681_10045669 3300025923 Bacteria 2942
325 Ga0207681_10070861 3300025923 Bacteria 2429
326 Ga0207694_10002301 3300025924 Bacteria 15627
327 Ga0207694_10016132 3300025924 Bacteria 5638
328 Ga0207650_10023555 3300025925 Bacteria 4367
329 Ga0207659_10011409 3300025926 Bacteria 5613
330 Ga0207659_10013840 3300025926 Bacteria 5184
331 Ga0207687_10000114 3300025927 Bacteria 57692
332 Ga0207687_10038307 3300025927 Bacteria 3276
333 Ga0207687_10465816 3300025927 Bacteria 1050
334 Ga0207700_10006699 3300025928 Bacteria 6990
335 Ga0207700_10009057 3300025928 Bacteria 6197
336 Ga0207700_10025316 3300025928 Bacteria 4119
337 Ga0207700_10155322 3300025928 Bacteria 1895
338 Ga0207700_10506440 3300025928 Bacteria 1069
339 Ga0207664_10000770 3300025929 Bacteria 21696
340 Ga0207664_10008332 3300025929 Bacteria 7224
341 Ga0207664_10108670 3300025929 Bacteria 2303
342 Ga0207664_10242042 3300025929 Bacteria 1571
343 Ga0207644_10042148 3300025931 Bacteria 3233
344 Ga0207644_10186048 3300025931 Bacteria 1631
345 Ga0207644_10237814 3300025931 Bacteria 1449
346 Ga0207690_10120148 3300025932 Bacteria 1907
347 Ga0207706_10000142 3300025933 Bacteria 78326
348 Ga0207706_10002518 3300025933 Bacteria 17874
349 Ga0207686_10092439 3300025934 Bacteria 2000
350 Ga0207709_10029484 3300025935 Bacteria 3184
351 Ga0207709_10031995 3300025935 Bacteria 3078
352 Ga0207670_10000059 3300025936 Bacteria 78072
353 Ga0207670_10035026 3300025936 Bacteria 3252
354 Ga0207669_10001832 3300025937 Bacteria 9000
355 Ga0207669_10100828 3300025937 Bacteria 1908
356 Ga0207704_10106491 3300025938 Bacteria 1884
357 Ga0207665_10001827 3300025939 Bacteria 14322
358 Ga0207665_10005832 3300025939 Bacteria 8196
359 Ga0207665_10028515 3300025939 Bacteria 3688
360 Ga0207665_10053282 3300025939 Bacteria 2727
361 Ga0207665_10080241 3300025939 Bacteria 2244
362 Ga0207665_10158681 3300025939 Bacteria 1625
363 Ga0207665_10167730 3300025939 Bacteria 1583
364 Ga0207691_10029438 3300025940 Bacteria 5137
365 Ga0207691_10118401 3300025940 Bacteria 2349
366 Ga0207711_10005720 3300025941 Bacteria 10489
367 Ga0207711_10013309 3300025941 Bacteria 6836
368 Ga0207711_10059275 3300025941 Bacteria 3296
369 Ga0207711_10309287 3300025941 Bacteria 1459
370 Ga0207711_10450658 3300025941 Bacteria 1198
371 Ga0207689_10006195 3300025942 Bacteria 10596
372 Ga0207689_10068787 3300025942 Bacteria 2910
373 Ga0207689_10272965 3300025942 Bacteria 1400
374 Ga0207679_10010543 3300025945 Bacteria 5956
375 Ga0207679_10031660 3300025945 Bacteria 3704
376 Ga0207679_10157870 3300025945 Bacteria 1854
377 Ga0207679_10173185 3300025945 Bacteria 1779
378 Ga0207667_10000821 3300025949 Bacteria 40162
379 Ga0207667_10002541 3300025949 Bacteria 22699
380 Ga0207667_10005864 3300025949 Bacteria 14958
381 Ga0207667_10041670 3300025949 Bacteria 4882
382 Ga0207712_10006834 3300025961 Bacteria 7199
383 Ga0207712_10066351 3300025961 Bacteria 2580
384 Ga0207668_10004797 3300025972 Bacteria 7960
385 Ga0207668_10011986 3300025972 Bacteria 5291
386 Ga0207640_10005281 3300025981 Bacteria 7035
387 Ga0207640_10057358 3300025981 Bacteria 2561
388 Ga0207640_10131896 3300025981 Bacteria 1808
389 Ga0207640_10472374 3300025981 Bacteria 1038
390 Ga0207658_10000510 3300025986 Bacteria 35545
391 Ga0207658_10048610 3300025986 Bacteria 3111
392 Ga0207658_10203914 3300025986 Bacteria 1653
393 Ga0207677_10002896 3300026023 Bacteria 9062
394 Ga0207677_10006776 3300026023 Bacteria 6294
395 Ga0207703_10001422 3300026035 Bacteria 21834
396 Ga0207703_10008453 3300026035 Bacteria 8134
397 Ga0207703_10009168 3300026035 Bacteria 7790
398 Ga0207703_10017852 3300026035 Bacteria 5541
399 Ga0207703_10051158 3300026035 Bacteria 3347
400 Ga0207703_10059442 3300026035 Bacteria 3122
401 Ga0207703_10069427 3300026035 Unclassified 2906
402 Ga0207639_10023769 3300026041 Bacteria 4427
403 Ga0207639_10040460 3300026041 Bacteria 3479
404 Ga0207639_10128502 3300026041 Bacteria 2094
405 Ga0207678_10000039 3300026067 Bacteria 101198
406 Ga0207678_10083605 3300026067 Bacteria 2731
407 Ga0207708_10000274 3300026075 Bacteria 40319
408 Ga0207702_10000275 3300026078 Bacteria 59296
409 Ga0207702_10004239 3300026078 Bacteria 12805
410 Ga0207702_10007064 3300026078 Bacteria 9602
411 Ga0207702_10142268 3300026078 Bacteria 2172
412 Ga0207641_10001218 3300026088 Bacteria 25753
413 Ga0207641_10010148 3300026088 Bacteria 7746
414 Ga0207641_10014501 3300026088 Bacteria 6459
415 Ga0207641_10025030 3300026088 Unclassified 4922
416 Ga0207648_10001492 3300026089 Bacteria 25769
417 Ga0207648_10007986 3300026089 Bacteria 10322
418 Ga0207676_10008441 3300026095 Bacteria 7324
419 Ga0207676_10099084 3300026095 Bacteria 2411
420 Ga0207674_10004700 3300026116 Bacteria 16372
421 Ga0207674_10038466 3300026116 Bacteria 4963
422 Ga0207675_100001773 3300026118 Bacteria 21566
423 Ga0207683_10002047 3300026121 Bacteria 17847
424 Ga0207683_10068440 3300026121 Bacteria 3134
425 Ga0207683_10149833 3300026121 Bacteria 2105
426 Ga0207698_10009126 3300026142 Bacteria 6303
427 Ga0207698_10015206 3300026142 Bacteria 5149
428 Ga0207698_10032781 3300026142 Bacteria 3768
429 Ga0268266_10005246 3300028379 Bacteria 12168
430 Ga0268265_10326946 3300028380 Bacteria 1391
431 Ga0268264_10007395 3300028381 Bacteria 9168
432 Ga0268264_10035895 3300028381 Bacteria 4082
433 Ga0265760_10091153 3300031090 Bacteria 954
434 Ga0307408_100122032 3300031548 Bacteria 2020
435 Ga0307410_10060147 3300031852 Bacteria 2596
436 Ga0307407_10012672 3300031903 Bacteria 4062
437 Ga0373950_0039980 3300034818 Bacteria 895
438 Ga0373934_0054135 3300035086 Bacteria 1593
439 Ga0373952_0008724 3300035092 Bacteria 1928
440 Ga0373923_0016392 3300035111 Bacteria 2814
441 Ga0373936_0028470 3300035113 Bacteria 2196
