F462675
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 551 | 314 | 546 | 116 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2515154202|2516086278 |
| Length | 127 |
| Sequence | GYALDEPGRLDATFAALADPTRRAILARLAQGDATVKEIAAPFPVSQPAISRHLKVLEGAGLISRGRVAQRRPCHLEGRQLRLVVDWLENYRGYWAEAFGRLDELLDELQAGDDVRQSSGGREGHGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 2 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 3 | 2524614857 | Deinococcus ficus DSM 19119 | Isolate | Rhizosphere |
| 4 | 2739367875 | Deinococcus ficus CC-FR2-10 | Isolate | Unclassified |
| 5 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 6 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 188 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 213 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 214 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 215 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 216 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 217 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 220 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 285 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 292 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 293 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 308 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 309 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 310 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 311 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 314 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.09 |
| Metatranscriptomes | 0 |
| Isolates | 0.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.72 |
| Nodule | 0 |
| Rhizoplane | 2.9 |
| Rhizosphere | 93.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10012745 | 3300003373 | Bacteria | 2155 |
| 2 | JGI25405J52794_10091079 | 3300003911 | Bacteria | 675 |
| 3 | Ga0065704_10426355 | 3300005289 | Bacteria | 727 |
| 4 | Ga0065707_10040831 | 3300005295 | Bacteria | 1026 |
| 5 | Ga0070658_11265579 | 3300005327 | Bacteria | 641 |
| 6 | Ga0070683_100001731 | 3300005329 | Bacteria | 16985 |
| 7 | Ga0070683_100010807 | 3300005329 | Bacteria | 7856 |
| 8 | Ga0070683_100043908 | 3300005329 | Bacteria | 4120 |
| 9 | Ga0070683_100056699 | 3300005329 | Bacteria | 3638 |
| 10 | Ga0070683_100196858 | 3300005329 | Bacteria | 1914 |
| 11 | Ga0070690_100314310 | 3300005330 | Bacteria | 1127 |
| 12 | Ga0070677_10198919 | 3300005333 | Bacteria | 966 |
| 13 | Ga0068869_100206381 | 3300005334 | Bacteria | 1552 |
| 14 | Ga0068869_100369276 | 3300005334 | Unclassified | 1174 |
| 15 | Ga0070680_100032107 | 3300005336 | Bacteria | 4224 |
| 16 | Ga0070680_100053923 | 3300005336 | Bacteria | 3282 |
| 17 | Ga0070680_100370845 | 3300005336 | Bacteria | 1218 |
| 18 | Ga0070682_100411639 | 3300005337 | Bacteria | 1025 |
| 19 | Ga0070682_100614535 | 3300005337 | Bacteria | 860 |
| 20 | Ga0070660_101381420 | 3300005339 | Bacteria | 598 |
| 21 | Ga0070660_101794878 | 3300005339 | Bacteria | 522 |
| 22 | Ga0070660_101878942 | 3300005339 | Bacteria | 510 |
| 23 | Ga0070687_100647769 | 3300005343 | Bacteria | 732 |
| 24 | Ga0070661_100231271 | 3300005344 | Bacteria | 1421 |
| 25 | Ga0070692_10424222 | 3300005345 | Bacteria | 845 |
| 26 | Ga0070668_100531040 | 3300005347 | Bacteria | 1022 |
| 27 | Ga0070669_101007972 | 3300005353 | Bacteria | 715 |
| 28 | Ga0070675_100101865 | 3300005354 | Unclassified | 2419 |
| 29 | Ga0070675_100222423 | 3300005354 | Bacteria | 1644 |
| 30 | Ga0070675_100509761 | 3300005354 | Bacteria | 1085 |
| 31 | Ga0070675_100919685 | 3300005354 | Bacteria | 802 |
| 32 | Ga0070671_100453224 | 3300005355 | Bacteria | 1101 |
| 33 | Ga0070674_100266151 | 3300005356 | Bacteria | 1353 |
| 34 | Ga0070674_100649593 | 3300005356 | Bacteria | 896 |
| 35 | Ga0070673_100271857 | 3300005364 | Bacteria | 1484 |
| 36 | Ga0070673_101947879 | 3300005364 | Bacteria | 557 |
| 37 | Ga0070688_100022487 | 3300005365 | Bacteria | 3696 |
| 38 | Ga0070688_100341239 | 3300005365 | Bacteria | 1094 |
| 39 | Ga0070659_100366053 | 3300005366 | Bacteria | 1212 |
| 40 | Ga0070667_100037627 | 3300005367 | Bacteria | 4057 |
| 41 | Ga0070709_11012827 | 3300005434 | Bacteria | 661 |
| 42 | Ga0070714_100027701 | 3300005435 | Bacteria | 4695 |
| 43 | Ga0070714_100090540 | 3300005435 | Bacteria | 2679 |
| 44 | Ga0070714_101215031 | 3300005435 | Bacteria | 735 |
| 45 | Ga0070713_100000219 | 3300005436 | Bacteria | 38014 |
| 46 | Ga0070713_100020793 | 3300005436 | Bacteria | 5038 |
| 47 | Ga0070713_100028455 | 3300005436 | Bacteria | 4413 |
| 48 | Ga0070713_100210306 | 3300005436 | Bacteria | 1761 |
| 49 | Ga0070713_100753388 | 3300005436 | Unclassified | 932 |
| 50 | Ga0070710_10387228 | 3300005437 | Unclassified | 934 |
| 51 | Ga0070701_10165316 | 3300005438 | Unclassified | 1285 |
| 52 | Ga0070701_10473183 | 3300005438 | Bacteria | 808 |
| 53 | Ga0070711_100031442 | 3300005439 | Bacteria | 3524 |
| 54 | Ga0070711_100385699 | 3300005439 | Unclassified | 1134 |
| 55 | Ga0070711_100494924 | 3300005439 | Unclassified | 1007 |
| 56 | Ga0070705_100018221 | 3300005440 | Bacteria | 3677 |
| 57 | Ga0070705_100062181 | 3300005440 | Bacteria | 2222 |
| 58 | Ga0070700_100361694 | 3300005441 | Bacteria | 1079 |
| 59 | Ga0070700_100813023 | 3300005441 | Bacteria | 754 |
| 60 | Ga0070694_100189979 | 3300005444 | Bacteria | 1525 |
| 61 | Ga0070663_100584190 | 3300005455 | Bacteria | 938 |
| 62 | Ga0070663_101429024 | 3300005455 | Bacteria | 613 |
| 63 | Ga0070678_100001493 | 3300005456 | Bacteria | 12499 |
| 64 | Ga0070678_100832474 | 3300005456 | Bacteria | 840 |
| 65 | Ga0070662_101129824 | 3300005457 | Bacteria | 673 |
| 66 | Ga0070662_101180322 | 3300005457 | Bacteria | 658 |
| 67 | Ga0070681_10002467 | 3300005458 | Bacteria | 16942 |
| 68 | Ga0070681_10117873 | 3300005458 | Bacteria | 2591 |
| 69 | Ga0068867_100236054 | 3300005459 | Bacteria | 1480 |
| 70 | Ga0068867_100284606 | 3300005459 | Bacteria | 1357 |
| 71 | Ga0070685_10089724 | 3300005466 | Unclassified | 1858 |
| 72 | Ga0070685_10206539 | 3300005466 | Unclassified | 1280 |
| 73 | Ga0070685_10225086 | 3300005466 | Unclassified | 1231 |
| 74 | Ga0070685_10766245 | 3300005466 | Bacteria | 709 |
| 75 | Ga0070706_100095094 | 3300005467 | Bacteria | 2765 |
| 76 | Ga0070706_100963564 | 3300005467 | Bacteria | 787 |
| 77 | Ga0070706_101868879 | 3300005467 | Unclassified | 545 |
| 78 | Ga0070707_100870743 | 3300005468 | Bacteria | 865 |
| 79 | Ga0070698_100578560 | 3300005471 | Bacteria | 1063 |
| 80 | Ga0070699_100234079 | 3300005518 | Unclassified | 1638 |
| 81 | Ga0070699_101318179 | 3300005518 | Bacteria | 662 |
| 82 | Ga0070679_100001208 | 3300005530 | Bacteria | 22740 |
| 83 | Ga0070679_100066217 | 3300005530 | Bacteria | 3601 |
| 84 | Ga0070679_100391964 | 3300005530 | Bacteria | 1335 |
| 85 | Ga0070684_100045914 | 3300005535 | Bacteria | 3784 |
| 86 | Ga0070684_100173863 | 3300005535 | Bacteria | 1957 |
| 87 | Ga0070684_100182336 | 3300005535 | Bacteria | 1909 |
| 88 | Ga0070684_100323835 | 3300005535 | Bacteria | 1416 |
| 89 | Ga0070684_100403570 | 3300005535 | Unclassified | 1260 |
| 90 | Ga0070684_100591267 | 3300005535 | Bacteria | 1031 |
| 91 | Ga0070684_100592299 | 3300005535 | Bacteria | 1031 |
| 92 | Ga0070684_100650492 | 3300005535 | Bacteria | 981 |
| 93 | Ga0070697_100703215 | 3300005536 | Unclassified | 892 |
| 94 | Ga0070672_100407074 | 3300005543 | Bacteria | 1167 |
| 95 | Ga0070672_100908339 | 3300005543 | Bacteria | 778 |
| 96 | Ga0070686_100242369 | 3300005544 | Bacteria | 1313 |
| 97 | Ga0070686_100478108 | 3300005544 | Bacteria | 963 |
| 98 | Ga0070695_100821930 | 3300005545 | Bacteria | 746 |
| 99 | Ga0070696_100648892 | 3300005546 | Bacteria | 855 |
| 100 | Ga0070693_100010836 | 3300005547 | Bacteria | 4576 |
| 101 | Ga0070693_100233386 | 3300005547 | Bacteria | 1212 |
| 102 | Ga0070693_100464661 | 3300005547 | Bacteria | 891 |
| 103 | Ga0070665_100446443 | 3300005548 | Bacteria | 1303 |
| 104 | Ga0070704_100057156 | 3300005549 | Bacteria | 2773 |
| 105 | Ga0070704_100119118 | 3300005549 | Bacteria | 2024 |
| 106 | Ga0070704_100172980 | 3300005549 | Bacteria | 1719 |
| 107 | Ga0070704_100590488 | 3300005549 | Bacteria | 975 |
| 108 | Ga0068855_100131564 | 3300005563 | Bacteria | 2857 |
| 109 | Ga0068855_100435511 | 3300005563 | Bacteria | 1432 |
| 110 | Ga0068855_102132200 | 3300005563 | Bacteria | 564 |
| 111 | Ga0068855_102302015 | 3300005563 | Bacteria | 539 |
| 112 | Ga0070664_100129718 | 3300005564 | Bacteria | 2214 |
| 113 | Ga0070664_100257045 | 3300005564 | Bacteria | 1571 |
| 114 | Ga0070664_100423729 | 3300005564 | Bacteria | 1219 |
| 115 | Ga0070664_101056004 | 3300005564 | Bacteria | 764 |
| 116 | Ga0070664_101187397 | 3300005564 | Unclassified | 720 |
| 117 | Ga0070664_101228521 | 3300005564 | Bacteria | 707 |
| 118 | Ga0068857_100076372 | 3300005577 | Bacteria | 2987 |
| 119 | Ga0068854_100822179 | 3300005578 | Bacteria | 811 |
| 120 | Ga0068856_100106706 | 3300005614 | Bacteria | 2796 |
| 121 | Ga0068856_100223689 | 3300005614 | Bacteria | 1897 |
| 122 | Ga0070702_100000533 | 3300005615 | Bacteria | 13731 |
| 123 | Ga0070702_100704141 | 3300005615 | Bacteria | 770 |
| 124 | Ga0068852_100122754 | 3300005616 | Unclassified | 2381 |
| 125 | Ga0068859_100000004 | 3300005617 | Bacteria | 470249 |
| 126 | Ga0068859_100120967 | 3300005617 | Bacteria | 2684 |
| 127 | Ga0068859_100529217 | 3300005617 | Bacteria | 1273 |
| 128 | Ga0068859_100747940 | 3300005617 | Unclassified | 1067 |
| 129 | Ga0068859_101147802 | 3300005617 | Bacteria | 855 |