442 Ga0373941_0073799 3300035115 Bacteria 1138
443 Ga0373954_0057340 3300035118 Unclassified 1834
444 Ga0373956_0012483 3300035119 Bacteria 3523
445 Ga0373943_0094834 3300035170 Bacteria 1551
446 Ga0373943_0258554 3300035170 Bacteria 980
447 Ga0373946_0022055 3300035171 Unclassified 2476
448 Ga0373955_0281479 3300035172 Bacteria 1001
449 Ga0373931_0031651 3300035691 Bacteria 2731
450 Ga0373931_0088260 3300035691 Bacteria 1723
451 Ga0373931_0172313 3300035691 Unclassified 1276
452 Ga0373927_0000189 3300035695 Bacteria 49133
453 Ga0373927_0159532 3300035695 Unclassified 1477
454 Ga0373933_0028504 3300035724 Bacteria 3222
455 Ga0373947_0042546 3300035725 Unclassified 2711
456 Ga0373937_0123869 3300036401 Bacteria 2410
457 Ga0373925_0001487 3300037068 Bacteria 20123
458 Ga0373925_0001494 3300037068 Bacteria 20080
459 Ga0373925_0021475 3300037068 Bacteria 4704
460 Ga0373925_0051715 3300037068 Unclassified 3067
461 Ga0395899_0089819 3300037312 Bacteria 2228
462 Ga0395900_0015389 3300037418 Bacteria 7796
463 Ga0395900_0055835 3300037418 Bacteria 4066
464 Ga0395901_0039977 3300038443 Bacteria 4855
465 Ga0451793_0709325 3300041452 Bacteria 1870
466 Ga0451853_2281844 3300041512 Bacteria 1963
467 Ga0495653_0376667 3300046463 Unclassified 907
468 Ga0495580_0002429 3300046472 Bacteria 16279
469 Ga0495580_0013063 3300046472 Bacteria 6356
470 Ga0495580_0046503 3300046472 Bacteria 3079
471 Ga0495608_0335193 3300046511 Bacteria 933
472 Ga0495630_0556893 3300046517 Bacteria 879
473 Ga0495642_0055879 3300046528 Bacteria 1630
474 Ga0495587_0182710 3300046536 Unclassified 1189
475 Ga0495633_0015766 3300046558 Bacteria 3915
476 Ga0495656_0002009 3300046615 Bacteria 6697
477 Ga0495659_0002916 3300046664 Bacteria 5495
478 Ga0495588_0011026 3300046674 Bacteria 4229
479 Ga0495670_0009420 3300046691 Bacteria 4800
480 Ga0495604_0191050 3300047317 Bacteria 1427
481 Ga0495677_0038306 3300047445 Bacteria 1752
482 Ga0495681_0015145 3300047470 Bacteria 4375
483 Ga0496100_0020193 3300048903 Bacteria 3990
484 Ga0496100_0119500 3300048903 Bacteria 1841
485 Ga0496101_0046163 3300048904 Bacteria 3123
486 Ga0496101_0051121 3300048904 Bacteria 2977
487 Ga0496101_0248263 3300048904 Unclassified 1386
488 Ga0496102_0000322 3300048905 Bacteria 59788
489 Ga0496102_0007102 3300048905 Bacteria 9560
490 Ga0496102_0042318 3300048905 Bacteria 4127
491 Ga0496103_0002175 3300048906 Bacteria 12451
492 Ga0496103_0080158 3300048906 Bacteria 2052
493 Ga0496104_0057955 3300048907 Bacteria 3665
494 Ga0496104_0079288 3300048907 Unclassified 3130
495 Ga0496104_0197901 3300048907 Bacteria 1921
496 Ga0496105_0317434 3300048908 Bacteria 1249
497 Ga0496105_0336344 3300048908 Bacteria 1208
498 Ga0496105_0366224 3300048908 Bacteria 1149
499 Ga0496106_0003494 3300048909 Bacteria 11706
500 Ga0496106_0034415 3300048909 Unclassified 3783
501 Ga0496106_0054971 3300048909 Bacteria 3008
502 Ga0496107_0076556 3300048910 Bacteria 2436
503 Ga0496107_0077743 3300048910 Bacteria 2417
504 Ga0496107_0109882 3300048910 Bacteria 2025
505 Ga0496108_0035265 3300048911 Bacteria 4157
506 Ga0496108_0042824 3300048911 Bacteria 3780
507 Ga0496109_0071270 3300048912 Bacteria 3190
508 Ga0496109_0206589 3300048912 Bacteria 1846
509 Ga0496109_0401426 3300048912 Bacteria 1295
510 Ga0496110_0008685 3300048913 Bacteria 8181
511 Ga0496110_0059359 3300048913 Bacteria 3372
512 Ga0496110_0158447 3300048913 Bacteria 2051
513 Ga0496111_0014633 3300048914 Bacteria 5367
514 Ga0496111_0140352 3300048914 Bacteria 1790
515 Ga0496112_0013854 3300048915 Bacteria 7458
516 Ga0496112_0050772 3300048915 Bacteria 4068
517 Ga0496112_0210761 3300048915 Bacteria 1900
518 Ga0496113_0043930 3300048916 Bacteria 3308
519 Ga0496113_0097718 3300048916 Bacteria 2272
520 Ga0496114_0028451 3300048917 Bacteria 4587
521 Ga0496114_0125338 3300048917 Bacteria 2213
522 Ga0496114_0253439 3300048917 Bacteria 1549
523 Ga0496119_0075499 3300048922 Bacteria 1959
524 Ga0496120_0115835 3300048923 Bacteria 1393
525 Ga0496121_0187624 3300048924 Bacteria 1486
526 Ga0496124_0050366 3300048927 Bacteria 3549
527 Ga0496126_0013801 3300048929 Bacteria 8192
528 Ga0501048_0000199 3300049582 Bacteria 39152
529 Ga0501070_0003977 3300049586 Bacteria 12725
530 Ga0501076_0004362 3300049592 Bacteria 10046
531 nmdc:mga03683_62217_c1 3300050489 Bacteria 1580
532 nmdc:mga0yw44_88751_c1 3300050492 Bacteria 1950
533 nmdc:mga0k408_267726_c1 3300050493 Bacteria 1020
534 nmdc:mga06z11_44796_c1 3300050494 Bacteria 2233
535 nmdc:mga07m45_303793_c1 3300050496 Bacteria 928
536 nmdc:mga08y16_356914_c1 3300050511 Bacteria 1501
537 nmdc:mga0n895_25618_c1 3300050512 Bacteria 5575
538 nmdc:mga0rr50_161443_c1 3300050513 Bacteria 1819
539 nmdc:mga0rr50_485174_c1 3300050513 Bacteria 1050
540 Ga0495619_0072493 3300053085 Bacteria 2307
541 Ga0500616_0002188 3300053153 Bacteria 16853
542 Ga0530510_0076487 3300061734 Bacteria 2432
543 Ga0530510_0150061 3300061734 Bacteria 1721

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10232067 Ga0163163_102320672 244
2 3300005336 Ga0070680_100216987 Ga0070680_1002169872 256
3 3300005337 Ga0070682_100266537 Ga0070682_1002665372 256
4 3300005458 Ga0070681_10000040 Ga0070681_1000004013 256
5 3300005530 Ga0070679_100001695 Ga0070679_10000169513 256
6 3300005535 Ga0070684_100030307 Ga0070684_1000303073 256
7 3300005539 Ga0068853_100014364 Ga0068853_1000143643 256
8 3300005563 Ga0068855_100000096 Ga0068855_10000009655 256
9 3300005564 Ga0070664_100220418 Ga0070664_1002204182 256
10 3300005577 Ga0068857_100054179 Ga0068857_1000541793 256
11 3300005578 Ga0068854_100004868 Ga0068854_1000048682 256
12 3300005614 Ga0068856_100008332 Ga0068856_1000083324 256
13 3300005842 Ga0068858_100023747 Ga0068858_1000237472 256