| 130 | Ga0068859_101924276 | 3300005617 | Bacteria | 653 |
| 131 | Ga0068864_100437074 | 3300005618 | Bacteria | 1249 |
| 132 | Ga0068864_101220038 | 3300005618 | Bacteria | 751 |
| 133 | Ga0068866_10012152 | 3300005718 | Bacteria | 3748 |
| 134 | Ga0068866_10033981 | 3300005718 | Bacteria | 2480 |
| 135 | Ga0068866_11127837 | 3300005718 | Bacteria | 563 |
| 136 | Ga0068861_101444378 | 3300005719 | Bacteria | 673 |
| 137 | Ga0068870_10835118 | 3300005840 | Bacteria | 646 |
| 138 | Ga0068863_100678653 | 3300005841 | Bacteria | 1023 |
| 139 | Ga0068863_101156751 | 3300005841 | Bacteria | 779 |
| 140 | Ga0068858_100088267 | 3300005842 | Bacteria | 2885 |
| 141 | Ga0068858_100806268 | 3300005842 | Bacteria | 916 |
| 142 | Ga0068860_100073596 | 3300005843 | Bacteria | 3248 |
| 143 | Ga0068862_100026756 | 3300005844 | Bacteria | 4850 |
| 144 | Ga0068862_100270241 | 3300005844 | Bacteria | 1554 |
| 145 | Ga0068862_101927688 | 3300005844 | Bacteria | 601 |
| 146 | Ga0081455_10000045 | 3300005937 | Bacteria | 128603 |
| 147 | Ga0081455_10001225 | 3300005937 | Bacteria | 32099 |
| 148 | Ga0081455_10073987 | 3300005937 | Bacteria | 2815 |
| 149 | Ga0081455_10081019 | 3300005937 | Bacteria | 2660 |
| 150 | Ga0081455_10100019 | 3300005937 | Bacteria | 2331 |
| 151 | Ga0081455_10117249 | 3300005937 | Bacteria | 2104 |
| 152 | Ga0081538_10006629 | 3300005981 | Bacteria | 10150 |
| 153 | Ga0081540_1057637 | 3300005983 | Bacteria | 1877 |
| 154 | Ga0081539_10235588 | 3300005985 | Bacteria | 823 |
| 155 | Ga0070717_10003026 | 3300006028 | Bacteria | 11975 |
| 156 | Ga0070717_10141943 | 3300006028 | Bacteria | 2072 |
| 157 | Ga0070717_11870182 | 3300006028 | Unclassified | 542 |
| 158 | Ga0075365_10731836 | 3300006038 | Bacteria | 699 |
| 159 | Ga0070712_100011885 | 3300006175 | Bacteria | 5532 |
| 160 | Ga0070712_100222335 | 3300006175 | Bacteria | 1495 |
| 161 | Ga0070712_100634420 | 3300006175 | Bacteria | 907 |
| 162 | Ga0075366_10656302 | 3300006195 | Bacteria | 651 |
| 163 | Ga0097621_101227557 | 3300006237 | Bacteria | 707 |
| 164 | Ga0068871_100009075 | 3300006358 | Bacteria | 7184 |
| 165 | Ga0068871_100670438 | 3300006358 | Bacteria | 948 |
| 166 | Ga0075428_101373175 | 3300006844 | Bacteria | 742 |
| 167 | Ga0075430_100263651 | 3300006846 | Bacteria | 1427 |
| 168 | Ga0075431_100006065 | 3300006847 | Bacteria | 11982 |
| 169 | Ga0075431_100618947 | 3300006847 | Bacteria | 1065 |
| 170 | Ga0075433_10948374 | 3300006852 | Bacteria | 750 |
| 171 | Ga0075434_101000206 | 3300006871 | Bacteria | 850 |
| 172 | Ga0075429_100272969 | 3300006880 | Bacteria | 1481 |
| 173 | Ga0068865_100165181 | 3300006881 | Bacteria | 1692 |
| 174 | Ga0068865_100693278 | 3300006881 | Unclassified | 870 |
| 175 | Ga0068865_100785660 | 3300006881 | Bacteria | 820 |
| 176 | Ga0068865_101456158 | 3300006881 | Bacteria | 613 |
| 177 | Ga0075436_100182293 | 3300006914 | Bacteria | 1484 |
| 178 | Ga0097620_100000004 | 3300006931 | Bacteria | 470249 |
| 179 | Ga0097620_100120972 | 3300006931 | Bacteria | 2684 |
| 180 | Ga0097620_100529214 | 3300006931 | Bacteria | 1273 |
| 181 | Ga0097620_100747940 | 3300006931 | Unclassified | 1067 |
| 182 | Ga0097620_101147679 | 3300006931 | Bacteria | 855 |
| 183 | Ga0097620_101924134 | 3300006931 | Bacteria | 653 |
| 184 | Ga0075435_100312736 | 3300007076 | Bacteria | 1344 |
| 185 | Ga0075435_100746826 | 3300007076 | Bacteria | 851 |
| 186 | Ga0105240_10082732 | 3300009093 | Bacteria | 3941 |
| 187 | Ga0105240_10360328 | 3300009093 | Bacteria | 1647 |
| 188 | Ga0111539_10068460 | 3300009094 | Bacteria | 4191 |
| 189 | Ga0105245_10137089 | 3300009098 | Bacteria | 2301 |
| 190 | Ga0105245_10270961 | 3300009098 | Bacteria | 1656 |
| 191 | Ga0105245_10607042 | 3300009098 | Bacteria | 1121 |
| 192 | Ga0105245_12411142 | 3300009098 | Bacteria | 580 |
| 193 | Ga0105247_10103594 | 3300009101 | Bacteria | 1822 |
| 194 | Ga0114129_10708488 | 3300009147 | Bacteria | 1293 |
| 195 | Ga0114129_11037649 | 3300009147 | Bacteria | 1030 |
| 196 | Ga0114129_11908741 | 3300009147 | Bacteria | 720 |
| 197 | Ga0105243_10049264 | 3300009148 | Bacteria | 3323 |
| 198 | Ga0105243_10311946 | 3300009148 | Unclassified | 1430 |
| 199 | Ga0105243_11791159 | 3300009148 | Bacteria | 645 |
| 200 | Ga0105243_12970934 | 3300009148 | Bacteria | 514 |
| 201 | Ga0105241_10050728 | 3300009174 | Bacteria | 3163 |
| 202 | Ga0105241_10258338 | 3300009174 | Unclassified | 1480 |
| 203 | Ga0105241_10684773 | 3300009174 | Bacteria | 934 |
| 204 | Ga0105241_10774849 | 3300009174 | Bacteria | 881 |
| 205 | Ga0105242_10025480 | 3300009176 | Bacteria | 4682 |
| 206 | Ga0105242_10068582 | 3300009176 | Bacteria | 2935 |
| 207 | Ga0105242_10310553 | 3300009176 | Bacteria | 1442 |
| 208 | Ga0105248_10082363 | 3300009177 | Bacteria | 3618 |
| 209 | Ga0105248_10150763 | 3300009177 | Bacteria | 2623 |
| 210 | Ga0105237_10072449 | 3300009545 | Bacteria | 3438 |
| 211 | Ga0105237_11112191 | 3300009545 | Bacteria | 797 |
| 212 | Ga0105237_12776148 | 3300009545 | Bacteria | 501 |
| 213 | Ga0105238_10334639 | 3300009551 | Bacteria | 1501 |
| 214 | Ga0105249_10220678 | 3300009553 | Bacteria | 1865 |
| 215 | Ga0105249_10821839 | 3300009553 | Bacteria | 994 |
| 216 | Ga0105249_11070861 | 3300009553 | Bacteria | 876 |
| 217 | Ga0105249_12417995 | 3300009553 | Bacteria | 598 |
| 218 | Ga0105239_10180195 | 3300010375 | Bacteria | 2364 |
| 219 | Ga0105239_10183550 | 3300010375 | Bacteria | 2341 |
| 220 | Ga0105239_10832402 | 3300010375 | Bacteria | 1058 |
| 221 | Ga0105239_13037038 | 3300010375 | Bacteria | 547 |
| 222 | Ga0105246_10106759 | 3300011119 | Bacteria | 2049 |
| 223 | Ga0157370_10083213 | 3300013104 | Bacteria | 3009 |
| 224 | Ga0157370_10308925 | 3300013104 | Bacteria | 1459 |
| 225 | Ga0157369_10135324 | 3300013105 | Bacteria | 2609 |
| 226 | Ga0157369_10269509 | 3300013105 | Bacteria | 1774 |
| 227 | Ga0157374_11027442 | 3300013296 | Bacteria | 844 |
| 228 | Ga0157378_10007611 | 3300013297 | Bacteria | 9454 |
| 229 | Ga0157378_10196435 | 3300013297 | Bacteria | 1906 |
| 230 | Ga0157378_10244355 | 3300013297 | Bacteria | 1716 |
| 231 | Ga0157378_11570310 | 3300013297 | Bacteria | 703 |
| 232 | Ga0163162_11157771 | 3300013306 | Bacteria | 877 |
| 233 | Ga0163162_11809085 | 3300013306 | Bacteria | 698 |
| 234 | Ga0163162_11834134 | 3300013306 | Bacteria | 694 |
| 235 | Ga0163162_12151268 | 3300013306 | Bacteria | 640 |
| 236 | Ga0157372_10024153 | 3300013307 | Bacteria | 6597 |
| 237 | Ga0157375_10184299 | 3300013308 | Bacteria | 2240 |
| 238 | Ga0157375_10637572 | 3300013308 | Bacteria | 1222 |
| 239 | Ga0157375_10652362 | 3300013308 | Bacteria | 1209 |
| 240 | Ga0157375_10894633 | 3300013308 | Bacteria | 1032 |
| 241 | Ga0157375_10963019 | 3300013308 | Bacteria | 995 |
| 242 | Ga0163163_10323930 | 3300014325 | Bacteria | 1595 |
| 243 | Ga0163163_11445615 | 3300014325 | Bacteria | 749 |
| 244 | Ga0163163_11991918 | 3300014325 | Bacteria | 641 |
| 245 | Ga0157377_10084608 | 3300014745 | Bacteria | 1861 |
| 246 | Ga0157377_10184742 | 3300014745 | Bacteria | 1314 |
| 247 | Ga0157379_10061108 | 3300014968 | Bacteria | 3369 |
| 248 | Ga0157379_11226226 | 3300014968 | Bacteria | 722 |
| 249 | Ga0157376_10077699 | 3300014969 | Bacteria | 2840 |
| 250 | Ga0157376_10371469 | 3300014969 | Bacteria | 1375 |
| 251 | Ga0157376_10610376 | 3300014969 | Bacteria | 1087 |
| 252 | Ga0182005_1129919 | 3300015265 | Bacteria | 722 |
| 253 | Ga0182005_1196356 | 3300015265 | Unclassified | 605 |
| 254 | Ga0163161_10824816 | 3300017792 | Bacteria | 781 |
| 255 | Ga0163161_11583066 | 3300017792 | Bacteria | 577 |
| 256 | Ga0213876_10016077 | 3300021384 | Bacteria | 3958 |
| 257 | Ga0213876_10121302 | 3300021384 | Bacteria | 1388 |
| 258 | Ga0207697_10287869 | 3300025315 | Bacteria | 728 |
| 259 | Ga0207692_10100950 | 3300025898 | Bacteria | 1584 |
| 260 | Ga0207692_10451875 | 3300025898 | Bacteria | 809 |
| 261 | Ga0207642_10075972 | 3300025899 | Bacteria | 1615 |
| 262 | Ga0207642_10129956 | 3300025899 | Bacteria | 1313 |
| 263 | Ga0207680_10157605 | 3300025903 | Bacteria | 1519 |
| 264 | Ga0207699_10017017 | 3300025906 | Bacteria | 3816 |
| 265 | Ga0207699_10061349 | 3300025906 | Unclassified | 2262 |
| 266 | Ga0207699_10862092 | 3300025906 | Bacteria | 667 |
| 267 | Ga0207645_10045363 | 3300025907 | Bacteria | 2810 |
| 268 | Ga0207705_10000407 | 3300025909 | Bacteria | 37762 |
| 269 | Ga0207684_10080635 | 3300025910 | Bacteria | 2769 |
| 270 | Ga0207684_11308668 | 3300025910 | Unclassified | 596 |
| 271 | Ga0207654_10150567 | 3300025911 | Bacteria | 1493 |
| 272 | Ga0207707_10001284 | 3300025912 | Bacteria | 23421 |
| 273 | Ga0207707_10071867 | 3300025912 | Bacteria | 3015 |
| 274 | Ga0207707_10728918 | 3300025912 | Bacteria | 830 |
| 275 | Ga0207695_10002089 | 3300025913 | Bacteria | 30401 |
| 276 | Ga0207695_10848594 | 3300025913 | Bacteria | 793 |
| 277 | Ga0207693_10019292 | 3300025915 | Bacteria | 5426 |
| 278 | Ga0207693_10174874 | 3300025915 | Bacteria | 1690 |
| 279 | Ga0207663_10154127 | 3300025916 | Bacteria | 1615 |
| 280 | Ga0207663_10167030 | 3300025916 | Unclassified | 1559 |
| 281 | Ga0207663_10527985 | 3300025916 | Bacteria | 920 |
| 282 | Ga0207660_10022758 | 3300025917 | Bacteria | 4224 |
| 283 | Ga0207660_10309626 | 3300025917 | Bacteria | 1259 |
| 284 | Ga0207660_10457328 | 3300025917 | Bacteria | 1033 |
| 285 | Ga0207662_10023902 | 3300025918 | Bacteria | 3514 |
| 286 | Ga0207662_10216580 | 3300025918 | Bacteria | 1245 |
| 287 | Ga0207657_10313067 | 3300025919 | Bacteria | 1242 |