14 3300006237 Ga0097621_100001314 Ga0097621_10000131411 256
15 3300006358 Ga0068871_100002435 Ga0068871_1000024357 256
16 3300009093 Ga0105240_10000820 Ga0105240_100008209 256
17 3300009174 Ga0105241_10147583 Ga0105241_101475832 256
18 3300009545 Ga0105237_10289705 Ga0105237_102897051 256
19 3300009551 Ga0105238_10000548 Ga0105238_1000054811 256
20 3300013105 Ga0157369_10000041 Ga0157369_1000004172 256
21 3300013296 Ga0157374_10000078 Ga0157374_100000781 256
22 3300013297 Ga0157378_10020009 Ga0157378_100200092 256
23 3300013307 Ga0157372_10000431 Ga0157372_1000043112 256
24 3300013307 Ga0157372_10318689 Ga0157372_103186891 256
25 3300014969 Ga0157376_10125928 Ga0157376_101259282 256
26 3300025911 Ga0207654_10335345 Ga0207654_103353452 256
27 3300025912 Ga0207707_10000194 Ga0207707_1000019427 256
28 3300025913 Ga0207695_10024621 Ga0207695_100246213 256
29 3300025914 Ga0207671_10245967 Ga0207671_102459671 256
30 3300025917 Ga0207660_10186237 Ga0207660_101862372 256
31 3300025921 Ga0207652_10329020 Ga0207652_103290201 256
32 3300025924 Ga0207694_10002301 Ga0207694_100023018 256
33 3300025941 Ga0207711_10309287 Ga0207711_103092872 256
34 3300025945 Ga0207679_10173185 Ga0207679_101731852 256
35 3300025949 Ga0207667_10000821 Ga0207667_1000082118 256
36 3300025981 Ga0207640_10057358 Ga0207640_100573582 256
37 3300026035 Ga0207703_10051158 Ga0207703_100511582 256
38 3300026041 Ga0207639_10023769 Ga0207639_100237693 256
39 3300026078 Ga0207702_10000275 Ga0207702_1000027515 256
40 3300026116 Ga0207674_10038466 Ga0207674_100384663 256
41 3300036401 Ga0373937_0123869 Ga0373937_0123869_21_884 256
42 3300037418 Ga0395900_0015389 Ga0395900_0015389_6731_7600 256
43 3300047317 Ga0495604_0191050 Ga0495604_0191050_547_1410 256
44 3300048908 Ga0496105_0366224 Ga0496105_0366224_30_848 256
45 3300048915 Ga0496112_0050772 Ga0496112_0050772_3053_3871 256
46 3300005439 Ga0070711_100015086 Ga0070711_1000150863 257
47 3300009979 Ga0105032_101960 Ga0105032_1019602 257
48 3300025915 Ga0207693_10004585 Ga0207693_1000458510 257
49 3300035170 Ga0373943_0258554 Ga0373943_0258554_76_882 257
50 3300037068 Ga0373925_0001494 Ga0373925_0001494_4330_5106 257
51 3300048910 Ga0496107_0077743 Ga0496107_0077743_1426_2322 257
52 3300007788 Ga0099795_10023321 Ga0099795_100233212 259
53 3300025898 Ga0207692_10233931 Ga0207692_102339311 259
54 3300025916 Ga0207663_10082853 Ga0207663_100828531 259
55 3300031548 Ga0307408_100122032 Ga0307408_1001220322 259
56 3300031903 Ga0307407_10012672 Ga0307407_100126722 259
57 3300009036 Ga0105244_10137302 Ga0105244_101373022 260
58 3300009094 Ga0111539_10755047 Ga0111539_107550471 260
59 3300013306 Ga0163162_10302070 Ga0163162_103020702 260
60 3300013308 Ga0157375_10026976 Ga0157375_100269763 260
61 3300046472 Ga0495580_0002429 Ga0495580_0002429_5650_6477 260
62 3300046472 Ga0495580_0013063 Ga0495580_0013063_4065_4880 260
63 3300048903 Ga0496100_0020193 Ga0496100_0020193_2939_3769 260
64 3300048904 Ga0496101_0046163 Ga0496101_0046163_2078_2908 260
65 3300048905 Ga0496102_0007102 Ga0496102_0007102_5813_6643 260
66 3300048906 Ga0496103_0002175 Ga0496103_0002175_9819_10649 260
67 3300048909 Ga0496106_0003494 Ga0496106_0003494_7103_7933 260
68 3300048914 Ga0496111_0014633 Ga0496111_0014633_3440_4270 260
69 3300048917 Ga0496114_0028451 Ga0496114_0028451_1694_2524 260
70 3300006173 Ga0070716_100113702 Ga0070716_1001137022 261
71 3300025910 Ga0207684_10285922 Ga0207684_102859221 261
72 3300050493 nmdc:mga0k408_267726_c1 nmdc:mga0k408_267726_c1_61_867 261
73 iso_pu_bacteria 2524023210 2524463781 261
74 3300009094 Ga0111539_10897954 Ga0111539_108979542 262
75 3300014326 Ga0157380_10627594 Ga0157380_106275942 262
76 3300049582 Ga0501048_0000199 Ga0501048_0000199_31334_32140 262
77 iso_pu_bacteria 2524023228 2524535346 262
78 iso_pu_bacteria 2904690495 2904698582 262
79 iso_pu_bacteria 2908739725 2908741104 262
80 iso_pu_bacteria 2908756301 2908762408 262
81 3300005337 Ga0070682_100059855 Ga0070682_1000598553 263
82 3300005614 Ga0068856_100004750 Ga0068856_10000475012 263
83 3300006038 Ga0075365_10022846 Ga0075365_100228464 263
84 3300006178 Ga0075367_10108288 Ga0075367_101082882 263
85 3300013105 Ga0157369_10168208 Ga0157369_101682084 263
86 3300013307 Ga0157372_10008205 Ga0157372_100082052 263
87 3300025942 Ga0207689_10272965 Ga0207689_102729651 263
88 3300050489 nmdc:mga03683_62217_c1 nmdc:mga03683_62217_c1_335_1126 263
89 3300050492 nmdc:mga0yw44_88751_c1 nmdc:mga0yw44_88751_c1_782_1573 263
90 3300050494 nmdc:mga06z11_44796_c1 nmdc:mga06z11_44796_c1_607_1398 263
91 3300050496 nmdc:mga07m45_303793_c1 nmdc:mga07m45_303793_c1_26_817 263
92 iso_pu_bacteria 2513237082 2513552587 263
93 iso_pu_bacteria 2513237083 2513560672 263
94 3300005434 Ga0070709_10033821 Ga0070709_100338212 264
95 3300005435 Ga0070714_100099511 Ga0070714_1000995112 264
96 3300005436 Ga0070713_100107789 Ga0070713_1001077893 264
97 3300005437 Ga0070710_10001617 Ga0070710_100016171 264
98 3300005439 Ga0070711_100025501 Ga0070711_1000255012 264
99 3300006028 Ga0070717_10055780 Ga0070717_100557802 264
100 3300009093 Ga0105240_10070607 Ga0105240_100706074 264
101 3300025898 Ga0207692_10075187 Ga0207692_100751872 264
102 3300025906 Ga0207699_10072613 Ga0207699_100726132 264
103 3300025913 Ga0207695_10166608 Ga0207695_101666082 264
104 3300025915 Ga0207693_10250572 Ga0207693_102505722 264
105 3300025928 Ga0207700_10025316 Ga0207700_100253163 264
106 3300025939 Ga0207665_10001827 Ga0207665_100018276 264
107 3300037312 Ga0395899_0089819 Ga0395899_0089819_961_1905 264
108 3300037418 Ga0395900_0055835 Ga0395900_0055835_1346_2290 264
109 3300038443 Ga0395901_0039977 Ga0395901_0039977_3597_4541 264
110 3300048908 Ga0496105_0336344 Ga0496105_0336344_296_1108 264
111 3300005437 Ga0070710_10304258 Ga0070710_103042581 265
112 3300005439 Ga0070711_100120105 Ga0070711_1001201051 265
113 3300006175 Ga0070712_100011522 Ga0070712_1000115228 265
114 3300025898 Ga0207692_10084588 Ga0207692_100845882 265
115 3300025915 Ga0207693_10005273 Ga0207693_100052733 265
116 3300025916 Ga0207663_10001808 Ga0207663_1000180810 265
117 3300025939 Ga0207665_10080241 Ga0207665_100802411 265
118 3300035695 Ga0373927_0000189 Ga0373927_0000189_24551_25348 265
119 3300037068 Ga0373925_0001487 Ga0373925_0001487_7508_8305 265
120 3300005338 Ga0068868_100127543 Ga0068868_1001275432 266
121 3300005436 Ga0070713_100229766 Ga0070713_1002297661 266
122 3300005437 Ga0070710_10234957 Ga0070710_102349571 266
123 3300005467 Ga0070706_100013807 Ga0070706_1000138075 266
124 3300005617 Ga0068859_100014631 Ga0068859_1000146319 266
125 3300005841 Ga0068863_100082372 Ga0068863_1000823723 266
126 3300005842 Ga0068858_100006190 Ga0068858_1000061907 266
127 3300006028 Ga0070717_10000947 Ga0070717_1000094718 266
128 3300006931 Ga0097620_100014631 Ga0097620_1000146319 266
129 3300025915 Ga0207693_10026242 Ga0207693_100262423 266
130 3300025928 Ga0207700_10506440 Ga0207700_105064401 266
131 3300025939 Ga0207665_10158681 Ga0207665_101586812 266
132 3300026035 Ga0207703_10009168 Ga0207703_100091682 266
133 3300026088 Ga0207641_10014501 Ga0207641_100145014 266
134 3300026088 Ga0207641_10025030 Ga0207641_100250301 266
135 3300031852 Ga0307410_10060147 Ga0307410_100601472 266
136 3300048917 Ga0496114_0253439 Ga0496114_0253439_602_1459 266
137 3300048929 Ga0496126_0013801 Ga0496126_0013801_2746_3546 266
138 3300049586 Ga0501070_0003977 Ga0501070_0003977_9420_10271 266
139 iso_pu_bacteria 2904666416 2904673358 266
140 3300005367 Ga0070667_100270931 Ga0070667_1002709312 267
141 3300005434 Ga0070709_10002775 Ga0070709_100027751 267
142 3300005435 Ga0070714_100004834 Ga0070714_1000048348 267
143 3300005435 Ga0070714_100019717 Ga0070714_1000197171 267
144 3300005435 Ga0070714_100234619 Ga0070714_1002346191 267
145 3300005436 Ga0070713_100000630 Ga0070713_1000006309 267
146 3300005439 Ga0070711_100345360 Ga0070711_1003453601 267
147 3300005539 Ga0068853_100397068 Ga0068853_1003970682 267
148 3300005547 Ga0070693_100233104 Ga0070693_1002331041 267
149 3300005563 Ga0068855_100008121 Ga0068855_1000081217 267
150 3300005577 Ga0068857_100299181 Ga0068857_1002991812 267
151 3300005578 Ga0068854_100020413 Ga0068854_1000204134 267
152 3300005614 Ga0068856_100000756 Ga0068856_1000007563 267
153 3300005618 Ga0068864_100054036 Ga0068864_1000540363 267
154 3300005718 Ga0068866_10188937 Ga0068866_101889372 267
155 3300005841 Ga0068863_100000951 Ga0068863_1000009512 267
156 3300005842 Ga0068858_100006823 Ga0068858_1000068238 267
157 3300005842 Ga0068858_100042971 Ga0068858_1000429714 267
158 3300005981 Ga0081538_10007935 Ga0081538_100079352 267
159 3300006173 Ga0070716_100017097 Ga0070716_1000170972 267
160 3300006173 Ga0070716_100029051 Ga0070716_1000290512 267
161 3300006175 Ga0070712_100005241 Ga0070712_1000052411 267
162 3300006175 Ga0070712_100017619 Ga0070712_1000176191 267
163 3300006237 Ga0097621_100002377 Ga0097621_1000023777 267
164 3300006237 Ga0097621_100006541 Ga0097621_1000065412 267
165 3300006237 Ga0097621_100041120 Ga0097621_1000411203 267
166 3300006237 Ga0097621_100392444 Ga0097621_1003924441 267
167 3300006358 Ga0068871_100000226 Ga0068871_10000022640 267
168 3300006358 Ga0068871_100001612 Ga0068871_10000161210 267
169 3300007076 Ga0075435_100225571 Ga0075435_1002255711 267
170 3300009093 Ga0105240_10105397 Ga0105240_101053974 267
171 3300009094 Ga0111539_10393846 Ga0111539_103938462 267
172 3300009098 Ga0105245_10004827 Ga0105245_100048272 267
173 3300009174 Ga0105241_10585235 Ga0105241_105852351 267
174 3300009177 Ga0105248_10011571 Ga0105248_100115717 267
175 3300009177 Ga0105248_10026078 Ga0105248_100260784 267
176 3300009551 Ga0105238_10121197 Ga0105238_101211973 267
177 3300010375 Ga0105239_10152972 Ga0105239_101529722 267
178 3300013102 Ga0157371_10271057 Ga0157371_102710572 267
179 3300013296 Ga0157374_10004157 Ga0157374_100041574 267
180 3300013296 Ga0157374_10098935 Ga0157374_100989352 267
181 3300013296 Ga0157374_10164640 Ga0157374_101646402 267
182 3300013297 Ga0157378_10002970 Ga0157378_100029704 267
183 3300013297 Ga0157378_10005309 Ga0157378_100053096 267
184 3300013297 Ga0157378_10013891 Ga0157378_100138918 267
185 3300013306 Ga0163162_10008849 Ga0163162_100088497 267
186 3300013306 Ga0163162_10013536 Ga0163162_100135365 267
187 3300013307 Ga0157372_10006059 Ga0157372_100060598 267
188 3300013307 Ga0157372_10146428 Ga0157372_101464282 267
189 3300014968 Ga0157379_10059545 Ga0157379_100595453 267
190 3300014969 Ga0157376_10015161 Ga0157376_100151612 267
191 3300025906 Ga0207699_10040480 Ga0207699_100404801 267
192 3300025913 Ga0207695_10281579 Ga0207695_102815792 267
193 3300025915 Ga0207693_10000286 Ga0207693_1000028616 267
194 3300025915 Ga0207693_10004130 Ga0207693_100041307 267
195 3300025916 Ga0207663_10034220 Ga0207663_100342201 267
196 3300025916 Ga0207663_10271278 Ga0207663_102712781 267
197 3300025922 Ga0207646_10295955 Ga0207646_102959552 267
198 3300025927 Ga0207687_10038307 Ga0207687_100383073 267
199 3300025928 Ga0207700_10006699 Ga0207700_100066993 267
200 3300025928 Ga0207700_10155322 Ga0207700_101553221 267
201 3300025929 Ga0207664_10000770 Ga0207664_1000077021 267
202 3300025929 Ga0207664_10008332 Ga0207664_100083329 267
203 3300025931 Ga0207644_10186048 Ga0207644_101860482 267
204 3300025931 Ga0207644_10237814 Ga0207644_102378142 267
205 3300025938 Ga0207704_10106491 Ga0207704_101064913 267