| 288 | Ga0207649_10217388 | 3300025920 | Bacteria | 1359 |
| 289 | Ga0207652_10000678 | 3300025921 | Bacteria | 33275 |
| 290 | Ga0207652_10189071 | 3300025921 | Bacteria | 1852 |
| 291 | Ga0207652_10764553 | 3300025921 | Bacteria | 859 |
| 292 | Ga0207646_11028764 | 3300025922 | Bacteria | 727 |
| 293 | Ga0207681_11240492 | 3300025923 | Bacteria | 626 |
| 294 | Ga0207650_10938190 | 3300025925 | Unclassified | 735 |
| 295 | Ga0207659_10342297 | 3300025926 | Unclassified | 1239 |
| 296 | Ga0207659_10375050 | 3300025926 | Bacteria | 1185 |
| 297 | Ga0207687_10042207 | 3300025927 | Bacteria | 3136 |
| 298 | Ga0207687_10330797 | 3300025927 | Bacteria | 1236 |
| 299 | Ga0207687_10582299 | 3300025927 | Unclassified | 942 |
| 300 | Ga0207700_10000651 | 3300025928 | Bacteria | 20300 |
| 301 | Ga0207700_10033904 | 3300025928 | Bacteria | 3658 |
| 302 | Ga0207700_10049844 | 3300025928 | Bacteria | 3117 |
| 303 | Ga0207700_10604025 | 3300025928 | Bacteria | 976 |
| 304 | Ga0207700_10651300 | 3300025928 | Unclassified | 939 |
| 305 | Ga0207664_10089661 | 3300025929 | Bacteria | 2519 |
| 306 | Ga0207664_10144415 | 3300025929 | Bacteria | 2016 |
| 307 | Ga0207664_10654531 | 3300025929 | Bacteria | 944 |
| 308 | Ga0207690_10115909 | 3300025932 | Bacteria | 1937 |
| 309 | Ga0207706_10316801 | 3300025933 | Bacteria | 1358 |
| 310 | Ga0207686_10047917 | 3300025934 | Bacteria | 2644 |
| 311 | Ga0207686_10051012 | 3300025934 | Bacteria | 2575 |
| 312 | Ga0207686_10332454 | 3300025934 | Bacteria | 1139 |
| 313 | Ga0207686_10705828 | 3300025934 | Bacteria | 802 |
| 314 | Ga0207709_10167645 | 3300025935 | Bacteria | 1538 |
| 315 | Ga0207709_10286862 | 3300025935 | Bacteria | 1218 |
| 316 | Ga0207709_10360238 | 3300025935 | Bacteria | 1101 |
| 317 | Ga0207709_10660088 | 3300025935 | Bacteria | 833 |
| 318 | Ga0207670_10020693 | 3300025936 | Bacteria | 4047 |
| 319 | Ga0207669_10460234 | 3300025937 | Bacteria | 1010 |
| 320 | Ga0207669_10576531 | 3300025937 | Bacteria | 911 |
| 321 | Ga0207669_10579928 | 3300025937 | Bacteria | 909 |
| 322 | Ga0207704_11459344 | 3300025938 | Bacteria | 587 |
| 323 | Ga0207704_11574655 | 3300025938 | Bacteria | 564 |
| 324 | Ga0207665_10984652 | 3300025939 | Unclassified | 670 |
| 325 | Ga0207691_10158456 | 3300025940 | Bacteria | 1987 |
| 326 | Ga0207711_10435694 | 3300025941 | Bacteria | 1220 |
| 327 | Ga0207689_10096208 | 3300025942 | Bacteria | 2432 |
| 328 | Ga0207689_10426648 | 3300025942 | Bacteria | 1107 |
| 329 | Ga0207661_10001479 | 3300025944 | Bacteria | 15896 |
| 330 | Ga0207661_10008372 | 3300025944 | Bacteria | 7387 |
| 331 | Ga0207661_10082034 | 3300025944 | Bacteria | 2665 |
| 332 | Ga0207661_10182374 | 3300025944 | Bacteria | 1835 |
| 333 | Ga0207679_10214911 | 3300025945 | Bacteria | 1615 |
| 334 | Ga0207679_10581046 | 3300025945 | Bacteria | 1008 |
| 335 | Ga0207679_10599550 | 3300025945 | Bacteria | 992 |
| 336 | Ga0207667_10180298 | 3300025949 | Bacteria | 2169 |
| 337 | Ga0207667_10546578 | 3300025949 | Bacteria | 1172 |
| 338 | Ga0207667_10681584 | 3300025949 | Bacteria | 1031 |
| 339 | Ga0207651_10030459 | 3300025960 | Bacteria | 3436 |
| 340 | Ga0207651_11784058 | 3300025960 | Bacteria | 554 |
| 341 | Ga0207668_10109711 | 3300025972 | Bacteria | 2068 |
| 342 | Ga0207668_10728229 | 3300025972 | Bacteria | 874 |
| 343 | Ga0207640_12060093 | 3300025981 | Bacteria | 517 |
| 344 | Ga0207658_10221273 | 3300025986 | Bacteria | 1593 |
| 345 | Ga0207703_10745562 | 3300026035 | Bacteria | 933 |
| 346 | Ga0207703_11279563 | 3300026035 | Bacteria | 705 |
| 347 | Ga0207639_11096959 | 3300026041 | Bacteria | 746 |
| 348 | Ga0207678_10050249 | 3300026067 | Bacteria | 3603 |
| 349 | Ga0207678_11963051 | 3300026067 | Bacteria | 510 |
| 350 | Ga0207702_10074728 | 3300026078 | Unclassified | 2926 |
| 351 | Ga0207702_11289715 | 3300026078 | Bacteria | 724 |
| 352 | Ga0207648_10074436 | 3300026089 | Bacteria | 2959 |
| 353 | Ga0207648_10253604 | 3300026089 | Bacteria | 1569 |
| 354 | Ga0207676_10593250 | 3300026095 | Bacteria | 1063 |
| 355 | Ga0207676_11130473 | 3300026095 | Bacteria | 775 |
| 356 | Ga0207676_11895039 | 3300026095 | Unclassified | 595 |
| 357 | Ga0207674_10025595 | 3300026116 | Bacteria | 6287 |
| 358 | Ga0207683_10000047 | 3300026121 | Bacteria | 89190 |
| 359 | Ga0207683_11098641 | 3300026121 | Bacteria | 738 |
| 360 | Ga0207698_10654206 | 3300026142 | Unclassified | 1041 |
| 361 | Ga0207698_11217435 | 3300026142 | Bacteria | 767 |
| 362 | Ga0268266_10414999 | 3300028379 | Bacteria | 1275 |
| 363 | Ga0268266_10431804 | 3300028379 | Bacteria | 1250 |
| 364 | Ga0268265_10067781 | 3300028380 | Bacteria | 2764 |
| 365 | Ga0268264_10443534 | 3300028381 | Bacteria | 1256 |
| 366 | Ga0268264_11067585 | 3300028381 | Bacteria | 815 |
| 367 | Ga0268264_11347047 | 3300028381 | Bacteria | 724 |
| 368 | Ga0307408_100879472 | 3300031548 | Bacteria | 819 |
| 369 | Ga0265313_10120314 | 3300031595 | Bacteria | 1146 |
| 370 | Ga0307413_10830441 | 3300031824 | Bacteria | 779 |
| 371 | Ga0307406_10260190 | 3300031901 | Bacteria | 1312 |
| 372 | Ga0307407_10348506 | 3300031903 | Bacteria | 1048 |
| 373 | Ga0307409_100145312 | 3300031995 | Bacteria | 2050 |
| 374 | Ga0307409_100347579 | 3300031995 | Bacteria | 1398 |
| 375 | Ga0307416_100778662 | 3300032002 | Bacteria | 1051 |
| 376 | Ga0307416_102436488 | 3300032002 | Bacteria | 622 |
| 377 | Ga0307416_103020368 | 3300032002 | Bacteria | 563 |
| 378 | Ga0307411_10373197 | 3300032005 | Bacteria | 1171 |
| 379 | Ga0307415_100029141 | 3300032126 | Bacteria | 3524 |
| 380 | Ga0307415_101201040 | 3300032126 | Bacteria | 715 |
| 381 | Ga0373926_0018857 | 3300035083 | Unclassified | 2376 |
| 382 | Ga0373936_0174471 | 3300035113 | Unclassified | 941 |
| 383 | Ga0373953_0082608 | 3300035117 | Bacteria | 1337 |
| 384 | Ga0373954_0027223 | 3300035118 | Bacteria | 2623 |
| 385 | Ga0373956_0010386 | 3300035119 | Bacteria | 3816 |
| 386 | Ga0373957_0003979 | 3300035120 | Bacteria | 4444 |
| 387 | Ga0373943_0006364 | 3300035170 | Bacteria | 5306 |
| 388 | Ga0373955_0002853 | 3300035172 | Bacteria | 7589 |
| 389 | Ga0373961_0034696 | 3300035241 | Bacteria | 1428 |
| 390 | Ga0373962_0384566 | 3300035242 | Bacteria | 513 |
| 391 | Ga0373924_0112240 | 3300035410 | Bacteria | 1179 |
| 392 | Ga0373935_0159033 | 3300035692 | Bacteria | 1539 |
| 393 | Ga0373927_0006883 | 3300035695 | Bacteria | 7726 |
| 394 | Ga0373933_0005266 | 3300035724 | Bacteria | 7050 |
| 395 | Ga0373947_0071235 | 3300035725 | Bacteria | 2131 |
| 396 | Ga0373937_0000944 | 3300036401 | Bacteria | 24720 |
| 397 | Ga0373925_0070547 | 3300037068 | Unclassified | 2641 |
| 398 | Ga0395900_0002748 | 3300037418 | Bacteria | 19211 |
| 399 | Ga0395900_0116961 | 3300037418 | Bacteria | 2736 |
| 400 | Ga0395900_0832653 | 3300037418 | Bacteria | 849 |
| 401 | Ga0395900_1618718 | 3300037418 | Unclassified | 559 |
| 402 | Ga0395898_0039888 | 3300037466 | Bacteria | 4646 |
| 403 | Ga0395898_0717188 | 3300037466 | Bacteria | 942 |
| 404 | Ga0395905_0118178 | 3300037471 | Bacteria | 2492 |
| 405 | Ga0395905_0750164 | 3300037471 | Bacteria | 878 |
| 406 | Ga0395901_0016295 | 3300038443 | Bacteria | 7570 |
| 407 | Ga0395901_0274485 | 3300038443 | Bacteria | 1753 |
| 408 | Ga0395901_0544530 | 3300038443 | Bacteria | 1177 |
| 409 | Ga0395901_1071864 | 3300038443 | Bacteria | 778 |
| 410 | Ga0242419_001701 | 3300038698 | Bacteria | 1382 |
| 411 | Ga0436365_0628761 | 3300039437 | Bacteria | 4142 |
| 412 | Ga0436365_0866291 | 3300039437 | Bacteria | 3782 |
| 413 | Ga0436365_1753766 | 3300039437 | Bacteria | 3262 |
| 414 | Ga0451807_0389216 | 3300041486 | Bacteria | 1537 |
| 415 | Ga0451853_2067756 | 3300041512 | Bacteria | 542 |
| 416 | Ga0439455_0152838 | 3300042012 | Bacteria | 657 |
| 417 | Ga0439459_0036691 | 3300042438 | Bacteria | 1024 |
| 418 | Ga0466969_0308943 | 3300044656 | Bacteria | 716 |
| 419 | Ga0466972_0493804 | 3300044658 | Bacteria | 576 |
| 420 | Ga0466966_0158704 | 3300044684 | Bacteria | 1377 |
| 421 | Ga0466961_0072836 | 3300044693 | Bacteria | 2179 |
| 422 | Ga0466961_0422909 | 3300044693 | Bacteria | 807 |
| 423 | Ga0466961_0737438 | 3300044693 | Bacteria | 589 |
| 424 | Ga0466963_0022238 | 3300044694 | Bacteria | 4014 |
| 425 | Ga0466963_0167816 | 3300044694 | Bacteria | 1529 |
| 426 | Ga0466964_0094003 | 3300044706 | Bacteria | 1310 |
| 427 | Ga0466971_0192056 | 3300044719 | Bacteria | 962 |
| 428 | Ga0466957_0174616 | 3300044842 | Bacteria | 1401 |
| 429 | Ga0466957_0471964 | 3300044842 | Bacteria | 867 |
| 430 | Ga0466957_0670230 | 3300044842 | Bacteria | 730 |
| 431 | Ga0466960_0368280 | 3300044901 | Bacteria | 823 |
| 432 | Ga0466959_0005273 | 3300045049 | Bacteria | 8831 |
| 433 | Ga0451576_0150876 | 3300045051 | Bacteria | 2424 |
| 434 | Ga0451576_0400396 | 3300045051 | Bacteria | 1439 |
| 435 | Ga0466958_0052185 | 3300045836 | Bacteria | 2478 |
| 436 | Ga0466958_0361384 | 3300045836 | Bacteria | 935 |
| 437 | Ga0466958_0947022 | 3300045836 | Unclassified | 562 |
| 438 | Ga0466967_0017231 | 3300045976 | Bacteria | 5729 |
| 439 | Ga0466967_0094629 | 3300045976 | Bacteria | 2721 |
| 440 | Ga0495603_0010428 | 3300046455 | Bacteria | 5628 |
| 441 | Ga0495603_0069822 | 3300046455 | Bacteria | 2066 |
| 442 | Ga0495638_0193416 | 3300046460 | Bacteria | 1153 |
| 443 | Ga0495653_0647995 | 3300046463 | Bacteria | 645 |
| 444 | Ga0495580_0000637 | 3300046472 | Bacteria | 29752 |
| 445 | Ga0495582_0011894 | 3300046473 | Bacteria | 4791 |
| 446 | Ga0495639_0000056 | 3300046475 | Bacteria | 49657 |
| 447 | Ga0495594_0170593 | 3300046499 | Unclassified | 1238 |
| 448 | Ga0495583_0024591 | 3300046506 | Bacteria | 3023 |
| 449 | Ga0495628_0056843 | 3300046516 | Bacteria | 3079 |
| 450 | Ga0495630_0005645 | 3300046517 | Bacteria | 8840 |
| 451 | Ga0495666_0111702 | 3300046526 | Unclassified | 1283 |
| 452 | Ga0495652_0026063 | 3300046529 | Bacteria | 5167 |
| 453 | Ga0495665_0014021 | 3300046531 | Bacteria | 4327 |
| 454 | Ga0495586_0244490 | 3300046535 | Bacteria | 1023 |
| 455 | Ga0495587_0009238 | 3300046536 | Bacteria | 6326 |
| 456 | Ga0495645_0000922 | 3300046543 | Bacteria | 20006 |
| 457 | Ga0495622_0037031 | 3300046557 | Bacteria | 2273 |
| 458 | Ga0495667_0002386 | 3300046559 | Bacteria | 12559 |
| 459 | Ga0495668_0046642 | 3300046616 | Bacteria | 2407 |
| 460 | Ga0495668_0343906 | 3300046616 | Bacteria | 819 |
| 461 | Ga0495625_0411209 | 3300046660 | Bacteria | 843 |
| 462 | Ga0495588_0001209 | 3300046674 | Bacteria | 11127 |
| 463 | Ga0495657_0147830 | 3300046675 | Bacteria | 1461 |
| 464 | Ga0495599_0028472 | 3300046678 | Bacteria | 3502 |
| 465 | Ga0495623_0001707 | 3300046679 | Bacteria | 14774 |
| 466 | Ga0495647_0130603 | 3300046681 | Bacteria | 1064 |
| 467 | Ga0495658_0000566 | 3300046683 | Bacteria | 20184 |
| 468 | Ga0495613_0062081 | 3300046689 | Bacteria | 2735 |
| 469 | Ga0495600_0016309 | 3300046809 | Bacteria | 4713 |
| 470 | Ga0495581_0003660 | 3300047315 | Bacteria | 8849 |
| 471 | Ga0495604_0143162 | 3300047317 | Bacteria | 1706 |
| 472 | Ga0495636_0303089 | 3300047318 | Bacteria | 748 |
| 473 | Ga0495672_0096587 | 3300047320 | Bacteria | 1611 |
| 474 | Ga0495676_0306392 | 3300047321 | Bacteria | 1070 |
| 475 | Ga0495676_0754553 | 3300047321 | Unclassified | 628 |
| 476 | Ga0495675_0006776 | 3300047444 | Bacteria | 7028 |
| 477 | Ga0495677_0006914 | 3300047445 | Bacteria | 4265 |
| 478 | Ga0495684_0286361 | 3300047471 | Bacteria | 1187 |
| 479 | Ga0495593_0000127 | 3300047673 | Bacteria | 36805 |
| 480 | Ga0495614_0000162 | 3300048089 | Bacteria | 24492 |
| 481 | Ga0496101_0111519 | 3300048904 | Bacteria | 2059 |
| 482 | Ga0496102_0106506 | 3300048905 | Bacteria | 2610 |
| 483 | Ga0496102_0149556 | 3300048905 | Bacteria | 2193 |
| 484 | Ga0496102_0755178 | 3300048905 | Bacteria | 895 |
| 485 | Ga0496103_0030997 | 3300048906 | Bacteria | 3256 |
| 486 | Ga0496103_0388052 | 3300048906 | Bacteria | 897 |
| 487 | Ga0496103_0596920 | 3300048906 | Bacteria | 703 |
| 488 | Ga0496104_0113254 | 3300048907 | Bacteria | 2601 |
| 489 | Ga0496104_1689478 | 3300048907 | Bacteria | 536 |
| 490 | Ga0496106_0015424 | 3300048909 | Bacteria | 5654 |
| 491 | Ga0496106_0390824 | 3300048909 | Bacteria | 1118 |
| 492 | Ga0496107_0148680 | 3300048910 | Bacteria | 1732 |
| 493 | Ga0496109_0000476 | 3300048912 | Bacteria | 34082 |
| 494 | Ga0496114_0008930 | 3300048917 | Bacteria | 7946 |
| 495 | Ga0496115_0026648 | 3300048918 | Bacteria | 4514 |
| 496 | Ga0501032_0667806 | 3300049569 | Bacteria | 660 |
| 497 | Ga0501034_0076797 | 3300049571 | Bacteria | 3346 |
| 498 | Ga0501036_0855117 | 3300049572 | Bacteria | 748 |
| 499 | Ga0501038_0218010 | 3300049574 | Bacteria | 1524 |
| 500 | Ga0501046_0492926 | 3300049580 | Bacteria | 878 |
| 501 | Ga0501069_0462342 | 3300049585 | Bacteria | 755 |
| 502 | Ga0501071_0031088 | 3300049587 | Bacteria | 3782 |
| 503 | Ga0501073_0619925 | 3300049589 | Bacteria | 747 |
| 504 | Ga0501075_0226434 | 3300049591 | Bacteria | 1426 |
| 505 | Ga0501077_0435195 | 3300049593 | Bacteria | 839 |
| 506 | Ga0501243_070317 | 3300049675 | Bacteria | 664 |
| 507 | Ga0501079_0242753 | 3300049741 | Bacteria | 1407 |
| 508 | Ga0501080_0860397 | 3300049742 | Bacteria | 792 |
| 509 | Ga0501081_0072861 | 3300049743 | Bacteria | 2395 |
| 510 | Ga0501035_0227929 | 3300049822 | Bacteria | 1589 |
| 511 | Ga0501044_0000592 | 3300049823 | Bacteria | 44003 |
| 512 | Ga0501044_0305741 | 3300049823 | Bacteria | 1518 |
| 513 | Ga0501044_1353957 | 3300049823 | Bacteria | 578 |
| 514 | Ga0501045_0893114 | 3300049824 | Bacteria | 653 |
| 515 | nmdc:mga03n38_475328_c1 | 3300050490 | Bacteria | 698 |
| 516 | nmdc:mga00v17_1069395_c1 | 3300050491 | Bacteria | 506 |
| 517 | nmdc:mga0yw44_1045807_c1 | 3300050492 | Bacteria | 552 |
| 518 | nmdc:mga0yw44_14658_c1 | 3300050492 | Bacteria | 4170 |
| 519 | nmdc:mga0k408_373844_c1 | 3300050493 | Bacteria | 849 |
| 520 | nmdc:mga0k408_627456_c1 | 3300050493 | Bacteria | 633 |
| 521 | nmdc:mga06z11_900713_c1 | 3300050494 | Bacteria | 539 |
| 522 | nmdc:mga09592_379490_c1 | 3300050508 | Bacteria | 1222 |
| 523 | nmdc:mga0qj67_145670_c1 | 3300050509 | Bacteria | 1920 |
| 524 | nmdc:mga0qj67_259587_c1 | 3300050509 | Bacteria | 1409 |
| 525 | nmdc:mga06r32_4911_c1 | 3300050510 | Bacteria | 12044 |
| 526 | nmdc:mga08y16_344281_c1 | 3300050511 | Bacteria | 1532 |
| 527 | nmdc:mga0n895_132903_c1 | 3300050512 | Bacteria | 2514 |
| 528 | nmdc:mga0rr50_1204439_c1 | 3300050513 | Bacteria | 643 |
| 529 | nmdc:mga0rr50_1800895_c1 | 3300050513 | Bacteria | 515 |
| 530 | nmdc:mga0rr50_419315_c1 | 3300050513 | Bacteria | 1132 |
| 531 | nmdc:mga0rr50_549406_c1 | 3300050513 | Bacteria | 983 |
| 532 | nmdc:mga08x19_340868_c1 | 3300050514 | Bacteria | 1045 |
| 533 | nmdc:mga0a205_867855_c1 | 3300050515 | Bacteria | 749 |
| 534 | Ga0495601_0451528 | 3300053077 | Bacteria | 831 |
| 535 | Ga0495595_0070250 | 3300053084 | Bacteria | 1654 |
| 536 | Ga0495619_0382653 | 3300053085 | Bacteria | 972 |
| 537 | Ga0500572_001948 | 3300053111 | Bacteria | 5174 |
| 538 | Ga0500597_031749 | 3300053120 | Bacteria | 2178 |
| 539 | Ga0500622_0041761 | 3300053156 | Bacteria | 2385 |
| 540 | Ga0500645_041111 | 3300053730 | Bacteria | 1366 |
| 541 | Ga0500645_074541 | 3300053730 | Bacteria | 972 |
| 542 | Ga0500645_099259 | 3300053730 | Bacteria | 822 |
| 543 | Ga0501084_0113541 | 3300054114 | Bacteria | 2277 |
| 544 | Ga0501082_0170888 | 3300060353 | Bacteria | 1890 |
| 545 | Ga0466962_0159968 | 3300061719 | Bacteria | 1094 |
| 546 | Ga0530510_0327961 | 3300061734 | Bacteria | 1148 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049569 | Ga0501032_0667806 | Ga0501032_0667806_262_603 | 109 |
| 2 | 3300049571 | Ga0501034_0076797 | Ga0501034_0076797_2570_2911 | 109 |
| 3 | 3300049823 | Ga0501044_0000592 | Ga0501044_0000592_37064_37405 | 109 |
| 4 | 3300053111 | Ga0500572_001948 | Ga0500572_001948_1141_1482 | 109 |
| 5 | 3300053120 | Ga0500597_031749 | Ga0500597_031749_1054_1395 | 109 |
| 6 | iso_pu_bacteria | 2524614857 | 2526062312 | 109 |
| 7 | iso_pu_bacteria | 2739367875 | 2740063662 | 109 |
| 8 | 3300005327 | Ga0070658_11265579 | Ga0070658_112655791 | 110 |
| 9 | 3300005339 | Ga0070660_101794878 | Ga0070660_1017948781 | 110 |
| 10 | 3300005366 | Ga0070659_100366053 | Ga0070659_1003660532 | 110 |
| 11 | 3300005434 | Ga0070709_11012827 | Ga0070709_110128271 | 110 |
| 12 | 3300005438 | Ga0070701_10473183 | Ga0070701_104731832 | 110 |
| 13 | 3300005455 | Ga0070663_100584190 | Ga0070663_1005841902 | 110 |
| 14 | 3300005466 | Ga0070685_10766245 | Ga0070685_107662452 | 110 |
| 15 | 3300005535 | Ga0070684_100323835 | Ga0070684_1003238352 | 110 |
| 16 | 3300005564 | Ga0070664_101056004 | Ga0070664_1010560042 | 110 |
| 17 | 3300005617 | Ga0068859_101147802 | Ga0068859_1011478022 | 110 |
| 18 | 3300005718 | Ga0068866_11127837 | Ga0068866_111278371 | 110 |
| 19 | 3300005719 | Ga0068861_101444378 | Ga0068861_1014443781 | 110 |
| 20 | 3300005841 | Ga0068863_100678653 | Ga0068863_1006786531 | 110 |
| 21 | 3300005844 | Ga0068862_100026756 | Ga0068862_1000267562 | 110 |
| 22 | 3300005937 | Ga0081455_10073987 | Ga0081455_100739872 | 110 |
| 23 | 3300006881 | Ga0068865_100785660 | Ga0068865_1007856602 | 110 |
| 24 | 3300006931 | Ga0097620_101147679 | Ga0097620_1011476792 | 110 |
| 25 | 3300009093 | Ga0105240_10082732 | Ga0105240_100827324 | 110 |
| 26 | 3300009098 | Ga0105245_12411142 | Ga0105245_124111421 | 110 |
| 27 | 3300009148 | Ga0105243_12970934 | Ga0105243_129709341 | 110 |
| 28 | 3300009174 | Ga0105241_10684773 | Ga0105241_106847732 | 110 |
| 29 | 3300009553 | Ga0105249_11070861 | Ga0105249_110708611 | 110 |
| 30 | 3300013296 | Ga0157374_11027442 | Ga0157374_110274422 | 110 |
| 31 | 3300013308 | Ga0157375_10894633 | Ga0157375_108946331 | 110 |
| 32 | 3300014745 | Ga0157377_10184742 | Ga0157377_101847421 | 110 |
| 33 | 3300014968 | Ga0157379_11226226 | Ga0157379_112262262 | 110 |
| 34 | 3300021384 | Ga0213876_10121302 | Ga0213876_101213021 | 110 |
| 35 | 3300025909 | Ga0207705_10000407 | Ga0207705_1000040712 | 110 |
| 36 | 3300025913 | Ga0207695_10848594 | Ga0207695_108485942 | 110 |
| 37 | 3300025919 | Ga0207657_10313067 | Ga0207657_103130672 | 110 |
| 38 | 3300025932 | Ga0207690_10115909 | Ga0207690_101159092 | 110 |
| 39 | 3300039437 | Ga0436365_0628761 | Ga0436365_0628761_3373_3714 | 110 |
| 40 | 3300042012 | Ga0439455_0152838 | Ga0439455_0152838_253_597 | 110 |
| 41 | 3300044658 | Ga0466972_0493804 | Ga0466972_0493804_107_457 | 110 |
| 42 | 3300044693 | Ga0466961_0737438 | Ga0466961_0737438_134_478 | 110 |
| 43 | 3300044694 | Ga0466963_0022238 | Ga0466963_0022238_2612_2956 | 110 |
| 44 | 3300044706 | Ga0466964_0094003 | Ga0466964_0094003_536_880 | 110 |
| 45 | 3300044719 | Ga0466971_0192056 | Ga0466971_0192056_548_892 | 110 |
| 46 | 3300044842 | Ga0466957_0670230 | Ga0466957_0670230_136_480 | 110 |
| 47 | 3300045836 | Ga0466958_0052185 | Ga0466958_0052185_521_865 | 110 |
| 48 | 3300046460 | Ga0495638_0193416 | Ga0495638_0193416_187_531 | 110 |
| 49 | 3300046506 | Ga0495583_0024591 | Ga0495583_0024591_58_402 | 110 |
| 50 | 3300046616 | Ga0495668_0046642 | Ga0495668_0046642_1923_2267 | 110 |