206 3300025939 Ga0207665_10005832 Ga0207665_100058325 267
207 3300025939 Ga0207665_10053282 Ga0207665_100532823 267
208 3300025939 Ga0207665_10167730 Ga0207665_101677302 267
209 3300025941 Ga0207711_10059275 Ga0207711_100592752 267
210 3300025941 Ga0207711_10450658 Ga0207711_104506582 267
211 3300025945 Ga0207679_10157870 Ga0207679_101578702 267
212 3300025949 Ga0207667_10005864 Ga0207667_100058649 267
213 3300025981 Ga0207640_10131896 Ga0207640_101318962 267
214 3300025986 Ga0207658_10203914 Ga0207658_102039142 267
215 3300026023 Ga0207677_10006776 Ga0207677_100067767 267
216 3300026035 Ga0207703_10008453 Ga0207703_100084538 267
217 3300026035 Ga0207703_10059442 Ga0207703_100594422 267
218 3300026041 Ga0207639_10128502 Ga0207639_101285022 267
219 3300026078 Ga0207702_10004239 Ga0207702_100042393 267
220 3300026088 Ga0207641_10010148 Ga0207641_100101482 267
221 3300026095 Ga0207676_10099084 Ga0207676_100990842 267
222 3300035086 Ga0373934_0054135 Ga0373934_0054135_595_1416 267
223 3300035111 Ga0373923_0016392 Ga0373923_0016392_183_1004 267
224 3300035113 Ga0373936_0028470 Ga0373936_0028470_772_1593 267
225 3300035118 Ga0373954_0057340 Ga0373954_0057340_339_1160 267
226 3300035119 Ga0373956_0012483 Ga0373956_0012483_847_1668 267
227 3300035170 Ga0373943_0094834 Ga0373943_0094834_284_1102 267
228 3300035171 Ga0373946_0022055 Ga0373946_0022055_896_1717 267
229 3300035172 Ga0373955_0281479 Ga0373955_0281479_16_897 267
230 3300035695 Ga0373927_0159532 Ga0373927_0159532_23_844 267
231 3300035724 Ga0373933_0028504 Ga0373933_0028504_853_1674 267
232 3300035725 Ga0373947_0042546 Ga0373947_0042546_961_1782 267
233 3300037068 Ga0373925_0021475 Ga0373925_0021475_2031_2912 267
234 3300037068 Ga0373925_0051715 Ga0373925_0051715_825_1646 267
235 3300046463 Ga0495653_0376667 Ga0495653_0376667_14_835 267
236 3300046472 Ga0495580_0046503 Ga0495580_0046503_756_1559 267
237 3300046511 Ga0495608_0335193 Ga0495608_0335193_100_909 267
238 3300046517 Ga0495630_0556893 Ga0495630_0556893_26_847 267
239 3300046536 Ga0495587_0182710 Ga0495587_0182710_285_1106 267
240 3300048904 Ga0496101_0051121 Ga0496101_0051121_120_1001 267
241 3300048907 Ga0496104_0197901 Ga0496104_0197901_792_1673 267
242 3300050511 nmdc:mga08y16_356914_c1 nmdc:mga08y16_356914_c1_141_950 267
243 3300053085 Ga0495619_0072493 Ga0495619_0072493_796_1677 267
244 3300053153 Ga0500616_0002188 Ga0500616_0002188_12608_13444 267
245 3300005328 Ga0070676_10002705 Ga0070676_100027053 268
246 3300005329 Ga0070683_100021245 Ga0070683_1000212453 268
247 3300005336 Ga0070680_100021494 Ga0070680_1000214943 268
248 3300005337 Ga0070682_100000741 Ga0070682_1000007414 268
249 3300005339 Ga0070660_100185246 Ga0070660_1001852462 268
250 3300005340 Ga0070689_100048959 Ga0070689_1000489591 268
251 3300005344 Ga0070661_100001050 Ga0070661_1000010501 268
252 3300005347 Ga0070668_100065381 Ga0070668_1000653811 268
253 3300005353 Ga0070669_100081382 Ga0070669_1000813823 268
254 3300005356 Ga0070674_100219230 Ga0070674_1002192302 268
255 3300005356 Ga0070674_100307543 Ga0070674_1003075432 268
256 3300005366 Ga0070659_100009584 Ga0070659_1000095843 268
257 3300005367 Ga0070667_100403538 Ga0070667_1004035381 268
258 3300005455 Ga0070663_100000852 Ga0070663_1000008527 268
259 3300005456 Ga0070678_100426560 Ga0070678_1004265601 268
260 3300005457 Ga0070662_100001503 Ga0070662_1000015034 268
261 3300005458 Ga0070681_10086737 Ga0070681_100867373 268
262 3300005459 Ga0068867_100216363 Ga0068867_1002163631 268
263 3300005466 Ga0070685_10047804 Ga0070685_100478042 268
264 3300005467 Ga0070706_100001802 Ga0070706_10000180210 268
265 3300005467 Ga0070706_100006607 Ga0070706_10000660712 268
266 3300005467 Ga0070706_100015247 Ga0070706_1000152472 268
267 3300005468 Ga0070707_100020357 Ga0070707_1000203573 268
268 3300005471 Ga0070698_100040621 Ga0070698_1000406212 268
269 3300005471 Ga0070698_100128413 Ga0070698_1001284132 268
270 3300005518 Ga0070699_100007216 Ga0070699_1000072163 268
271 3300005530 Ga0070679_100075536 Ga0070679_1000755363 268
272 3300005535 Ga0070684_100017328 Ga0070684_1000173284 268
273 3300005536 Ga0070697_100053685 Ga0070697_1000536852 268
274 3300005544 Ga0070686_100004160 Ga0070686_1000041604 268
275 3300005547 Ga0070693_100041185 Ga0070693_1000411853 268
276 3300005548 Ga0070665_100006728 Ga0070665_1000067284 268
277 3300005563 Ga0068855_100019518 Ga0068855_1000195184 268
278 3300005564 Ga0070664_100014281 Ga0070664_1000142816 268
279 3300005578 Ga0068854_100000511 Ga0068854_1000005115 268
280 3300005614 Ga0068856_100005937 Ga0068856_1000059377 268
281 3300005616 Ga0068852_100081927 Ga0068852_1000819272 268
282 3300005617 Ga0068859_100002596 Ga0068859_1000025969 268
283 3300005834 Ga0068851_10002982 Ga0068851_100029824 268
284 3300005842 Ga0068858_100046652 Ga0068858_1000466525 268
285 3300005843 Ga0068860_100021617 Ga0068860_1000216174 268
286 3300005844 Ga0068862_100025568 Ga0068862_1000255683 268
287 3300006028 Ga0070717_10000492 Ga0070717_1000049214 268
288 3300006175 Ga0070712_100120682 Ga0070712_1001206822 268
289 3300006237 Ga0097621_100004753 Ga0097621_1000047535 268
290 3300006237 Ga0097621_100005174 Ga0097621_1000051748 268
291 3300006358 Ga0068871_100025860 Ga0068871_1000258604 268
292 3300006881 Ga0068865_100070967 Ga0068865_1000709671 268
293 3300006931 Ga0097620_100002596 Ga0097620_1000025968 268
294 3300009093 Ga0105240_10002935 Ga0105240_100029359 268
295 3300009098 Ga0105245_10012267 Ga0105245_100122673 268
296 3300009101 Ga0105247_10001142 Ga0105247_100011429 268
297 3300009177 Ga0105248_10004230 Ga0105248_100042307 268
298 3300009545 Ga0105237_10029342 Ga0105237_100293427 268
299 3300009551 Ga0105238_10172436 Ga0105238_101724363 268