| 51 | 3300046660 | Ga0495625_0411209 | Ga0495625_0411209_122_466 | 110 |
| 52 | 3300047445 | Ga0495677_0006914 | Ga0495677_0006914_445_789 | 110 |
| 53 | 3300061719 | Ga0466962_0159968 | Ga0466962_0159968_119_463 | 110 |
| 54 | 3300005456 | Ga0070678_100832474 | Ga0070678_1008324742 | 111 |
| 55 | 3300006358 | Ga0068871_100670438 | Ga0068871_1006704382 | 111 |
| 56 | 3300009176 | Ga0105242_10068582 | Ga0105242_100685824 | 111 |
| 57 | 3300013306 | Ga0163162_12151268 | Ga0163162_121512682 | 111 |
| 58 | 3300013308 | Ga0157375_10637572 | Ga0157375_106375722 | 111 |
| 59 | 3300014969 | Ga0157376_10610376 | Ga0157376_106103763 | 111 |
| 60 | 3300017792 | Ga0163161_11583066 | Ga0163161_115830661 | 111 |
| 61 | 3300025934 | Ga0207686_10047917 | Ga0207686_100479172 | 111 |
| 62 | 3300026121 | Ga0207683_11098641 | Ga0207683_110986412 | 111 |
| 63 | 3300028379 | Ga0268266_10431804 | Ga0268266_104318042 | 111 |
| 64 | 3300031595 | Ga0265313_10120314 | Ga0265313_101203142 | 111 |
| 65 | 3300042438 | Ga0439459_0036691 | Ga0439459_0036691_393_734 | 111 |
| 66 | 3300049675 | Ga0501243_070317 | Ga0501243_070317_50_385 | 111 |
| 67 | 3300050491 | nmdc:mga00v17_1069395_c1 | nmdc:mga00v17_1069395_c1_35_388 | 111 |
| 68 | 3300050492 | nmdc:mga0yw44_1045807_c1 | nmdc:mga0yw44_1045807_c1_136_477 | 111 |
| 69 | 3300050493 | nmdc:mga0k408_627456_c1 | nmdc:mga0k408_627456_c1_172_525 | 111 |
| 70 | 3300005330 | Ga0070690_100314310 | Ga0070690_1003143102 | 112 |
| 71 | 3300005333 | Ga0070677_10198919 | Ga0070677_101989192 | 112 |
| 72 | 3300005334 | Ga0068869_100369276 | Ga0068869_1003692763 | 112 |
| 73 | 3300005336 | Ga0070680_100053923 | Ga0070680_1000539233 | 112 |
| 74 | 3300005343 | Ga0070687_100647769 | Ga0070687_1006477692 | 112 |
| 75 | 3300005353 | Ga0070669_101007972 | Ga0070669_1010079722 | 112 |
| 76 | 3300005354 | Ga0070675_100101865 | Ga0070675_1001018653 | 112 |
| 77 | 3300005354 | Ga0070675_100509761 | Ga0070675_1005097613 | 112 |
| 78 | 3300005364 | Ga0070673_100271857 | Ga0070673_1002718572 | 112 |
| 79 | 3300005365 | Ga0070688_100022487 | Ga0070688_1000224872 | 112 |
| 80 | 3300005367 | Ga0070667_100037627 | Ga0070667_1000376274 | 112 |
| 81 | 3300005441 | Ga0070700_100813023 | Ga0070700_1008130232 | 112 |
| 82 | 3300005457 | Ga0070662_101129824 | Ga0070662_1011298241 | 112 |
| 83 | 3300005459 | Ga0068867_100236054 | Ga0068867_1002360543 | 112 |
| 84 | 3300005459 | Ga0068867_100284606 | Ga0068867_1002846062 | 112 |
| 85 | 3300005466 | Ga0070685_10089724 | Ga0070685_100897242 | 112 |
| 86 | 3300005518 | Ga0070699_101318179 | Ga0070699_1013181791 | 112 |
| 87 | 3300005543 | Ga0070672_100407074 | Ga0070672_1004070742 | 112 |
| 88 | 3300005544 | Ga0070686_100478108 | Ga0070686_1004781082 | 112 |
| 89 | 3300005548 | Ga0070665_100446443 | Ga0070665_1004464431 | 112 |
| 90 | 3300005563 | Ga0068855_100435511 | Ga0068855_1004355112 | 112 |
| 91 | 3300005614 | Ga0068856_100223689 | Ga0068856_1002236894 | 112 |
| 92 | 3300005617 | Ga0068859_100120967 | Ga0068859_1001209674 | 112 |
| 93 | 3300005618 | Ga0068864_101220038 | Ga0068864_1012200381 | 112 |
| 94 | 3300005718 | Ga0068866_10033981 | Ga0068866_100339812 | 112 |
| 95 | 3300005840 | Ga0068870_10835118 | Ga0068870_108351182 | 112 |
| 96 | 3300005844 | Ga0068862_100270241 | Ga0068862_1002702412 | 112 |
| 97 | 3300005983 | Ga0081540_1057637 | Ga0081540_10576372 | 112 |
| 98 | 3300006237 | Ga0097621_101227557 | Ga0097621_1012275572 | 112 |
| 99 | 3300006881 | Ga0068865_100693278 | Ga0068865_1006932782 | 112 |
| 100 | 3300006881 | Ga0068865_101456158 | Ga0068865_1014561581 | 112 |
| 101 | 3300006931 | Ga0097620_100120972 | Ga0097620_1001209724 | 112 |
| 102 | 3300009098 | Ga0105245_10270961 | Ga0105245_102709612 | 112 |
| 103 | 3300009098 | Ga0105245_10607042 | Ga0105245_106070422 | 112 |
| 104 | 3300009148 | Ga0105243_10311946 | Ga0105243_103119462 | 112 |
| 105 | 3300009174 | Ga0105241_10258338 | Ga0105241_102583381 | 112 |
| 106 | 3300009176 | Ga0105242_10310553 | Ga0105242_103105533 | 112 |
| 107 | 3300009177 | Ga0105248_10150763 | Ga0105248_101507634 | 112 |
| 108 | 3300009545 | Ga0105237_12776148 | Ga0105237_127761481 | 112 |
| 109 | 3300009551 | Ga0105238_10334639 | Ga0105238_103346391 | 112 |
| 110 | 3300010375 | Ga0105239_10180195 | Ga0105239_101801954 | 112 |
| 111 | 3300010375 | Ga0105239_13037038 | Ga0105239_130370381 | 112 |
| 112 | 3300011119 | Ga0105246_10106759 | Ga0105246_101067594 | 112 |
| 113 | 3300013297 | Ga0157378_10244355 | Ga0157378_102443551 | 112 |
| 114 | 3300013306 | Ga0163162_11809085 | Ga0163162_118090851 | 112 |
| 115 | 3300013308 | Ga0157375_10184299 | Ga0157375_101842992 | 112 |
| 116 | 3300013308 | Ga0157375_10652362 | Ga0157375_106523621 | 112 |
| 117 | 3300014745 | Ga0157377_10084608 | Ga0157377_100846083 | 112 |
| 118 | 3300014968 | Ga0157379_10061108 | Ga0157379_100611085 | 112 |
| 119 | 3300014969 | Ga0157376_10371469 | Ga0157376_103714692 | 112 |
| 120 | 3300025315 | Ga0207697_10287869 | Ga0207697_102878692 | 112 |
| 121 | 3300025899 | Ga0207642_10129956 | Ga0207642_101299562 | 112 |
| 122 | 3300025903 | Ga0207680_10157605 | Ga0207680_101576052 | 112 |
| 123 | 3300025907 | Ga0207645_10045363 | Ga0207645_100453632 | 112 |
| 124 | 3300025918 | Ga0207662_10023902 | Ga0207662_1002390210 | 112 |
| 125 | 3300025923 | Ga0207681_11240492 | Ga0207681_112404921 | 112 |
| 126 | 3300025926 | Ga0207659_10375050 | Ga0207659_103750503 | 112 |
| 127 | 3300025927 | Ga0207687_10582299 | Ga0207687_105822992 | 112 |
| 128 | 3300025933 | Ga0207706_10316801 | Ga0207706_103168012 | 112 |
| 129 | 3300025934 | Ga0207686_10332454 | Ga0207686_103324542 | 112 |
| 130 | 3300025934 | Ga0207686_10705828 | Ga0207686_107058282 | 112 |
| 131 | 3300025935 | Ga0207709_10360238 | Ga0207709_103602383 | 112 |
| 132 | 3300025936 | Ga0207670_10020693 | Ga0207670_100206933 | 112 |
| 133 | 3300025937 | Ga0207669_10460234 | Ga0207669_104602342 | 112 |
| 134 | 3300025938 | Ga0207704_11459344 | Ga0207704_114593442 | 112 |
| 135 | 3300025940 | Ga0207691_10158456 | Ga0207691_101584562 | 112 |
| 136 | 3300025942 | Ga0207689_10096208 | Ga0207689_100962083 | 112 |
| 137 | 3300025945 | Ga0207679_10214911 | Ga0207679_102149112 | 112 |
| 138 | 3300025949 | Ga0207667_10681584 | Ga0207667_106815842 | 112 |
| 139 | 3300025960 | Ga0207651_10030459 | Ga0207651_100304598 | 112 |
| 140 | 3300025972 | Ga0207668_10109711 | Ga0207668_101097113 | 112 |
| 141 | 3300025986 | Ga0207658_10221273 | Ga0207658_102212733 | 112 |
| 142 | 3300026041 | Ga0207639_11096959 | Ga0207639_110969591 | 112 |
| 143 | 3300026078 | Ga0207702_11289715 | Ga0207702_112897151 | 112 |
| 144 | 3300026089 | Ga0207648_10074436 | Ga0207648_100744367 | 112 |
| 145 | 3300026142 | Ga0207698_11217435 | Ga0207698_112174352 | 112 |
| 146 | 3300028379 | Ga0268266_10414999 | Ga0268266_104149993 | 112 |
| 147 | 3300028380 | Ga0268265_10067781 | Ga0268265_100677812 | 112 |
| 148 | 3300028381 | Ga0268264_10443534 | Ga0268264_104435342 | 112 |
| 149 | 3300031548 | Ga0307408_100879472 | Ga0307408_1008794722 | 112 |
| 150 | 3300031901 | Ga0307406_10260190 | Ga0307406_102601902 | 112 |
| 151 | 3300031995 | Ga0307409_100347579 | Ga0307409_1003475792 | 112 |
| 152 | 3300032002 | Ga0307416_100778662 | Ga0307416_1007786621 | 112 |
| 153 | 3300032126 | Ga0307415_101201040 | Ga0307415_1012010402 | 112 |
| 154 | 3300037418 | Ga0395900_1618718 | Ga0395900_1618718_92_430 | 112 |
| 155 | 3300037466 | Ga0395898_0717188 | Ga0395898_0717188_178_516 | 112 |
| 156 | 3300038443 | Ga0395901_0274485 | Ga0395901_0274485_196_534 | 112 |
| 157 | 3300041486 | Ga0451807_0389216 | Ga0451807_0389216_477_815 | 112 |
| 158 | 3300044693 | Ga0466961_0422909 | Ga0466961_0422909_230_601 | 112 |
| 159 | 3300044694 | Ga0466963_0167816 | Ga0466963_0167816_272_640 | 112 |
| 160 | 3300044842 | Ga0466957_0174616 | Ga0466957_0174616_784_1152 | 112 |
| 161 | 3300044901 | Ga0466960_0368280 | Ga0466960_0368280_302_676 | 112 |
| 162 | 3300045976 | Ga0466967_0017231 | Ga0466967_0017231_2195_2569 | 112 |
| 163 | 3300046616 | Ga0495668_0343906 | Ga0495668_0343906_278_628 | 112 |
| 164 | 3300047318 | Ga0495636_0303089 | Ga0495636_0303089_208_546 | 112 |
| 165 | 3300047320 | Ga0495672_0096587 | Ga0495672_0096587_397_735 | 112 |
| 166 | 3300053156 | Ga0500622_0041761 | Ga0500622_0041761_1807_2157 | 112 |
| 167 | 3300053730 | Ga0500645_074541 | Ga0500645_074541_406_756 | 112 |
| 168 | 3300061734 | Ga0530510_0327961 | Ga0530510_0327961_524_862 | 112 |
| 169 | iso_pu_bacteria | 2873314349 | 2873319711 | 112 |
| 170 | 3300005457 | Ga0070662_101180322 | Ga0070662_1011803221 | 113 |
| 171 | 3300005547 | Ga0070693_100464661 | Ga0070693_1004646612 | 113 |
| 172 | 3300005563 | Ga0068855_102132200 | Ga0068855_1021322001 | 113 |
| 173 | 3300005578 | Ga0068854_100822179 | Ga0068854_1008221792 | 113 |
| 174 | 3300005615 | Ga0070702_100704141 | Ga0070702_1007041412 | 113 |
| 175 | 3300009098 | Ga0105245_10137089 | Ga0105245_101370891 | 113 |
| 176 | 3300010375 | Ga0105239_10183550 | Ga0105239_101835501 | 113 |
| 177 | 3300013297 | Ga0157378_11570310 | Ga0157378_115703102 | 113 |
| 178 | 3300013306 | Ga0163162_11157771 | Ga0163162_111577712 | 113 |
| 179 | 3300025927 | Ga0207687_10330797 | Ga0207687_103307971 | 113 |
| 180 | 3300025981 | Ga0207640_12060093 | Ga0207640_120600932 | 113 |
| 181 | 3300048905 | Ga0496102_0755178 | Ga0496102_0755178_446_862 | 113 |
| 182 | 3300048906 | Ga0496103_0388052 | Ga0496103_0388052_431_847 | 113 |
| 183 | 3300005937 | Ga0081455_10001225 | Ga0081455_1000122532 | 114 |
| 184 | 3300005937 | Ga0081455_10081019 | Ga0081455_100810192 | 114 |
| 185 | 3300009147 | Ga0114129_11908741 | Ga0114129_119087411 | 114 |
| 186 | 3300014325 | Ga0163163_11991918 | Ga0163163_119919182 | 114 |
| 187 | 3300025928 | Ga0207700_10604025 | Ga0207700_106040252 | 114 |
| 188 | 3300037471 | Ga0395905_0750164 | Ga0395905_0750164_150_503 | 114 |
| 189 | 3300039437 | Ga0436365_1753766 | Ga0436365_1753766_799_1143 | 114 |
| 190 | 3300045836 | Ga0466958_0361384 | Ga0466958_0361384_542_889 | 114 |
| 191 | 3300049572 | Ga0501036_0855117 | Ga0501036_0855117_17_361 | 114 |
| 192 | 3300049574 | Ga0501038_0218010 | Ga0501038_0218010_459_809 | 114 |
| 193 | 3300049580 | Ga0501046_0492926 | Ga0501046_0492926_243_587 | 114 |
| 194 | 3300049585 | Ga0501069_0462342 | Ga0501069_0462342_32_376 | 114 |
| 195 | 3300049587 | Ga0501071_0031088 | Ga0501071_0031088_960_1304 | 114 |
| 196 | 3300049589 | Ga0501073_0619925 | Ga0501073_0619925_223_567 | 114 |
| 197 | 3300049591 | Ga0501075_0226434 | Ga0501075_0226434_1045_1389 | 114 |
| 198 | 3300049593 | Ga0501077_0435195 | Ga0501077_0435195_474_818 | 114 |
| 199 | 3300049741 | Ga0501079_0242753 | Ga0501079_0242753_505_849 | 114 |
| 200 | 3300049743 | Ga0501081_0072861 | Ga0501081_0072861_964_1308 | 114 |
| 201 | 3300049823 | Ga0501044_0305741 | Ga0501044_0305741_1109_1459 | 114 |
| 202 | 3300053730 | Ga0500645_041111 | Ga0500645_041111_974_1318 | 114 |
| 203 | 3300053730 | Ga0500645_099259 | Ga0500645_099259_100_444 | 114 |
| 204 | 3300054114 | Ga0501084_0113541 | Ga0501084_0113541_1283_1627 | 114 |
| 205 | 3300005329 | Ga0070683_100043908 | Ga0070683_1000439082 | 115 |
| 206 | 3300005336 | Ga0070680_100032107 | Ga0070680_1000321071 | 115 |
| 207 | 3300005336 | Ga0070680_100370845 | Ga0070680_1003708451 | 115 |
| 208 | 3300005337 | Ga0070682_100411639 | Ga0070682_1004116393 | 115 |
| 209 | 3300005339 | Ga0070660_101878942 | Ga0070660_1018789421 | 115 |
| 210 | 3300005345 | Ga0070692_10424222 | Ga0070692_104242222 | 115 |
| 211 | 3300005355 | Ga0070671_100453224 | Ga0070671_1004532242 | 115 |
| 212 | 3300005356 | Ga0070674_100649593 | Ga0070674_1006495931 | 115 |
| 213 | 3300005435 | Ga0070714_100027701 | Ga0070714_1000277012 | 115 |
| 214 | 3300005435 | Ga0070714_101215031 | Ga0070714_1012150311 | 115 |
| 215 | 3300005436 | Ga0070713_100000219 | Ga0070713_10000021927 | 115 |
| 216 | 3300005436 | Ga0070713_100020793 | Ga0070713_1000207931 | 115 |
| 217 | 3300005436 | Ga0070713_100028455 | Ga0070713_1000284555 | 115 |
| 218 | 3300005436 | Ga0070713_100210306 | Ga0070713_1002103063 | 115 |
| 219 | 3300005437 | Ga0070710_10387228 | Ga0070710_103872282 | 115 |
| 220 | 3300005439 | Ga0070711_100031442 | Ga0070711_1000314426 | 115 |
| 221 | 3300005439 | Ga0070711_100494924 | Ga0070711_1004949241 | 115 |
| 222 | 3300005440 | Ga0070705_100062181 | Ga0070705_1000621814 | 115 |
| 223 | 3300005455 | Ga0070663_101429024 | Ga0070663_1014290242 | 115 |
| 224 | 3300005456 | Ga0070678_100001493 | Ga0070678_1000014933 | 115 |
| 225 | 3300005458 | Ga0070681_10002467 | Ga0070681_100024675 | 115 |
| 226 | 3300005458 | Ga0070681_10117873 | Ga0070681_101178734 | 115 |
| 227 | 3300005530 | Ga0070679_100001208 | Ga0070679_10000120815 | 115 |
| 228 | 3300005530 | Ga0070679_100391964 | Ga0070679_1003919643 | 115 |
| 229 | 3300005535 | Ga0070684_100182336 | Ga0070684_1001823363 | 115 |
| 230 | 3300005535 | Ga0070684_100591267 | Ga0070684_1005912672 | 115 |
| 231 | 3300005547 | Ga0070693_100010836 | Ga0070693_1000108365 | 115 |
| 232 | 3300005547 | Ga0070693_100233386 | Ga0070693_1002333862 | 115 |
| 233 | 3300005549 | Ga0070704_100119118 | Ga0070704_1001191183 | 115 |
| 234 | 3300005564 | Ga0070664_100129718 | Ga0070664_1001297183 | 115 |
| 235 | 3300005615 | Ga0070702_100000533 | Ga0070702_1000005335 | 115 |
| 236 | 3300005718 | Ga0068866_10012152 | Ga0068866_100121524 | 115 |
| 237 | 3300005842 | Ga0068858_100088267 | Ga0068858_1000882675 | 115 |
| 238 | 3300005843 | Ga0068860_100073596 | Ga0068860_1000735963 | 115 |
| 239 | 3300006028 | Ga0070717_10003026 | Ga0070717_100030263 | 115 |
| 240 | 3300006028 | Ga0070717_10141943 | Ga0070717_101419433 | 115 |
| 241 | 3300006028 | Ga0070717_11870182 | Ga0070717_118701821 | 115 |
| 242 | 3300006175 | Ga0070712_100011885 | Ga0070712_1000118854 | 115 |
| 243 | 3300006175 | Ga0070712_100222335 | Ga0070712_1002223351 | 115 |
| 244 | 3300006195 | Ga0075366_10656302 | Ga0075366_106563022 | 115 |
| 245 | 3300006358 | Ga0068871_100009075 | Ga0068871_1000090754 | 115 |
| 246 | 3300006847 | Ga0075431_100006065 | Ga0075431_1000060656 | 115 |
| 247 | 3300006880 | Ga0075429_100272969 | Ga0075429_1002729693 | 115 |
| 248 | 3300006881 | Ga0068865_100165181 | Ga0068865_1001651812 | 115 |
| 249 | 3300006914 | Ga0075436_100182293 | Ga0075436_1001822932 | 115 |
| 250 | 3300007076 | Ga0075435_100312736 | Ga0075435_1003127362 | 115 |
| 251 | 3300007076 | Ga0075435_100746826 | Ga0075435_1007468262 | 115 |
| 252 | 3300009101 | Ga0105247_10103594 | Ga0105247_101035943 | 115 |
| 253 | 3300009148 | Ga0105243_10049264 | Ga0105243_100492645 | 115 |
| 254 | 3300009174 | Ga0105241_10050728 | Ga0105241_100507284 | 115 |
| 255 | 3300009176 | Ga0105242_10025480 | Ga0105242_100254805 | 115 |
| 256 | 3300009177 | Ga0105248_10082363 | Ga0105248_100823633 | 115 |
| 257 | 3300013297 | Ga0157378_10007611 | Ga0157378_1000761110 | 115 |
| 258 | 3300013308 | Ga0157375_10963019 | Ga0157375_109630191 | 115 |
| 259 | 3300014969 | Ga0157376_10077699 | Ga0157376_100776995 | 115 |
| 260 | 3300017792 | Ga0163161_10824816 | Ga0163161_108248162 | 115 |
| 261 | 3300025898 | Ga0207692_10100950 | Ga0207692_101009501 | 115 |
| 262 | 3300025898 | Ga0207692_10451875 | Ga0207692_104518751 | 115 |
| 263 | 3300025899 | Ga0207642_10075972 | Ga0207642_100759723 | 115 |
| 264 | 3300025906 | Ga0207699_10017017 | Ga0207699_100170172 | 115 |
| 265 | 3300025906 | Ga0207699_10862092 | Ga0207699_108620921 | 115 |
| 266 | 3300025911 | Ga0207654_10150567 | Ga0207654_101505673 | 115 |
| 267 | 3300025912 | Ga0207707_10001284 | Ga0207707_1000128416 | 115 |
| 268 | 3300025912 | Ga0207707_10071867 | Ga0207707_100718674 | 115 |
| 269 | 3300025912 | Ga0207707_10728918 | Ga0207707_107289182 | 115 |
| 270 | 3300025915 | Ga0207693_10019292 | Ga0207693_100192923 | 115 |
| 271 | 3300025916 | Ga0207663_10154127 | Ga0207663_101541272 | 115 |
| 272 | 3300025916 | Ga0207663_10527985 | Ga0207663_105279851 | 115 |
| 273 | 3300025917 | Ga0207660_10022758 | Ga0207660_100227581 | 115 |
| 274 | 3300025917 | Ga0207660_10457328 | Ga0207660_104573281 | 115 |
| 275 | 3300025921 | Ga0207652_10000678 | Ga0207652_100006784 | 115 |
| 276 | 3300025921 | Ga0207652_10189071 | Ga0207652_101890712 | 115 |
| 277 | 3300025921 | Ga0207652_10764553 | Ga0207652_107645532 | 115 |
| 278 | 3300025927 | Ga0207687_10042207 | Ga0207687_100422073 | 115 |
| 279 | 3300025928 | Ga0207700_10000651 | Ga0207700_1000065115 | 115 |
| 280 | 3300025928 | Ga0207700_10049844 | Ga0207700_100498441 | 115 |
| 281 | 3300025929 | Ga0207664_10089661 | Ga0207664_100896615 | 115 |
| 282 | 3300025929 | Ga0207664_10654531 | Ga0207664_106545312 | 115 |
| 283 | 3300025934 | Ga0207686_10051012 | Ga0207686_100510124 | 115 |
| 284 | 3300025935 | Ga0207709_10167645 | Ga0207709_101676454 | 115 |
| 285 | 3300025935 | Ga0207709_10660088 | Ga0207709_106600882 | 115 |
| 286 | 3300025937 | Ga0207669_10576531 | Ga0207669_105765311 | 115 |
| 287 | 3300025938 | Ga0207704_11574655 | Ga0207704_115746551 | 115 |
| 288 | 3300025941 | Ga0207711_10435694 | Ga0207711_104356943 | 115 |
| 289 | 3300025949 | Ga0207667_10546578 | Ga0207667_105465782 | 115 |
| 290 | 3300025960 | Ga0207651_11784058 | Ga0207651_117840581 | 115 |
| 291 | 3300026035 | Ga0207703_11279563 | Ga0207703_112795631 | 115 |
| 292 | 3300026067 | Ga0207678_10050249 | Ga0207678_100502495 | 115 |
| 293 | 3300026089 | Ga0207648_10253604 | Ga0207648_102536042 | 115 |
| 294 | 3300026121 | Ga0207683_10000047 | Ga0207683_1000004753 | 115 |
| 295 | 3300028381 | Ga0268264_11347047 | Ga0268264_113470471 | 115 |
| 296 | 3300035083 | Ga0373926_0018857 | Ga0373926_0018857_463_810 | 115 |
| 297 | 3300035113 | Ga0373936_0174471 | Ga0373936_0174471_576_923 | 115 |
| 298 | 3300035170 | Ga0373943_0006364 | Ga0373943_0006364_35_382 | 115 |
| 299 | 3300035695 | Ga0373927_0006883 | Ga0373927_0006883_3242_3589 | 115 |
| 300 | 3300035725 | Ga0373947_0071235 | Ga0373947_0071235_804_1151 | 115 |
| 301 | 3300037068 | Ga0373925_0070547 | Ga0373925_0070547_1887_2234 | 115 |
| 302 | 3300038443 | Ga0395901_1071864 | Ga0395901_1071864_217_564 | 115 |
| 303 | 3300044842 | Ga0466957_0471964 | Ga0466957_0471964_60_407 | 115 |
| 304 | 3300045051 | Ga0451576_0150876 | Ga0451576_0150876_1066_1413 | 115 |
| 305 | 3300045051 | Ga0451576_0400396 | Ga0451576_0400396_392_739 | 115 |
| 306 | 3300046455 | Ga0495603_0010428 | Ga0495603_0010428_1404_1751 | 115 |
| 307 | 3300046472 | Ga0495580_0000637 | Ga0495580_0000637_11210_11557 | 115 |
| 308 | 3300046473 | Ga0495582_0011894 | Ga0495582_0011894_2201_2548 | 115 |
| 309 | 3300046475 | Ga0495639_0000056 | Ga0495639_0000056_42478_42825 | 115 |
| 310 | 3300046499 | Ga0495594_0170593 | Ga0495594_0170593_478_825 | 115 |
| 311 | 3300046517 | Ga0495630_0005645 | Ga0495630_0005645_7760_8107 | 115 |
| 312 | 3300046526 | Ga0495666_0111702 | Ga0495666_0111702_475_822 | 115 |
| 313 | 3300046531 | Ga0495665_0014021 | Ga0495665_0014021_2372_2719 | 115 |
| 314 | 3300046557 | Ga0495622_0037031 | Ga0495622_0037031_25_372 | 115 |
| 315 | 3300046674 | Ga0495588_0001209 | Ga0495588_0001209_8512_8859 | 115 |