300 3300009553 Ga0105249_10016745 Ga0105249_100167453 268
301 3300010375 Ga0105239_10031370 Ga0105239_100313707 268
302 3300010375 Ga0105239_10122614 Ga0105239_101226144 268
303 3300011119 Ga0105246_10016586 Ga0105246_100165862 268
304 3300013105 Ga0157369_10001859 Ga0157369_1000185914 268
305 3300013296 Ga0157374_10004200 Ga0157374_100042008 268
306 3300013297 Ga0157378_10078362 Ga0157378_100783623 268
307 3300013297 Ga0157378_10202937 Ga0157378_102029371 268
308 3300013306 Ga0163162_10024609 Ga0163162_100246095 268
309 3300013307 Ga0157372_10011026 Ga0157372_100110267 268
310 3300013307 Ga0157372_10226307 Ga0157372_102263071 268
311 3300013308 Ga0157375_10003850 Ga0157375_100038505 268
312 3300014325 Ga0163163_10011593 Ga0163163_100115934 268
313 3300014745 Ga0157377_10126241 Ga0157377_101262411 268
314 3300014968 Ga0157379_10158179 Ga0157379_101581791 268
315 3300014968 Ga0157379_10183967 Ga0157379_101839671 268
316 3300014969 Ga0157376_10017042 Ga0157376_100170423 268
317 3300025903 Ga0207680_10003866 Ga0207680_100038664 268
318 3300025907 Ga0207645_10027038 Ga0207645_100270384 268
319 3300025910 Ga0207684_10001829 Ga0207684_100018299 268
320 3300025910 Ga0207684_10026227 Ga0207684_100262273 268
321 3300025911 Ga0207654_10005026 Ga0207654_100050267 268
322 3300025912 Ga0207707_10082632 Ga0207707_100826322 268
323 3300025913 Ga0207695_10014360 Ga0207695_100143603 268
324 3300025915 Ga0207693_10134477 Ga0207693_101344771 268
325 3300025919 Ga0207657_10002061 Ga0207657_1000206117 268
326 3300025922 Ga0207646_10000469 Ga0207646_1000046928 268
327 3300025923 Ga0207681_10070861 Ga0207681_100708612 268
328 3300025924 Ga0207694_10016132 Ga0207694_100161324 268
329 3300025927 Ga0207687_10000114 Ga0207687_100001148 268
330 3300025929 Ga0207664_10242042 Ga0207664_102420421 268
331 3300025933 Ga0207706_10000142 Ga0207706_1000014211 268
332 3300025935 Ga0207709_10029484 Ga0207709_100294843 268
333 3300025936 Ga0207670_10035026 Ga0207670_100350263 268
334 3300025941 Ga0207711_10005720 Ga0207711_100057204 268
335 3300025942 Ga0207689_10068787 Ga0207689_100687872 268
336 3300025945 Ga0207679_10031660 Ga0207679_100316601 268
337 3300025949 Ga0207667_10002541 Ga0207667_100025414 268
338 3300025961 Ga0207712_10006834 Ga0207712_100068343 268
339 3300025972 Ga0207668_10011986 Ga0207668_100119863 268
340 3300025981 Ga0207640_10005281 Ga0207640_100052813 268
341 3300025986 Ga0207658_10048610 Ga0207658_100486102 268
342 3300026023 Ga0207677_10002896 Ga0207677_100028963 268
343 3300026035 Ga0207703_10017852 Ga0207703_100178527 268
344 3300026041 Ga0207639_10040460 Ga0207639_100404603 268
345 3300026067 Ga0207678_10000039 Ga0207678_1000003910 268
346 3300026078 Ga0207702_10007064 Ga0207702_100070643 268
347 3300026116 Ga0207674_10004700 Ga0207674_100047006 268
348 3300026121 Ga0207683_10068440 Ga0207683_100684403 268
349 3300026142 Ga0207698_10015206 Ga0207698_100152061 268
350 3300028379 Ga0268266_10005246 Ga0268266_100052467 268
351 3300028380 Ga0268265_10326946 Ga0268265_103269461 268
352 3300028381 Ga0268264_10035895 Ga0268264_100358953 268
353 3300034818 Ga0373950_0039980 Ga0373950_0039980_11_832 268
354 3300035092 Ga0373952_0008724 Ga0373952_0008724_132_953 268
355 3300035115 Ga0373941_0073799 Ga0373941_0073799_239_1060 268
356 3300035691 Ga0373931_0031651 Ga0373931_0031651_747_1568 268
357 3300041452 Ga0451793_0709325 Ga0451793_0709325_620_1507 268
358 3300041512 Ga0451853_2281844 Ga0451853_2281844_467_1354 268
359 3300048911 Ga0496108_0042824 Ga0496108_0042824_1689_2543 268
360 3300048912 Ga0496109_0401426 Ga0496109_0401426_119_940 268
361 3300048915 Ga0496112_0013854 Ga0496112_0013854_4070_4951 268
362 3300048915 Ga0496112_0210761 Ga0496112_0210761_1056_1877 268
363 3300048916 Ga0496113_0097718 Ga0496113_0097718_1279_2133 268
364 3300061734 Ga0530510_0150061 Ga0530510_0150061_823_1629 268
365 3300005328 Ga0070676_10000101 Ga0070676_1000010123 269
366 3300005328 Ga0070676_10007846 Ga0070676_100078465 269
367 3300005331 Ga0070670_100034394 Ga0070670_1000343942 269
368 3300005333 Ga0070677_10004536 Ga0070677_100045364 269
369 3300005333 Ga0070677_10011959 Ga0070677_100119592 269
370 3300005334 Ga0068869_100019436 Ga0068869_1000194363 269
371 3300005335 Ga0070666_10009585 Ga0070666_100095855 269
372 3300005335 Ga0070666_10019223 Ga0070666_100192233 269
373 3300005343 Ga0070687_100006552 Ga0070687_1000065523 269
374 3300005347 Ga0070668_100003368 Ga0070668_1000033686 269
375 3300005353 Ga0070669_100000736 Ga0070669_10000073613 269
376 3300005353 Ga0070669_100017301 Ga0070669_1000173013 269
377 3300005354 Ga0070675_100007885 Ga0070675_1000078856 269
378 3300005354 Ga0070675_100010135 Ga0070675_1000101354 269
379 3300005364 Ga0070673_100009134 Ga0070673_1000091344 269
380 3300005367 Ga0070667_100000911 Ga0070667_10000091122 269
381 3300005434 Ga0070709_10081930 Ga0070709_100819302 269
382 3300005435 Ga0070714_100303333 Ga0070714_1003033332 269
383 3300005436 Ga0070713_100094526 Ga0070713_1000945262 269
384 3300005437 Ga0070710_10023188 Ga0070710_100231882 269
385 3300005439 Ga0070711_100191440 Ga0070711_1001914402 269
386 3300005456 Ga0070678_100005813 Ga0070678_1000058135 269
387 3300005457 Ga0070662_100013482 Ga0070662_1000134822 269
388 3300005459 Ga0068867_100018950 Ga0068867_1000189504 269
389 3300005543 Ga0070672_100000298 Ga0070672_10000029821 269
390 3300005543 Ga0070672_100027102 Ga0070672_1000271024 269
391 3300005543 Ga0070672_100283433 Ga0070672_1002834332 269
392 3300005544 Ga0070686_100030995 Ga0070686_1000309952 269
393 3300005546 Ga0070696_100183355 Ga0070696_1001833552 269
394 3300005564 Ga0070664_100097401 Ga0070664_1000974013 269
395 3300005616 Ga0068852_100009195 Ga0068852_1000091956 269
396 3300005616 Ga0068852_100678119 Ga0068852_1006781191 269
397 3300005617 Ga0068859_100007474 Ga0068859_1000074746 269
398 3300005618 Ga0068864_100006459 Ga0068864_1000064597 269
399 3300005718 Ga0068866_10002832 Ga0068866_100028324 269
400 3300005841 Ga0068863_100000830 Ga0068863_1000008306 269
401 3300005842 Ga0068858_100001155 Ga0068858_10000115522 269
402 3300005843 Ga0068860_100000796 Ga0068860_10000079612 269
403 3300006163 Ga0070715_10005882 Ga0070715_100058822 269
404 3300006173 Ga0070716_100060060 Ga0070716_1000600603 269
405 3300006175 Ga0070712_100413186 Ga0070712_1004131861 269
406 3300006881 Ga0068865_100032599 Ga0068865_1000325992 269
407 3300006931 Ga0097620_100007475 Ga0097620_1000074756 269
408 3300007076 Ga0075435_100118279 Ga0075435_1001182794 269
409 3300009011 Ga0105251_10089360 Ga0105251_100893602 269
410 3300009101 Ga0105247_10204729 Ga0105247_102047291 269
411 3300009147 Ga0114129_10901665 Ga0114129_109016651 269
412 3300009148 Ga0105243_10005098 Ga0105243_100050984 269
413 3300009148 Ga0105243_10186796 Ga0105243_101867961 269
414 3300009174 Ga0105241_10022224 Ga0105241_100222245 269
415 3300009177 Ga0105248_10073281 Ga0105248_100732812 269
416 3300009545 Ga0105237_10538786 Ga0105237_105387861 269
417 3300011119 Ga0105246_10103764 Ga0105246_101037642 269
418 3300013102 Ga0157371_10289852 Ga0157371_102898521 269
419 3300013306 Ga0163162_10009457 Ga0163162_100094576 269
420 3300013306 Ga0163162_10115293 Ga0163162_101152932 269
421 3300013308 Ga0157375_10001027 Ga0157375_1000102715 269
422 3300014326 Ga0157380_10000360 Ga0157380_100003603 269
423 3300014968 Ga0157379_10004258 Ga0157379_100042586 269
424 3300017792 Ga0163161_10011240 Ga0163161_100112404 269
425 3300025315 Ga0207697_10000796 Ga0207697_100007963 269
426 3300025321 Ga0207656_10138913 Ga0207656_101389132 269
427 3300025728 Ga0207655_1003545 Ga0207655_10035452 269
428 3300025735 Ga0207713_1076030 Ga0207713_10760302 269
429 3300025903 Ga0207680_10025629 Ga0207680_100256293 269
430 3300025903 Ga0207680_10059983 Ga0207680_100599832 269
431 3300025906 Ga0207699_10042899 Ga0207699_100428992 269
432 3300025907 Ga0207645_10002303 Ga0207645_100023038 269
433 3300025907 Ga0207645_10005194 Ga0207645_100051942 269
434 3300025916 Ga0207663_10034135 Ga0207663_100341352 269
435 3300025918 Ga0207662_10009401 Ga0207662_100094013 269
436 3300025920 Ga0207649_10052895 Ga0207649_100528952 269
437 3300025923 Ga0207681_10000592 Ga0207681_1000059220 269
438 3300025923 Ga0207681_10045669 Ga0207681_100456691 269
439 3300025925 Ga0207650_10023555 Ga0207650_100235552 269
440 3300025926 Ga0207659_10011409 Ga0207659_100114093 269
441 3300025926 Ga0207659_10013840 Ga0207659_100138404 269
442 3300025927 Ga0207687_10465816 Ga0207687_104658161 269
443 3300025928 Ga0207700_10009057 Ga0207700_100090575 269
444 3300025929 Ga0207664_10108670 Ga0207664_101086702 269
445 3300025931 Ga0207644_10042148 Ga0207644_100421483 269
446 3300025933 Ga0207706_10002518 Ga0207706_100025186 269
447 3300025935 Ga0207709_10031995 Ga0207709_100319953 269
448 3300025937 Ga0207669_10001832 Ga0207669_100018328 269
449 3300025937 Ga0207669_10100828 Ga0207669_101008282 269
450 3300025939 Ga0207665_10028515 Ga0207665_100285154 269
451 3300025940 Ga0207691_10029438 Ga0207691_100294382 269
452 3300025940 Ga0207691_10118401 Ga0207691_101184013 269
453 3300025942 Ga0207689_10006195 Ga0207689_1000619510 269
454 3300025961 Ga0207712_10066351 Ga0207712_100663513 269
455 3300025972 Ga0207668_10004797 Ga0207668_100047976 269
456 3300025986 Ga0207658_10000510 Ga0207658_1000051016 269
457 3300026035 Ga0207703_10001422 Ga0207703_100014226 269
458 3300026035 Ga0207703_10069427 Ga0207703_100694271 269
459 3300026067 Ga0207678_10083605 Ga0207678_100836053 269
460 3300026088 Ga0207641_10001218 Ga0207641_1000121819 269
461 3300026089 Ga0207648_10001492 Ga0207648_100014927 269
462 3300026095 Ga0207676_10008441 Ga0207676_100084413 269
463 3300026118 Ga0207675_100001773 Ga0207675_1000017736 269
464 3300026121 Ga0207683_10002047 Ga0207683_100020473 269
465 3300026121 Ga0207683_10149833 Ga0207683_101498331 269
466 3300026142 Ga0207698_10009126 Ga0207698_100091263 269
467 3300028381 Ga0268264_10007395 Ga0268264_100073956 269
468 3300035691 Ga0373931_0088260 Ga0373931_0088260_813_1643 269
469 3300035691 Ga0373931_0172313 Ga0373931_0172313_151_981 269
470 3300046528 Ga0495642_0055879 Ga0495642_0055879_17_850 269
471 3300046558 Ga0495633_0015766 Ga0495633_0015766_1149_1982 269
472 3300046615 Ga0495656_0002009 Ga0495656_0002009_1466_2299 269
473 3300046664 Ga0495659_0002916 Ga0495659_0002916_2751_3584 269
474 3300046674 Ga0495588_0011026 Ga0495588_0011026_2236_3069 269
475 3300046691 Ga0495670_0009420 Ga0495670_0009420_971_1804 269
476 3300047445 Ga0495677_0038306 Ga0495677_0038306_202_1035 269
477 3300047470 Ga0495681_0015145 Ga0495681_0015145_1088_1921 269
478 3300048903 Ga0496100_0119500 Ga0496100_0119500_772_1605 269
479 3300048904 Ga0496101_0248263 Ga0496101_0248263_89_919 269
480 3300048905 Ga0496102_0042318 Ga0496102_0042318_2056_2889 269
481 3300048906 Ga0496103_0080158 Ga0496103_0080158_264_1097 269
482 3300048907 Ga0496104_0057955 Ga0496104_0057955_830_1663 269
483 3300048908 Ga0496105_0317434 Ga0496105_0317434_52_885 269
484 3300048909 Ga0496106_0034415 Ga0496106_0034415_921_1751 269
485 3300048909 Ga0496106_0054971 Ga0496106_0054971_760_1593 269
486 3300048910 Ga0496107_0076556 Ga0496107_0076556_239_1072 269
487 3300048910 Ga0496107_0109882 Ga0496107_0109882_761_1594 269
488 3300048911 Ga0496108_0035265 Ga0496108_0035265_592_1425 269
489 3300048912 Ga0496109_0071270 Ga0496109_0071270_948_1781 269
490 3300048912 Ga0496109_0206589 Ga0496109_0206589_899_1732 269
491 3300048913 Ga0496110_0008685 Ga0496110_0008685_5782_6615 269
492 3300048913 Ga0496110_0059359 Ga0496110_0059359_2081_2896 269
493 3300048913 Ga0496110_0158447 Ga0496110_0158447_592_1425 269
494 3300048914 Ga0496111_0140352 Ga0496111_0140352_913_1746 269
495 3300048916 Ga0496113_0043930 Ga0496113_0043930_1237_2070 269
496 3300048917 Ga0496114_0125338 Ga0496114_0125338_592_1425 269
497 3300048922 Ga0496119_0075499 Ga0496119_0075499_590_1423 269
498 3300048923 Ga0496120_0115835 Ga0496120_0115835_462_1295 269
499 3300048924 Ga0496121_0187624 Ga0496121_0187624_500_1333 269
500 3300048927 Ga0496124_0050366 Ga0496124_0050366_441_1274 269
501 3300050512 nmdc:mga0n895_25618_c1 nmdc:mga0n895_25618_c1_2048_2977 269
502 3300050513 nmdc:mga0rr50_161443_c1 nmdc:mga0rr50_161443_c1_346_1275 269
503 3300050513 nmdc:mga0rr50_485174_c1 nmdc:mga0rr50_485174_c1_107_916 269
504 3300005330 Ga0070690_100000316 Ga0070690_1000003162 270
505 3300005340 Ga0070689_100003624 Ga0070689_1000036242 270
506 3300005344 Ga0070661_100090642 Ga0070661_1000906423 270
507 3300005365 Ga0070688_100000908 Ga0070688_10000090810 270
508 3300005366 Ga0070659_100282996 Ga0070659_1002829962 270
509 3300005436 Ga0070713_100183380 Ga0070713_1001833802 270
510 3300005441 Ga0070700_100000459 Ga0070700_10000045916 270
511 3300005459 Ga0068867_100048593 Ga0068867_1000485932 270
512 3300005466 Ga0070685_10087251 Ga0070685_100872511 270
513 3300005544 Ga0070686_100000989 Ga0070686_10000098912 270
514 3300005545 Ga0070695_100140845 Ga0070695_1001408452 270
515 3300005578 Ga0068854_100117557 Ga0068854_1001175572 270
516 3300005617 Ga0068859_100005789 Ga0068859_1000057895 270
517 3300006931 Ga0097620_100005789 Ga0097620_1000057895 270
518 3300009177 Ga0105248_10003754 Ga0105248_1000375411 270
519 3300014326 Ga0157380_10179907 Ga0157380_101799071 270
520 3300025934 Ga0207686_10092439 Ga0207686_100924392 270
521 3300025936 Ga0207670_10000059 Ga0207670_1000005956 270
522 3300025941 Ga0207711_10013309 Ga0207711_100133093 270
523 3300025981 Ga0207640_10472374 Ga0207640_104723741 270
524 3300026075 Ga0207708_10000274 Ga0207708_1000027417 270
525 3300026089 Ga0207648_10007986 Ga0207648_100079866 270
526 3300031090 Ga0265760_10091153 Ga0265760_100911532 270
527 3300005366 Ga0070659_100131413 Ga0070659_1001314132 271
528 3300005563 Ga0068855_100625717 Ga0068855_1006257171 271
529 3300005564 Ga0070664_100001668 Ga0070664_1000016686 271
530 3300005614 Ga0068856_100022293 Ga0068856_1000222934 271
531 3300006237 Ga0097621_100185761 Ga0097621_1001857612 271
532 3300009177 Ga0105248_10298890 Ga0105248_102988901 271
533 3300009551 Ga0105238_10024369 Ga0105238_100243692 271
534 3300010375 Ga0105239_10037990 Ga0105239_100379904 271
535 3300013100 Ga0157373_10033694 Ga0157373_100336944 271
536 3300013105 Ga0157369_10054472 Ga0157369_100544722 271
537 3300013307 Ga0157372_10267779 Ga0157372_102677792 271
538 3300014497 Ga0182008_10025824 Ga0182008_100258242 271
539 3300014968 Ga0157379_10005735 Ga0157379_100057354 271
540 3300025911 Ga0207654_10041014 Ga0207654_100410141 271
541 3300025932 Ga0207690_10120148 Ga0207690_101201482 271
542 3300025945 Ga0207679_10010543 Ga0207679_100105435 271
543 3300025949 Ga0207667_10041670 Ga0207667_100416701 271
544 3300026078 Ga0207702_10142268 Ga0207702_101422682 271
545 3300026142 Ga0207698_10032781 Ga0207698_100327815 271
546 3300048905 Ga0496102_0000322 Ga0496102_0000322_21403_22365 271
547 3300048907 Ga0496104_0079288 Ga0496104_0079288_1671_2633 271
548 3300049592 Ga0501076_0004362 Ga0501076_0004362_7307_8251 271
549 3300061734 Ga0530510_0076487 Ga0530510_0076487_208_1152 271
550 3300003659 JGI25404J52841_10019971 JGI25404J52841_100199712 273
551 3300005983 Ga0081540_1000086 Ga0081540_100008646 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03976

PPK2

Polyphosphate kinase 2 (PPK2)

65

293

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5llf-assembly2.cif.gz_C structure of polyphosphate kinase 2 mutant d117n from francisella tularensis with polyphosphate 0.9821 15 241
5llb-assembly1.cif.gz_C structure of polyphosphate kinase 2 from francisella tularensis with amppch2ppp and polyphosphate 0.9772 17 242
3czq-assembly1.cif.gz_D crystal structure of putative polyphosphate kinase 2 from sinorhizobium meliloti 0.9753 15 242
4yeg-assembly2.cif.gz_D characterisation of polyphosphate kinase 2 from the intracellular pathogen francisella tularensis 0.9589 14 241
4yeg-assembly1.cif.gz_A characterisation of polyphosphate kinase 2 from the intracellular pathogen francisella tularensis 0.9467 14 242
ID Description Score Start End Superfamily
3czqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9674 15 239 3.40.50.300
4yegC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.938 14 242 3.40.50.300
3czpB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9118 10 234 3.40.50.300
6angA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9055 9 235 3.40.50.300
3czpB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8995 17 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5C7K9I6-F1-model_v4 deleted 0.9964 17 135
AF-A0A7V8G0E4-F1-model_v4 Polyphosphate:ADP phosphotransferase 0.9957 19 162 GO:0016740
AF-A0A526RPP4-F1-model_v4 ADP/GDP-polyphosphate phosphotransferase (EC 2.7.4.-) (Polyphosphate kinase PPK2) 0.9943 15 231 GO:0006754
GO:0008976
AF-A0A7C3CXH0-F1-model_v4 ADP/GDP-polyphosphate phosphotransferase (EC 2.7.4.-) (Polyphosphate kinase PPK2) 0.993 16 243 GO:0006793
GO:0008976
AF-A0A530QIR0-F1-model_v4 Polyphosphate kinase 2 0.9927 78 207 GO:0006754
GO:0016301

Feature Viewer

pLDDT pTM Quality
91.32 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map