| 316 | 3300046683 | Ga0495658_0000566 | Ga0495658_0000566_2015_2362 | 115 |
| 317 | 3300046689 | Ga0495613_0062081 | Ga0495613_0062081_2033_2380 | 115 |
| 318 | 3300047315 | Ga0495581_0003660 | Ga0495581_0003660_8217_8564 | 115 |
| 319 | 3300047321 | Ga0495676_0754553 | Ga0495676_0754553_27_374 | 115 |
| 320 | 3300047673 | Ga0495593_0000127 | Ga0495593_0000127_25676_26023 | 115 |
| 321 | 3300048089 | Ga0495614_0000162 | Ga0495614_0000162_13168_13515 | 115 |
| 322 | 3300048904 | Ga0496101_0111519 | Ga0496101_0111519_1009_1356 | 115 |
| 323 | 3300048905 | Ga0496102_0149556 | Ga0496102_0149556_992_1339 | 115 |
| 324 | 3300048906 | Ga0496103_0030997 | Ga0496103_0030997_475_822 | 115 |
| 325 | 3300048907 | Ga0496104_0113254 | Ga0496104_0113254_84_431 | 115 |
| 326 | 3300048909 | Ga0496106_0015424 | Ga0496106_0015424_3976_4323 | 115 |
| 327 | 3300048910 | Ga0496107_0148680 | Ga0496107_0148680_354_701 | 115 |
| 328 | 3300048917 | Ga0496114_0008930 | Ga0496114_0008930_2576_2923 | 115 |
| 329 | 3300048918 | Ga0496115_0026648 | Ga0496115_0026648_1923_2270 | 115 |
| 330 | 3300049823 | Ga0501044_1353957 | Ga0501044_1353957_40_387 | 115 |
| 331 | 3300050490 | nmdc:mga03n38_475328_c1 | nmdc:mga03n38_475328_c1_130_504 | 115 |
| 332 | 3300050493 | nmdc:mga0k408_373844_c1 | nmdc:mga0k408_373844_c1_142_516 | 115 |
| 333 | 3300050494 | nmdc:mga06z11_900713_c1 | nmdc:mga06z11_900713_c1_12_386 | 115 |
| 334 | 3300050508 | nmdc:mga09592_379490_c1 | nmdc:mga09592_379490_c1_188_541 | 115 |
| 335 | 3300050510 | nmdc:mga06r32_4911_c1 | nmdc:mga06r32_4911_c1_5491_5844 | 115 |
| 336 | 3300050512 | nmdc:mga0n895_132903_c1 | nmdc:mga0n895_132903_c1_565_912 | 115 |
| 337 | 3300050513 | nmdc:mga0rr50_1800895_c1 | nmdc:mga0rr50_1800895_c1_106_453 | 115 |
| 338 | 3300050513 | nmdc:mga0rr50_419315_c1 | nmdc:mga0rr50_419315_c1_615_962 | 115 |
| 339 | 3300050513 | nmdc:mga0rr50_549406_c1 | nmdc:mga0rr50_549406_c1_56_403 | 115 |
| 340 | 3300050514 | nmdc:mga08x19_340868_c1 | nmdc:mga08x19_340868_c1_566_913 | 115 |
| 341 | 3300003373 | JGI25407J50210_10012745 | JGI25407J50210_100127453 | 116 |
| 342 | 3300003911 | JGI25405J52794_10091079 | JGI25405J52794_100910792 | 116 |
| 343 | 3300005289 | Ga0065704_10426355 | Ga0065704_104263552 | 116 |
| 344 | 3300005295 | Ga0065707_10040831 | Ga0065707_100408312 | 116 |
| 345 | 3300005329 | Ga0070683_100001731 | Ga0070683_1000017317 | 116 |
| 346 | 3300005329 | Ga0070683_100010807 | Ga0070683_1000108075 | 116 |
| 347 | 3300005329 | Ga0070683_100056699 | Ga0070683_1000566994 | 116 |
| 348 | 3300005329 | Ga0070683_100196858 | Ga0070683_1001968584 | 116 |
| 349 | 3300005334 | Ga0068869_100206381 | Ga0068869_1002063812 | 116 |
| 350 | 3300005337 | Ga0070682_100614535 | Ga0070682_1006145351 | 116 |
| 351 | 3300005339 | Ga0070660_101381420 | Ga0070660_1013814201 | 116 |
| 352 | 3300005344 | Ga0070661_100231271 | Ga0070661_1002312712 | 116 |
| 353 | 3300005347 | Ga0070668_100531040 | Ga0070668_1005310402 | 116 |
| 354 | 3300005354 | Ga0070675_100222423 | Ga0070675_1002224231 | 116 |
| 355 | 3300005354 | Ga0070675_100919685 | Ga0070675_1009196851 | 116 |
| 356 | 3300005356 | Ga0070674_100266151 | Ga0070674_1002661512 | 116 |
| 357 | 3300005364 | Ga0070673_101947879 | Ga0070673_1019478792 | 116 |
| 358 | 3300005365 | Ga0070688_100341239 | Ga0070688_1003412391 | 116 |
| 359 | 3300005435 | Ga0070714_100090540 | Ga0070714_1000905405 | 116 |
| 360 | 3300005436 | Ga0070713_100753388 | Ga0070713_1007533882 | 116 |
| 361 | 3300005438 | Ga0070701_10165316 | Ga0070701_101653162 | 116 |
| 362 | 3300005439 | Ga0070711_100385699 | Ga0070711_1003856992 | 116 |
| 363 | 3300005440 | Ga0070705_100018221 | Ga0070705_1000182215 | 116 |
| 364 | 3300005441 | Ga0070700_100361694 | Ga0070700_1003616942 | 116 |
| 365 | 3300005444 | Ga0070694_100189979 | Ga0070694_1001899792 | 116 |
| 366 | 3300005466 | Ga0070685_10206539 | Ga0070685_102065392 | 116 |
| 367 | 3300005466 | Ga0070685_10225086 | Ga0070685_102250862 | 116 |
| 368 | 3300005467 | Ga0070706_100095094 | Ga0070706_1000950942 | 116 |
| 369 | 3300005467 | Ga0070706_100963564 | Ga0070706_1009635642 | 116 |
| 370 | 3300005467 | Ga0070706_101868879 | Ga0070706_1018688791 | 116 |
| 371 | 3300005468 | Ga0070707_100870743 | Ga0070707_1008707431 | 116 |
| 372 | 3300005471 | Ga0070698_100578560 | Ga0070698_1005785602 | 116 |
| 373 | 3300005518 | Ga0070699_100234079 | Ga0070699_1002340793 | 116 |
| 374 | 3300005530 | Ga0070679_100066217 | Ga0070679_1000662172 | 116 |
| 375 | 3300005535 | Ga0070684_100045914 | Ga0070684_1000459143 | 116 |
| 376 | 3300005535 | Ga0070684_100173863 | Ga0070684_1001738633 | 116 |
| 377 | 3300005535 | Ga0070684_100403570 | Ga0070684_1004035702 | 116 |
| 378 | 3300005535 | Ga0070684_100592299 | Ga0070684_1005922992 | 116 |
| 379 | 3300005535 | Ga0070684_100650492 | Ga0070684_1006504922 | 116 |
| 380 | 3300005536 | Ga0070697_100703215 | Ga0070697_1007032152 | 116 |
| 381 | 3300005543 | Ga0070672_100908339 | Ga0070672_1009083391 | 116 |
| 382 | 3300005544 | Ga0070686_100242369 | Ga0070686_1002423691 | 116 |
| 383 | 3300005545 | Ga0070695_100821930 | Ga0070695_1008219302 | 116 |
| 384 | 3300005546 | Ga0070696_100648892 | Ga0070696_1006488922 | 116 |
| 385 | 3300005549 | Ga0070704_100057156 | Ga0070704_1000571562 | 116 |
| 386 | 3300005549 | Ga0070704_100172980 | Ga0070704_1001729802 | 116 |
| 387 | 3300005549 | Ga0070704_100590488 | Ga0070704_1005904882 | 116 |
| 388 | 3300005563 | Ga0068855_100131564 | Ga0068855_1001315644 | 116 |
| 389 | 3300005563 | Ga0068855_102302015 | Ga0068855_1023020151 | 116 |
| 390 | 3300005564 | Ga0070664_100257045 | Ga0070664_1002570452 | 116 |
| 391 | 3300005564 | Ga0070664_100423729 | Ga0070664_1004237292 | 116 |
| 392 | 3300005564 | Ga0070664_101187397 | Ga0070664_1011873972 | 116 |
| 393 | 3300005564 | Ga0070664_101228521 | Ga0070664_1012285212 | 116 |
| 394 | 3300005577 | Ga0068857_100076372 | Ga0068857_1000763722 | 116 |
| 395 | 3300005614 | Ga0068856_100106706 | Ga0068856_1001067063 | 116 |
| 396 | 3300005616 | Ga0068852_100122754 | Ga0068852_1001227543 | 116 |
| 397 | 3300005617 | Ga0068859_100000004 | Ga0068859_10000000415 | 116 |
| 398 | 3300005617 | Ga0068859_100529217 | Ga0068859_1005292173 | 116 |
| 399 | 3300005617 | Ga0068859_100747940 | Ga0068859_1007479402 | 116 |
| 400 | 3300005617 | Ga0068859_101924276 | Ga0068859_1019242763 | 116 |
| 401 | 3300005618 | Ga0068864_100437074 | Ga0068864_1004370742 | 116 |
| 402 | 3300005841 | Ga0068863_101156751 | Ga0068863_1011567512 | 116 |
| 403 | 3300005842 | Ga0068858_100806268 | Ga0068858_1008062682 | 116 |
| 404 | 3300005844 | Ga0068862_101927688 | Ga0068862_1019276882 | 116 |
| 405 | 3300005937 | Ga0081455_10000045 | Ga0081455_1000004526 | 116 |
| 406 | 3300005937 | Ga0081455_10100019 | Ga0081455_101000194 | 116 |
| 407 | 3300005937 | Ga0081455_10117249 | Ga0081455_101172494 | 116 |
| 408 | 3300005981 | Ga0081538_10006629 | Ga0081538_100066294 | 116 |
| 409 | 3300005985 | Ga0081539_10235588 | Ga0081539_102355882 | 116 |
| 410 | 3300006038 | Ga0075365_10731836 | Ga0075365_107318362 | 116 |
| 411 | 3300006175 | Ga0070712_100634420 | Ga0070712_1006344202 | 116 |
| 412 | 3300006844 | Ga0075428_101373175 | Ga0075428_1013731752 | 116 |
| 413 | 3300006846 | Ga0075430_100263651 | Ga0075430_1002636512 | 116 |
| 414 | 3300006847 | Ga0075431_100618947 | Ga0075431_1006189472 | 116 |
| 415 | 3300006852 | Ga0075433_10948374 | Ga0075433_109483741 | 116 |
| 416 | 3300006871 | Ga0075434_101000206 | Ga0075434_1010002062 | 116 |
| 417 | 3300006931 | Ga0097620_100000004 | Ga0097620_10000000415 | 116 |
| 418 | 3300006931 | Ga0097620_100529214 | Ga0097620_1005292143 | 116 |
| 419 | 3300006931 | Ga0097620_100747940 | Ga0097620_1007479402 | 116 |
| 420 | 3300006931 | Ga0097620_101924134 | Ga0097620_1019241341 | 116 |
| 421 | 3300009093 | Ga0105240_10360328 | Ga0105240_103603283 | 116 |
| 422 | 3300009094 | Ga0111539_10068460 | Ga0111539_100684602 | 116 |
| 423 | 3300009147 | Ga0114129_10708488 | Ga0114129_107084882 | 116 |
| 424 | 3300009147 | Ga0114129_11037649 | Ga0114129_110376491 | 116 |
| 425 | 3300009148 | Ga0105243_11791159 | Ga0105243_117911591 | 116 |
| 426 | 3300009174 | Ga0105241_10774849 | Ga0105241_107748492 | 116 |
| 427 | 3300009545 | Ga0105237_10072449 | Ga0105237_100724494 | 116 |
| 428 | 3300009545 | Ga0105237_11112191 | Ga0105237_111121912 | 116 |
| 429 | 3300009553 | Ga0105249_10220678 | Ga0105249_102206782 | 116 |
| 430 | 3300009553 | Ga0105249_10821839 | Ga0105249_108218392 | 116 |
| 431 | 3300009553 | Ga0105249_12417995 | Ga0105249_124179952 | 116 |
| 432 | 3300010375 | Ga0105239_10832402 | Ga0105239_108324022 | 116 |
| 433 | 3300013104 | Ga0157370_10083213 | Ga0157370_100832134 | 116 |
| 434 | 3300013104 | Ga0157370_10308925 | Ga0157370_103089251 | 116 |
| 435 | 3300013105 | Ga0157369_10135324 | Ga0157369_101353242 | 116 |
| 436 | 3300013105 | Ga0157369_10269509 | Ga0157369_102695091 | 116 |
| 437 | 3300013297 | Ga0157378_10196435 | Ga0157378_101964351 | 116 |
| 438 | 3300013306 | Ga0163162_11834134 | Ga0163162_118341341 | 116 |
| 439 | 3300013307 | Ga0157372_10024153 | Ga0157372_100241535 | 116 |
| 440 | 3300014325 | Ga0163163_10323930 | Ga0163163_103239302 | 116 |
| 441 | 3300014325 | Ga0163163_11445615 | Ga0163163_114456152 | 116 |
| 442 | 3300015265 | Ga0182005_1129919 | Ga0182005_11299192 | 116 |
| 443 | 3300015265 | Ga0182005_1196356 | Ga0182005_11963562 | 116 |
| 444 | 3300021384 | Ga0213876_10016077 | Ga0213876_100160772 | 116 |
| 445 | 3300025906 | Ga0207699_10061349 | Ga0207699_100613493 | 116 |
| 446 | 3300025910 | Ga0207684_10080635 | Ga0207684_100806354 | 116 |
| 447 | 3300025910 | Ga0207684_11308668 | Ga0207684_113086681 | 116 |
| 448 | 3300025913 | Ga0207695_10002089 | Ga0207695_1000208919 | 116 |
| 449 | 3300025915 | Ga0207693_10174874 | Ga0207693_101748742 | 116 |
| 450 | 3300025916 | Ga0207663_10167030 | Ga0207663_101670302 | 116 |
| 451 | 3300025917 | Ga0207660_10309626 | Ga0207660_103096262 | 116 |
| 452 | 3300025918 | Ga0207662_10216580 | Ga0207662_102165803 | 116 |
| 453 | 3300025920 | Ga0207649_10217388 | Ga0207649_102173882 | 116 |
| 454 | 3300025922 | Ga0207646_11028764 | Ga0207646_110287642 | 116 |
| 455 | 3300025925 | Ga0207650_10938190 | Ga0207650_109381902 | 116 |
| 456 | 3300025926 | Ga0207659_10342297 | Ga0207659_103422972 | 116 |
| 457 | 3300025928 | Ga0207700_10033904 | Ga0207700_100339043 | 116 |
| 458 | 3300025928 | Ga0207700_10651300 | Ga0207700_106513002 | 116 |
| 459 | 3300025929 | Ga0207664_10144415 | Ga0207664_101444153 | 116 |
| 460 | 3300025935 | Ga0207709_10286862 | Ga0207709_102868622 | 116 |
| 461 | 3300025937 | Ga0207669_10579928 | Ga0207669_105799281 | 116 |
| 462 | 3300025939 | Ga0207665_10984652 | Ga0207665_109846521 | 116 |
| 463 | 3300025942 | Ga0207689_10426648 | Ga0207689_104266482 | 116 |
| 464 | 3300025944 | Ga0207661_10001479 | Ga0207661_1000147914 | 116 |
| 465 | 3300025944 | Ga0207661_10008372 | Ga0207661_100083726 | 116 |
| 466 | 3300025944 | Ga0207661_10082034 | Ga0207661_100820344 | 116 |
| 467 | 3300025944 | Ga0207661_10182374 | Ga0207661_101823741 | 116 |
| 468 | 3300025945 | Ga0207679_10581046 | Ga0207679_105810462 | 116 |
| 469 | 3300025945 | Ga0207679_10599550 | Ga0207679_105995502 | 116 |
| 470 | 3300025949 | Ga0207667_10180298 | Ga0207667_101802982 | 116 |
| 471 | 3300025972 | Ga0207668_10728229 | Ga0207668_107282292 | 116 |
| 472 | 3300026035 | Ga0207703_10745562 | Ga0207703_107455621 | 116 |
| 473 | 3300026067 | Ga0207678_11963051 | Ga0207678_119630511 | 116 |
| 474 | 3300026078 | Ga0207702_10074728 | Ga0207702_100747283 | 116 |
| 475 | 3300026095 | Ga0207676_10593250 | Ga0207676_105932502 | 116 |
| 476 | 3300026095 | Ga0207676_11130473 | Ga0207676_111304731 | 116 |
| 477 | 3300026095 | Ga0207676_11895039 | Ga0207676_118950391 | 116 |
| 478 | 3300026116 | Ga0207674_10025595 | Ga0207674_100255953 | 116 |
| 479 | 3300026142 | Ga0207698_10654206 | Ga0207698_106542061 | 116 |
| 480 | 3300028381 | Ga0268264_11067585 | Ga0268264_110675851 | 116 |
| 481 | 3300031824 | Ga0307413_10830441 | Ga0307413_108304411 | 116 |
| 482 | 3300031903 | Ga0307407_10348506 | Ga0307407_103485062 | 116 |
| 483 | 3300031995 | Ga0307409_100145312 | Ga0307409_1001453123 | 116 |
| 484 | 3300032002 | Ga0307416_102436488 | Ga0307416_1024364881 | 116 |
| 485 | 3300032002 | Ga0307416_103020368 | Ga0307416_1030203681 | 116 |
| 486 | 3300032005 | Ga0307411_10373197 | Ga0307411_103731972 | 116 |
| 487 | 3300032126 | Ga0307415_100029141 | Ga0307415_1000291413 | 116 |
| 488 | 3300035117 | Ga0373953_0082608 | Ga0373953_0082608_789_1145 | 116 |
| 489 | 3300035118 | Ga0373954_0027223 | Ga0373954_0027223_373_729 | 116 |
| 490 | 3300035119 | Ga0373956_0010386 | Ga0373956_0010386_1805_2161 | 116 |
| 491 | 3300035120 | Ga0373957_0003979 | Ga0373957_0003979_1518_1874 | 116 |
| 492 | 3300035172 | Ga0373955_0002853 | Ga0373955_0002853_6045_6401 | 116 |
| 493 | 3300035241 | Ga0373961_0034696 | Ga0373961_0034696_372_722 | 116 |
| 494 | 3300035242 | Ga0373962_0384566 | Ga0373962_0384566_126_476 | 116 |
| 495 | 3300035410 | Ga0373924_0112240 | Ga0373924_0112240_699_1055 | 116 |
| 496 | 3300035692 | Ga0373935_0159033 | Ga0373935_0159033_1166_1516 | 116 |
| 497 | 3300035724 | Ga0373933_0005266 | Ga0373933_0005266_2655_3011 | 116 |
| 498 | 3300036401 | Ga0373937_0000944 | Ga0373937_0000944_17663_18019 | 116 |
| 499 | 3300037418 | Ga0395900_0002748 | Ga0395900_0002748_244_609 | 116 |
| 500 | 3300037418 | Ga0395900_0116961 | Ga0395900_0116961_990_1349 | 116 |
| 501 | 3300037418 | Ga0395900_0832653 | Ga0395900_0832653_27_386 | 116 |
| 502 | 3300037466 | Ga0395898_0039888 | Ga0395898_0039888_2895_3260 | 116 |
| 503 | 3300037471 | Ga0395905_0118178 | Ga0395905_0118178_697_1062 | 116 |
| 504 | 3300038443 | Ga0395901_0016295 | Ga0395901_0016295_6986_7351 | 116 |
| 505 | 3300038443 | Ga0395901_0544530 | Ga0395901_0544530_196_546 | 116 |
| 506 | 3300038698 | Ga0242419_001701 | Ga0242419_001701_48_398 | 116 |
| 507 | 3300039437 | Ga0436365_0866291 | Ga0436365_0866291_2095_2445 | 116 |
| 508 | 3300041512 | Ga0451853_2067756 | Ga0451853_2067756_182_532 | 116 |
| 509 | 3300044656 | Ga0466969_0308943 | Ga0466969_0308943_86_436 | 116 |
| 510 | 3300044684 | Ga0466966_0158704 | Ga0466966_0158704_367_717 | 116 |
| 511 | 3300044693 | Ga0466961_0072836 | Ga0466961_0072836_1537_1887 | 116 |
| 512 | 3300045049 | Ga0466959_0005273 | Ga0466959_0005273_3447_3797 | 116 |
| 513 | 3300045836 | Ga0466958_0947022 | Ga0466958_0947022_12_365 | 116 |
| 514 | 3300045976 | Ga0466967_0094629 | Ga0466967_0094629_1324_1674 | 116 |
| 515 | 3300046455 | Ga0495603_0069822 | Ga0495603_0069822_1684_2034 | 116 |
| 516 | 3300046463 | Ga0495653_0647995 | Ga0495653_0647995_135_491 | 116 |
| 517 | 3300046516 | Ga0495628_0056843 | Ga0495628_0056843_2617_2973 | 116 |
| 518 | 3300046529 | Ga0495652_0026063 | Ga0495652_0026063_3245_3601 | 116 |
| 519 | 3300046535 | Ga0495586_0244490 | Ga0495586_0244490_333_689 | 116 |
| 520 | 3300046536 | Ga0495587_0009238 | Ga0495587_0009238_1519_1875 | 116 |
| 521 | 3300046543 | Ga0495645_0000922 | Ga0495645_0000922_2501_2857 | 116 |
| 522 | 3300046559 | Ga0495667_0002386 | Ga0495667_0002386_8778_9134 | 116 |
| 523 | 3300046675 | Ga0495657_0147830 | Ga0495657_0147830_565_921 | 116 |
| 524 | 3300046678 | Ga0495599_0028472 | Ga0495599_0028472_1457_1813 | 116 |
| 525 | 3300046679 | Ga0495623_0001707 | Ga0495623_0001707_6570_6926 | 116 |
| 526 | 3300046681 | Ga0495647_0130603 | Ga0495647_0130603_610_960 | 116 |
| 527 | 3300046809 | Ga0495600_0016309 | Ga0495600_0016309_1774_2130 | 116 |
| 528 | 3300047317 | Ga0495604_0143162 | Ga0495604_0143162_180_536 | 116 |
| 529 | 3300047321 | Ga0495676_0306392 | Ga0495676_0306392_666_1016 | 116 |
| 530 | 3300047444 | Ga0495675_0006776 | Ga0495675_0006776_1185_1541 | 116 |
| 531 | 3300047471 | Ga0495684_0286361 | Ga0495684_0286361_545_901 | 116 |
| 532 | 3300048905 | Ga0496102_0106506 | Ga0496102_0106506_121_471 | 116 |
| 533 | 3300048906 | Ga0496103_0596920 | Ga0496103_0596920_280_630 | 116 |
| 534 | 3300048907 | Ga0496104_1689478 | Ga0496104_1689478_113_463 | 116 |
| 535 | 3300048909 | Ga0496106_0390824 | Ga0496106_0390824_115_465 | 116 |
| 536 | 3300048912 | Ga0496109_0000476 | Ga0496109_0000476_29774_30127 | 116 |
| 537 | 3300049742 | Ga0501080_0860397 | Ga0501080_0860397_346_699 | 116 |
| 538 | 3300049822 | Ga0501035_0227929 | Ga0501035_0227929_364_747 | 116 |
| 539 | 3300049824 | Ga0501045_0893114 | Ga0501045_0893114_207_560 | 116 |
| 540 | 3300050492 | nmdc:mga0yw44_14658_c1 | nmdc:mga0yw44_14658_c1_3700_4062 | 116 |
| 541 | 3300050509 | nmdc:mga0qj67_145670_c1 | nmdc:mga0qj67_145670_c1_349_708 | 116 |
| 542 | 3300050509 | nmdc:mga0qj67_259587_c1 | nmdc:mga0qj67_259587_c1_487_840 | 116 |
| 543 | 3300050511 | nmdc:mga08y16_344281_c1 | nmdc:mga08y16_344281_c1_1113_1463 | 116 |
| 544 | 3300050513 | nmdc:mga0rr50_1204439_c1 | nmdc:mga0rr50_1204439_c1_193_585 | 116 |
| 545 | 3300050515 | nmdc:mga0a205_867855_c1 | nmdc:mga0a205_867855_c1_385_735 | 116 |
| 546 | 3300053077 | Ga0495601_0451528 | Ga0495601_0451528_153_509 | 116 |
| 547 | 3300053084 | Ga0495595_0070250 | Ga0495595_0070250_25_381 | 116 |
| 548 | 3300053085 | Ga0495619_0382653 | Ga0495619_0382653_267_623 | 116 |
| 549 | 3300060353 | Ga0501082_0170888 | Ga0501082_0170888_27_380 | 116 |
| 550 | iso_pu_bacteria | 2515154129 | 2515719209 | 116 |
| 551 | iso_pu_bacteria | 2515154202 | 2516086278 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p6f-assembly2.cif.gz_CCC-2 | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9288 | 3 | 89 |
| 3f6o-assembly1.cif.gz_A | crystal structure of arsr family transcriptional regulator, rha00566 | 0.928 | 5 | 92 |
| 3f6o-assembly1.cif.gz_B | crystal structure of arsr family transcriptional regulator, rha00566 | 0.9257 | 4 | 92 |
| 3f6v-assembly1.cif.gz_A-2 | crystal structure of possible transcriptional regulator for arsenical resistance | 0.9158 | 9 | 87 |
| 6j0e-assembly1.cif.gz_A | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.911 | 10 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vxzA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9374 | 17 | 72 | 1.10.10.10 |
| af_Q5NE14_88_145_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.931 | 17 | 72 | 1.10.10.10 |
| 3f6oB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9257 | 4 | 92 | 1.10.10.10 |
| af_I6Y1A7_25_116_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9189 | 5 | 82 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9178 | 15 | 71 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9G072-F1-model_v4 | Transcriptional regulator | 0.9878 | 1 | 73 |
GO:0003700
|
| AF-A0A350UIW9-F1-model_v4 | Transcriptional regulator | 0.9871 | 5 | 88 |
GO:0003700
|
| AF-A0A7W0YP81-F1-model_v4 | Winged helix-turn-helix transcriptional regulator | 0.9818 | 5 | 89 |
GO:0003700
|
| AF-A0A2W5VFY7-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9803 | 5 | 83 |
GO:0003700
|
| AF-H1S4V4-F1-model_v4 | ArsR family transcriptional regulator | 0.9801 | 3 | 84 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar