F462675

General Info

Members Datasets Scaffolds Average Seq Length
551 314 546 116

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154202|2516086278
Length 127
Sequence GYALDEPGRLDATFAALADPTRRAILARLAQGDATVKEIAAPFPVSQPAISRHLKVLEGAGLISRGRVAQRRPCHLEGRQLRLVVDWLENYRGYWAEAFGRLDELLDELQAGDDVRQSSGGREGHGT

Samples

Sample ID Description Type Environment
1 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
2 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
3 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
4 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
5 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
213 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
258 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
291 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
292 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
293 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
297 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
308 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
309 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
310 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
314 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.72
Nodule 0
Rhizoplane 2.9
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10012745 3300003373 Bacteria 2155
2 JGI25405J52794_10091079 3300003911 Bacteria 675
3 Ga0065704_10426355 3300005289 Bacteria 727
4 Ga0065707_10040831 3300005295 Bacteria 1026
5 Ga0070658_11265579 3300005327 Bacteria 641
6 Ga0070683_100001731 3300005329 Bacteria 16985
7 Ga0070683_100010807 3300005329 Bacteria 7856
8 Ga0070683_100043908 3300005329 Bacteria 4120
9 Ga0070683_100056699 3300005329 Bacteria 3638
10 Ga0070683_100196858 3300005329 Bacteria 1914
11 Ga0070690_100314310 3300005330 Bacteria 1127
12 Ga0070677_10198919 3300005333 Bacteria 966
13 Ga0068869_100206381 3300005334 Bacteria 1552
14 Ga0068869_100369276 3300005334 Unclassified 1174
15 Ga0070680_100032107 3300005336 Bacteria 4224
16 Ga0070680_100053923 3300005336 Bacteria 3282
17 Ga0070680_100370845 3300005336 Bacteria 1218
18 Ga0070682_100411639 3300005337 Bacteria 1025
19 Ga0070682_100614535 3300005337 Bacteria 860
20 Ga0070660_101381420 3300005339 Bacteria 598
21 Ga0070660_101794878 3300005339 Bacteria 522
22 Ga0070660_101878942 3300005339 Bacteria 510
23 Ga0070687_100647769 3300005343 Bacteria 732
24 Ga0070661_100231271 3300005344 Bacteria 1421
25 Ga0070692_10424222 3300005345 Bacteria 845
26 Ga0070668_100531040 3300005347 Bacteria 1022
27 Ga0070669_101007972 3300005353 Bacteria 715
28 Ga0070675_100101865 3300005354 Unclassified 2419
29 Ga0070675_100222423 3300005354 Bacteria 1644
30 Ga0070675_100509761 3300005354 Bacteria 1085
31 Ga0070675_100919685 3300005354 Bacteria 802
32 Ga0070671_100453224 3300005355 Bacteria 1101
33 Ga0070674_100266151 3300005356 Bacteria 1353
34 Ga0070674_100649593 3300005356 Bacteria 896
35 Ga0070673_100271857 3300005364 Bacteria 1484
36 Ga0070673_101947879 3300005364 Bacteria 557
37 Ga0070688_100022487 3300005365 Bacteria 3696
38 Ga0070688_100341239 3300005365 Bacteria 1094
39 Ga0070659_100366053 3300005366 Bacteria 1212
40 Ga0070667_100037627 3300005367 Bacteria 4057
41 Ga0070709_11012827 3300005434 Bacteria 661
42 Ga0070714_100027701 3300005435 Bacteria 4695
43 Ga0070714_100090540 3300005435 Bacteria 2679
44 Ga0070714_101215031 3300005435 Bacteria 735
45 Ga0070713_100000219 3300005436 Bacteria 38014
46 Ga0070713_100020793 3300005436 Bacteria 5038
47 Ga0070713_100028455 3300005436 Bacteria 4413
48 Ga0070713_100210306 3300005436 Bacteria 1761
49 Ga0070713_100753388 3300005436 Unclassified 932
50 Ga0070710_10387228 3300005437 Unclassified 934
51 Ga0070701_10165316 3300005438 Unclassified 1285
52 Ga0070701_10473183 3300005438 Bacteria 808
53 Ga0070711_100031442 3300005439 Bacteria 3524
54 Ga0070711_100385699 3300005439 Unclassified 1134
55 Ga0070711_100494924 3300005439 Unclassified 1007
56 Ga0070705_100018221 3300005440 Bacteria 3677
57 Ga0070705_100062181 3300005440 Bacteria 2222
58 Ga0070700_100361694 3300005441 Bacteria 1079
59 Ga0070700_100813023 3300005441 Bacteria 754
60 Ga0070694_100189979 3300005444 Bacteria 1525
61 Ga0070663_100584190 3300005455 Bacteria 938
62 Ga0070663_101429024 3300005455 Bacteria 613
63 Ga0070678_100001493 3300005456 Bacteria 12499
64 Ga0070678_100832474 3300005456 Bacteria 840
65 Ga0070662_101129824 3300005457 Bacteria 673
66 Ga0070662_101180322 3300005457 Bacteria 658
67 Ga0070681_10002467 3300005458 Bacteria 16942
68 Ga0070681_10117873 3300005458 Bacteria 2591
69 Ga0068867_100236054 3300005459 Bacteria 1480
70 Ga0068867_100284606 3300005459 Bacteria 1357
71 Ga0070685_10089724 3300005466 Unclassified 1858
72 Ga0070685_10206539 3300005466 Unclassified 1280
73 Ga0070685_10225086 3300005466 Unclassified 1231
74 Ga0070685_10766245 3300005466 Bacteria 709
75 Ga0070706_100095094 3300005467 Bacteria 2765
76 Ga0070706_100963564 3300005467 Bacteria 787
77 Ga0070706_101868879 3300005467 Unclassified 545
78 Ga0070707_100870743 3300005468 Bacteria 865
79 Ga0070698_100578560 3300005471 Bacteria 1063
80 Ga0070699_100234079 3300005518 Unclassified 1638
81 Ga0070699_101318179 3300005518 Bacteria 662
82 Ga0070679_100001208 3300005530 Bacteria 22740
83 Ga0070679_100066217 3300005530 Bacteria 3601
84 Ga0070679_100391964 3300005530 Bacteria 1335
85 Ga0070684_100045914 3300005535 Bacteria 3784
86 Ga0070684_100173863 3300005535 Bacteria 1957
87 Ga0070684_100182336 3300005535 Bacteria 1909
88 Ga0070684_100323835 3300005535 Bacteria 1416
89 Ga0070684_100403570 3300005535 Unclassified 1260
90 Ga0070684_100591267 3300005535 Bacteria 1031
91 Ga0070684_100592299 3300005535 Bacteria 1031
92 Ga0070684_100650492 3300005535 Bacteria 981
93 Ga0070697_100703215 3300005536 Unclassified 892
94 Ga0070672_100407074 3300005543 Bacteria 1167
95 Ga0070672_100908339 3300005543 Bacteria 778
96 Ga0070686_100242369 3300005544 Bacteria 1313
97 Ga0070686_100478108 3300005544 Bacteria 963
98 Ga0070695_100821930 3300005545 Bacteria 746
99 Ga0070696_100648892 3300005546 Bacteria 855
100 Ga0070693_100010836 3300005547 Bacteria 4576
101 Ga0070693_100233386 3300005547 Bacteria 1212
102 Ga0070693_100464661 3300005547 Bacteria 891
103 Ga0070665_100446443 3300005548 Bacteria 1303
104 Ga0070704_100057156 3300005549 Bacteria 2773
105 Ga0070704_100119118 3300005549 Bacteria 2024
106 Ga0070704_100172980 3300005549 Bacteria 1719
107 Ga0070704_100590488 3300005549 Bacteria 975
108 Ga0068855_100131564 3300005563 Bacteria 2857
109 Ga0068855_100435511 3300005563 Bacteria 1432
110 Ga0068855_102132200 3300005563 Bacteria 564
111 Ga0068855_102302015 3300005563 Bacteria 539
112 Ga0070664_100129718 3300005564 Bacteria 2214
113 Ga0070664_100257045 3300005564 Bacteria 1571
114 Ga0070664_100423729 3300005564 Bacteria 1219
115 Ga0070664_101056004 3300005564 Bacteria 764
116 Ga0070664_101187397 3300005564 Unclassified 720
117 Ga0070664_101228521 3300005564 Bacteria 707
118 Ga0068857_100076372 3300005577 Bacteria 2987
119 Ga0068854_100822179 3300005578 Bacteria 811
120 Ga0068856_100106706 3300005614 Bacteria 2796
121 Ga0068856_100223689 3300005614 Bacteria 1897
122 Ga0070702_100000533 3300005615 Bacteria 13731
123 Ga0070702_100704141 3300005615 Bacteria 770
124 Ga0068852_100122754 3300005616 Unclassified 2381
125 Ga0068859_100000004 3300005617 Bacteria 470249
126 Ga0068859_100120967 3300005617 Bacteria 2684
127 Ga0068859_100529217 3300005617 Bacteria 1273
128 Ga0068859_100747940 3300005617 Unclassified 1067
129 Ga0068859_101147802 3300005617 Bacteria 855
130 Ga0068859_101924276 3300005617 Bacteria 653
131 Ga0068864_100437074 3300005618 Bacteria 1249
132 Ga0068864_101220038 3300005618 Bacteria 751
133 Ga0068866_10012152 3300005718 Bacteria 3748
134 Ga0068866_10033981 3300005718 Bacteria 2480
135 Ga0068866_11127837 3300005718 Bacteria 563
136 Ga0068861_101444378 3300005719 Bacteria 673
137 Ga0068870_10835118 3300005840 Bacteria 646
138 Ga0068863_100678653 3300005841 Bacteria 1023
139 Ga0068863_101156751 3300005841 Bacteria 779
140 Ga0068858_100088267 3300005842 Bacteria 2885
141 Ga0068858_100806268 3300005842 Bacteria 916
142 Ga0068860_100073596 3300005843 Bacteria 3248
143 Ga0068862_100026756 3300005844 Bacteria 4850
144 Ga0068862_100270241 3300005844 Bacteria 1554
145 Ga0068862_101927688 3300005844 Bacteria 601
146 Ga0081455_10000045 3300005937 Bacteria 128603
147 Ga0081455_10001225 3300005937 Bacteria 32099
148 Ga0081455_10073987 3300005937 Bacteria 2815
149 Ga0081455_10081019 3300005937 Bacteria 2660
150 Ga0081455_10100019 3300005937 Bacteria 2331
151 Ga0081455_10117249 3300005937 Bacteria 2104
152 Ga0081538_10006629 3300005981 Bacteria 10150
153 Ga0081540_1057637 3300005983 Bacteria 1877
154 Ga0081539_10235588 3300005985 Bacteria 823
155 Ga0070717_10003026 3300006028 Bacteria 11975
156 Ga0070717_10141943 3300006028 Bacteria 2072
157 Ga0070717_11870182 3300006028 Unclassified 542
158 Ga0075365_10731836 3300006038 Bacteria 699
159 Ga0070712_100011885 3300006175 Bacteria 5532
160 Ga0070712_100222335 3300006175 Bacteria 1495
161 Ga0070712_100634420 3300006175 Bacteria 907
162 Ga0075366_10656302 3300006195 Bacteria 651
163 Ga0097621_101227557 3300006237 Bacteria 707
164 Ga0068871_100009075 3300006358 Bacteria 7184
165 Ga0068871_100670438 3300006358 Bacteria 948
166 Ga0075428_101373175 3300006844 Bacteria 742
167 Ga0075430_100263651 3300006846 Bacteria 1427
168 Ga0075431_100006065 3300006847 Bacteria 11982
169 Ga0075431_100618947 3300006847 Bacteria 1065
170 Ga0075433_10948374 3300006852 Bacteria 750
171 Ga0075434_101000206 3300006871 Bacteria 850
172 Ga0075429_100272969 3300006880 Bacteria 1481
173 Ga0068865_100165181 3300006881 Bacteria 1692
174 Ga0068865_100693278 3300006881 Unclassified 870
175 Ga0068865_100785660 3300006881 Bacteria 820
176 Ga0068865_101456158 3300006881 Bacteria 613
177 Ga0075436_100182293 3300006914 Bacteria 1484
178 Ga0097620_100000004 3300006931 Bacteria 470249
179 Ga0097620_100120972 3300006931 Bacteria 2684
180 Ga0097620_100529214 3300006931 Bacteria 1273
181 Ga0097620_100747940 3300006931 Unclassified 1067
182 Ga0097620_101147679 3300006931 Bacteria 855
183 Ga0097620_101924134 3300006931 Bacteria 653
184 Ga0075435_100312736 3300007076 Bacteria 1344
185 Ga0075435_100746826 3300007076 Bacteria 851
186 Ga0105240_10082732 3300009093 Bacteria 3941
187 Ga0105240_10360328 3300009093 Bacteria 1647
188 Ga0111539_10068460 3300009094 Bacteria 4191
189 Ga0105245_10137089 3300009098 Bacteria 2301
190 Ga0105245_10270961 3300009098 Bacteria 1656
191 Ga0105245_10607042 3300009098 Bacteria 1121
192 Ga0105245_12411142 3300009098 Bacteria 580
193 Ga0105247_10103594 3300009101 Bacteria 1822
194 Ga0114129_10708488 3300009147 Bacteria 1293
195 Ga0114129_11037649 3300009147 Bacteria 1030
196 Ga0114129_11908741 3300009147 Bacteria 720
197 Ga0105243_10049264 3300009148 Bacteria 3323
198 Ga0105243_10311946 3300009148 Unclassified 1430
199 Ga0105243_11791159 3300009148 Bacteria 645
200 Ga0105243_12970934 3300009148 Bacteria 514
201 Ga0105241_10050728 3300009174 Bacteria 3163
202 Ga0105241_10258338 3300009174 Unclassified 1480
203 Ga0105241_10684773 3300009174 Bacteria 934
204 Ga0105241_10774849 3300009174 Bacteria 881
205 Ga0105242_10025480 3300009176 Bacteria 4682
206 Ga0105242_10068582 3300009176 Bacteria 2935
207 Ga0105242_10310553 3300009176 Bacteria 1442
208 Ga0105248_10082363 3300009177 Bacteria 3618
209 Ga0105248_10150763 3300009177 Bacteria 2623
210 Ga0105237_10072449 3300009545 Bacteria 3438
211 Ga0105237_11112191 3300009545 Bacteria 797
212 Ga0105237_12776148 3300009545 Bacteria 501
213 Ga0105238_10334639 3300009551 Bacteria 1501
214 Ga0105249_10220678 3300009553 Bacteria 1865
215 Ga0105249_10821839 3300009553 Bacteria 994
216 Ga0105249_11070861 3300009553 Bacteria 876
217 Ga0105249_12417995 3300009553 Bacteria 598
218 Ga0105239_10180195 3300010375 Bacteria 2364
219 Ga0105239_10183550 3300010375 Bacteria 2341
220 Ga0105239_10832402 3300010375 Bacteria 1058
221 Ga0105239_13037038 3300010375 Bacteria 547
222 Ga0105246_10106759 3300011119 Bacteria 2049
223 Ga0157370_10083213 3300013104 Bacteria 3009
224 Ga0157370_10308925 3300013104 Bacteria 1459
225 Ga0157369_10135324 3300013105 Bacteria 2609
226 Ga0157369_10269509 3300013105 Bacteria 1774
227 Ga0157374_11027442 3300013296 Bacteria 844
228 Ga0157378_10007611 3300013297 Bacteria 9454
229 Ga0157378_10196435 3300013297 Bacteria 1906
230 Ga0157378_10244355 3300013297 Bacteria 1716
231 Ga0157378_11570310 3300013297 Bacteria 703
232 Ga0163162_11157771 3300013306 Bacteria 877
233 Ga0163162_11809085 3300013306 Bacteria 698
234 Ga0163162_11834134 3300013306 Bacteria 694
235 Ga0163162_12151268 3300013306 Bacteria 640
236 Ga0157372_10024153 3300013307 Bacteria 6597
237 Ga0157375_10184299 3300013308 Bacteria 2240
238 Ga0157375_10637572 3300013308 Bacteria 1222
239 Ga0157375_10652362 3300013308 Bacteria 1209
240 Ga0157375_10894633 3300013308 Bacteria 1032
241 Ga0157375_10963019 3300013308 Bacteria 995
242 Ga0163163_10323930 3300014325 Bacteria 1595
243 Ga0163163_11445615 3300014325 Bacteria 749
244 Ga0163163_11991918 3300014325 Bacteria 641
245 Ga0157377_10084608 3300014745 Bacteria 1861
246 Ga0157377_10184742 3300014745 Bacteria 1314
247 Ga0157379_10061108 3300014968 Bacteria 3369
248 Ga0157379_11226226 3300014968 Bacteria 722
249 Ga0157376_10077699 3300014969 Bacteria 2840
250 Ga0157376_10371469 3300014969 Bacteria 1375
251 Ga0157376_10610376 3300014969 Bacteria 1087
252 Ga0182005_1129919 3300015265 Bacteria 722
253 Ga0182005_1196356 3300015265 Unclassified 605
254 Ga0163161_10824816 3300017792 Bacteria 781
255 Ga0163161_11583066 3300017792 Bacteria 577
256 Ga0213876_10016077 3300021384 Bacteria 3958
257 Ga0213876_10121302 3300021384 Bacteria 1388
258 Ga0207697_10287869 3300025315 Bacteria 728
259 Ga0207692_10100950 3300025898 Bacteria 1584
260 Ga0207692_10451875 3300025898 Bacteria 809
261 Ga0207642_10075972 3300025899 Bacteria 1615
262 Ga0207642_10129956 3300025899 Bacteria 1313
263 Ga0207680_10157605 3300025903 Bacteria 1519
264 Ga0207699_10017017 3300025906 Bacteria 3816
265 Ga0207699_10061349 3300025906 Unclassified 2262
266 Ga0207699_10862092 3300025906 Bacteria 667
267 Ga0207645_10045363 3300025907 Bacteria 2810
268 Ga0207705_10000407 3300025909 Bacteria 37762
269 Ga0207684_10080635 3300025910 Bacteria 2769
270 Ga0207684_11308668 3300025910 Unclassified 596
271 Ga0207654_10150567 3300025911 Bacteria 1493
272 Ga0207707_10001284 3300025912 Bacteria 23421
273 Ga0207707_10071867 3300025912 Bacteria 3015
274 Ga0207707_10728918 3300025912 Bacteria 830
275 Ga0207695_10002089 3300025913 Bacteria 30401
276 Ga0207695_10848594 3300025913 Bacteria 793
277 Ga0207693_10019292 3300025915 Bacteria 5426
278 Ga0207693_10174874 3300025915 Bacteria 1690
279 Ga0207663_10154127 3300025916 Bacteria 1615
280 Ga0207663_10167030 3300025916 Unclassified 1559
281 Ga0207663_10527985 3300025916 Bacteria 920
282 Ga0207660_10022758 3300025917 Bacteria 4224
283 Ga0207660_10309626 3300025917 Bacteria 1259
284 Ga0207660_10457328 3300025917 Bacteria 1033
285 Ga0207662_10023902 3300025918 Bacteria 3514
286 Ga0207662_10216580 3300025918 Bacteria 1245
287 Ga0207657_10313067 3300025919 Bacteria 1242
288 Ga0207649_10217388 3300025920 Bacteria 1359
289 Ga0207652_10000678 3300025921 Bacteria 33275
290 Ga0207652_10189071 3300025921 Bacteria 1852
291 Ga0207652_10764553 3300025921 Bacteria 859
292 Ga0207646_11028764 3300025922 Bacteria 727
293 Ga0207681_11240492 3300025923 Bacteria 626
294 Ga0207650_10938190 3300025925 Unclassified 735
295 Ga0207659_10342297 3300025926 Unclassified 1239
296 Ga0207659_10375050 3300025926 Bacteria 1185
297 Ga0207687_10042207 3300025927 Bacteria 3136
298 Ga0207687_10330797 3300025927 Bacteria 1236
299 Ga0207687_10582299 3300025927 Unclassified 942
300 Ga0207700_10000651 3300025928 Bacteria 20300
301 Ga0207700_10033904 3300025928 Bacteria 3658
302 Ga0207700_10049844 3300025928 Bacteria 3117
303 Ga0207700_10604025 3300025928 Bacteria 976
304 Ga0207700_10651300 3300025928 Unclassified 939
305 Ga0207664_10089661 3300025929 Bacteria 2519
306 Ga0207664_10144415 3300025929 Bacteria 2016
307 Ga0207664_10654531 3300025929 Bacteria 944
308 Ga0207690_10115909 3300025932 Bacteria 1937
309 Ga0207706_10316801 3300025933 Bacteria 1358
310 Ga0207686_10047917 3300025934 Bacteria 2644
311 Ga0207686_10051012 3300025934 Bacteria 2575
312 Ga0207686_10332454 3300025934 Bacteria 1139
313 Ga0207686_10705828 3300025934 Bacteria 802
314 Ga0207709_10167645 3300025935 Bacteria 1538
315 Ga0207709_10286862 3300025935 Bacteria 1218
316 Ga0207709_10360238 3300025935 Bacteria 1101
317 Ga0207709_10660088 3300025935 Bacteria 833
318 Ga0207670_10020693 3300025936 Bacteria 4047
319 Ga0207669_10460234 3300025937 Bacteria 1010
320 Ga0207669_10576531 3300025937 Bacteria 911
321 Ga0207669_10579928 3300025937 Bacteria 909
322 Ga0207704_11459344 3300025938 Bacteria 587
323 Ga0207704_11574655 3300025938 Bacteria 564
324 Ga0207665_10984652 3300025939 Unclassified 670
325 Ga0207691_10158456 3300025940 Bacteria 1987
326 Ga0207711_10435694 3300025941 Bacteria 1220
327 Ga0207689_10096208 3300025942 Bacteria 2432
328 Ga0207689_10426648 3300025942 Bacteria 1107
329 Ga0207661_10001479 3300025944 Bacteria 15896
330 Ga0207661_10008372 3300025944 Bacteria 7387
331 Ga0207661_10082034 3300025944 Bacteria 2665
332 Ga0207661_10182374 3300025944 Bacteria 1835
333 Ga0207679_10214911 3300025945 Bacteria 1615
334 Ga0207679_10581046 3300025945 Bacteria 1008
335 Ga0207679_10599550 3300025945 Bacteria 992
336 Ga0207667_10180298 3300025949 Bacteria 2169
337 Ga0207667_10546578 3300025949 Bacteria 1172
338 Ga0207667_10681584 3300025949 Bacteria 1031
339 Ga0207651_10030459 3300025960 Bacteria 3436
340 Ga0207651_11784058 3300025960 Bacteria 554
341 Ga0207668_10109711 3300025972 Bacteria 2068
342 Ga0207668_10728229 3300025972 Bacteria 874
343 Ga0207640_12060093 3300025981 Bacteria 517
344 Ga0207658_10221273 3300025986 Bacteria 1593
345 Ga0207703_10745562 3300026035 Bacteria 933
346 Ga0207703_11279563 3300026035 Bacteria 705
347 Ga0207639_11096959 3300026041 Bacteria 746
348 Ga0207678_10050249 3300026067 Bacteria 3603
349 Ga0207678_11963051 3300026067 Bacteria 510
350 Ga0207702_10074728 3300026078 Unclassified 2926
351 Ga0207702_11289715 3300026078 Bacteria 724
352 Ga0207648_10074436 3300026089 Bacteria 2959
353 Ga0207648_10253604 3300026089 Bacteria 1569
354 Ga0207676_10593250 3300026095 Bacteria 1063
355 Ga0207676_11130473 3300026095 Bacteria 775
356 Ga0207676_11895039 3300026095 Unclassified 595
357 Ga0207674_10025595 3300026116 Bacteria 6287
358 Ga0207683_10000047 3300026121 Bacteria 89190
359 Ga0207683_11098641 3300026121 Bacteria 738
360 Ga0207698_10654206 3300026142 Unclassified 1041
361 Ga0207698_11217435 3300026142 Bacteria 767
362 Ga0268266_10414999 3300028379 Bacteria 1275
363 Ga0268266_10431804 3300028379 Bacteria 1250
364 Ga0268265_10067781 3300028380 Bacteria 2764
365 Ga0268264_10443534 3300028381 Bacteria 1256
366 Ga0268264_11067585 3300028381 Bacteria 815
367 Ga0268264_11347047 3300028381 Bacteria 724
368 Ga0307408_100879472 3300031548 Bacteria 819
369 Ga0265313_10120314 3300031595 Bacteria 1146
370 Ga0307413_10830441 3300031824 Bacteria 779
371 Ga0307406_10260190 3300031901 Bacteria 1312
372 Ga0307407_10348506 3300031903 Bacteria 1048
373 Ga0307409_100145312 3300031995 Bacteria 2050
374 Ga0307409_100347579 3300031995 Bacteria 1398
375 Ga0307416_100778662 3300032002 Bacteria 1051
376 Ga0307416_102436488 3300032002 Bacteria 622
377 Ga0307416_103020368 3300032002 Bacteria 563
378 Ga0307411_10373197 3300032005 Bacteria 1171
379 Ga0307415_100029141 3300032126 Bacteria 3524
380 Ga0307415_101201040 3300032126 Bacteria 715
381 Ga0373926_0018857 3300035083 Unclassified 2376
382 Ga0373936_0174471 3300035113 Unclassified 941
383 Ga0373953_0082608 3300035117 Bacteria 1337
384 Ga0373954_0027223 3300035118 Bacteria 2623
385 Ga0373956_0010386 3300035119 Bacteria 3816
386 Ga0373957_0003979 3300035120 Bacteria 4444
387 Ga0373943_0006364 3300035170 Bacteria 5306
388 Ga0373955_0002853 3300035172 Bacteria 7589
389 Ga0373961_0034696 3300035241 Bacteria 1428
390 Ga0373962_0384566 3300035242 Bacteria 513
391 Ga0373924_0112240 3300035410 Bacteria 1179
392 Ga0373935_0159033 3300035692 Bacteria 1539
393 Ga0373927_0006883 3300035695 Bacteria 7726
394 Ga0373933_0005266 3300035724 Bacteria 7050
395 Ga0373947_0071235 3300035725 Bacteria 2131
396 Ga0373937_0000944 3300036401 Bacteria 24720
397 Ga0373925_0070547 3300037068 Unclassified 2641
398 Ga0395900_0002748 3300037418 Bacteria 19211
399 Ga0395900_0116961 3300037418 Bacteria 2736
400 Ga0395900_0832653 3300037418 Bacteria 849
401 Ga0395900_1618718 3300037418 Unclassified 559
402 Ga0395898_0039888 3300037466 Bacteria 4646
403 Ga0395898_0717188 3300037466 Bacteria 942
404 Ga0395905_0118178 3300037471 Bacteria 2492
405 Ga0395905_0750164 3300037471 Bacteria 878
406 Ga0395901_0016295 3300038443 Bacteria 7570
407 Ga0395901_0274485 3300038443 Bacteria 1753
408 Ga0395901_0544530 3300038443 Bacteria 1177
409 Ga0395901_1071864 3300038443 Bacteria 778
410 Ga0242419_001701 3300038698 Bacteria 1382
411 Ga0436365_0628761 3300039437 Bacteria 4142
412 Ga0436365_0866291 3300039437 Bacteria 3782
413 Ga0436365_1753766 3300039437 Bacteria 3262
414 Ga0451807_0389216 3300041486 Bacteria 1537
415 Ga0451853_2067756 3300041512 Bacteria 542
416 Ga0439455_0152838 3300042012 Bacteria 657
417 Ga0439459_0036691 3300042438 Bacteria 1024
418 Ga0466969_0308943 3300044656 Bacteria 716
419 Ga0466972_0493804 3300044658 Bacteria 576
420 Ga0466966_0158704 3300044684 Bacteria 1377
421 Ga0466961_0072836 3300044693 Bacteria 2179
422 Ga0466961_0422909 3300044693 Bacteria 807
423 Ga0466961_0737438 3300044693 Bacteria 589
424 Ga0466963_0022238 3300044694 Bacteria 4014
425 Ga0466963_0167816 3300044694 Bacteria 1529
426 Ga0466964_0094003 3300044706 Bacteria 1310
427 Ga0466971_0192056 3300044719 Bacteria 962
428 Ga0466957_0174616 3300044842 Bacteria 1401
429 Ga0466957_0471964 3300044842 Bacteria 867
430 Ga0466957_0670230 3300044842 Bacteria 730
431 Ga0466960_0368280 3300044901 Bacteria 823
432 Ga0466959_0005273 3300045049 Bacteria 8831
433 Ga0451576_0150876 3300045051 Bacteria 2424
434 Ga0451576_0400396 3300045051 Bacteria 1439
435 Ga0466958_0052185 3300045836 Bacteria 2478
436 Ga0466958_0361384 3300045836 Bacteria 935
437 Ga0466958_0947022 3300045836 Unclassified 562
438 Ga0466967_0017231 3300045976 Bacteria 5729
439 Ga0466967_0094629 3300045976 Bacteria 2721
440 Ga0495603_0010428 3300046455 Bacteria 5628
441 Ga0495603_0069822 3300046455 Bacteria 2066
442 Ga0495638_0193416 3300046460 Bacteria 1153
443 Ga0495653_0647995 3300046463 Bacteria 645
444 Ga0495580_0000637 3300046472 Bacteria 29752
445 Ga0495582_0011894 3300046473 Bacteria 4791
446 Ga0495639_0000056 3300046475 Bacteria 49657
447 Ga0495594_0170593 3300046499 Unclassified 1238
448 Ga0495583_0024591 3300046506 Bacteria 3023
449 Ga0495628_0056843 3300046516 Bacteria 3079
450 Ga0495630_0005645 3300046517 Bacteria 8840
451 Ga0495666_0111702 3300046526 Unclassified 1283
452 Ga0495652_0026063 3300046529 Bacteria 5167
453 Ga0495665_0014021 3300046531 Bacteria 4327
454 Ga0495586_0244490 3300046535 Bacteria 1023
455 Ga0495587_0009238 3300046536 Bacteria 6326
456 Ga0495645_0000922 3300046543 Bacteria 20006
457 Ga0495622_0037031 3300046557 Bacteria 2273
458 Ga0495667_0002386 3300046559 Bacteria 12559
459 Ga0495668_0046642 3300046616 Bacteria 2407
460 Ga0495668_0343906 3300046616 Bacteria 819
461 Ga0495625_0411209 3300046660 Bacteria 843
462 Ga0495588_0001209 3300046674 Bacteria 11127
463 Ga0495657_0147830 3300046675 Bacteria 1461
464 Ga0495599_0028472 3300046678 Bacteria 3502
465 Ga0495623_0001707 3300046679 Bacteria 14774
466 Ga0495647_0130603 3300046681 Bacteria 1064
467 Ga0495658_0000566 3300046683 Bacteria 20184
468 Ga0495613_0062081 3300046689 Bacteria 2735
469 Ga0495600_0016309 3300046809 Bacteria 4713
470 Ga0495581_0003660 3300047315 Bacteria 8849
471 Ga0495604_0143162 3300047317 Bacteria 1706
472 Ga0495636_0303089 3300047318 Bacteria 748
473 Ga0495672_0096587 3300047320 Bacteria 1611
474 Ga0495676_0306392 3300047321 Bacteria 1070
475 Ga0495676_0754553 3300047321 Unclassified 628
476 Ga0495675_0006776 3300047444 Bacteria 7028
477 Ga0495677_0006914 3300047445 Bacteria 4265
478 Ga0495684_0286361 3300047471 Bacteria 1187
479 Ga0495593_0000127 3300047673 Bacteria 36805
480 Ga0495614_0000162 3300048089 Bacteria 24492
481 Ga0496101_0111519 3300048904 Bacteria 2059
482 Ga0496102_0106506 3300048905 Bacteria 2610
483 Ga0496102_0149556 3300048905 Bacteria 2193
484 Ga0496102_0755178 3300048905 Bacteria 895
485 Ga0496103_0030997 3300048906 Bacteria 3256
486 Ga0496103_0388052 3300048906 Bacteria 897
487 Ga0496103_0596920 3300048906 Bacteria 703
488 Ga0496104_0113254 3300048907 Bacteria 2601
489 Ga0496104_1689478 3300048907 Bacteria 536
490 Ga0496106_0015424 3300048909 Bacteria 5654
491 Ga0496106_0390824 3300048909 Bacteria 1118
492 Ga0496107_0148680 3300048910 Bacteria 1732
493 Ga0496109_0000476 3300048912 Bacteria 34082
494 Ga0496114_0008930 3300048917 Bacteria 7946
495 Ga0496115_0026648 3300048918 Bacteria 4514
496 Ga0501032_0667806 3300049569 Bacteria 660
497 Ga0501034_0076797 3300049571 Bacteria 3346
498 Ga0501036_0855117 3300049572 Bacteria 748
499 Ga0501038_0218010 3300049574 Bacteria 1524
500 Ga0501046_0492926 3300049580 Bacteria 878
501 Ga0501069_0462342 3300049585 Bacteria 755
502 Ga0501071_0031088 3300049587 Bacteria 3782
503 Ga0501073_0619925 3300049589 Bacteria 747
504 Ga0501075_0226434 3300049591 Bacteria 1426
505 Ga0501077_0435195 3300049593 Bacteria 839
506 Ga0501243_070317 3300049675 Bacteria 664
507 Ga0501079_0242753 3300049741 Bacteria 1407
508 Ga0501080_0860397 3300049742 Bacteria 792
509 Ga0501081_0072861 3300049743 Bacteria 2395
510 Ga0501035_0227929 3300049822 Bacteria 1589
511 Ga0501044_0000592 3300049823 Bacteria 44003
512 Ga0501044_0305741 3300049823 Bacteria 1518
513 Ga0501044_1353957 3300049823 Bacteria 578
514 Ga0501045_0893114 3300049824 Bacteria 653
515 nmdc:mga03n38_475328_c1 3300050490 Bacteria 698
516 nmdc:mga00v17_1069395_c1 3300050491 Bacteria 506
517 nmdc:mga0yw44_1045807_c1 3300050492 Bacteria 552
518 nmdc:mga0yw44_14658_c1 3300050492 Bacteria 4170
519 nmdc:mga0k408_373844_c1 3300050493 Bacteria 849
520 nmdc:mga0k408_627456_c1 3300050493 Bacteria 633
521 nmdc:mga06z11_900713_c1 3300050494 Bacteria 539
522 nmdc:mga09592_379490_c1 3300050508 Bacteria 1222
523 nmdc:mga0qj67_145670_c1 3300050509 Bacteria 1920
524 nmdc:mga0qj67_259587_c1 3300050509 Bacteria 1409
525 nmdc:mga06r32_4911_c1 3300050510 Bacteria 12044
526 nmdc:mga08y16_344281_c1 3300050511 Bacteria 1532
527 nmdc:mga0n895_132903_c1 3300050512 Bacteria 2514
528 nmdc:mga0rr50_1204439_c1 3300050513 Bacteria 643
529 nmdc:mga0rr50_1800895_c1 3300050513 Bacteria 515
530 nmdc:mga0rr50_419315_c1 3300050513 Bacteria 1132
531 nmdc:mga0rr50_549406_c1 3300050513 Bacteria 983
532 nmdc:mga08x19_340868_c1 3300050514 Bacteria 1045
533 nmdc:mga0a205_867855_c1 3300050515 Bacteria 749
534 Ga0495601_0451528 3300053077 Bacteria 831
535 Ga0495595_0070250 3300053084 Bacteria 1654
536 Ga0495619_0382653 3300053085 Bacteria 972
537 Ga0500572_001948 3300053111 Bacteria 5174
538 Ga0500597_031749 3300053120 Bacteria 2178
539 Ga0500622_0041761 3300053156 Bacteria 2385
540 Ga0500645_041111 3300053730 Bacteria 1366
541 Ga0500645_074541 3300053730 Bacteria 972
542 Ga0500645_099259 3300053730 Bacteria 822
543 Ga0501084_0113541 3300054114 Bacteria 2277
544 Ga0501082_0170888 3300060353 Bacteria 1890
545 Ga0466962_0159968 3300061719 Bacteria 1094
546 Ga0530510_0327961 3300061734 Bacteria 1148

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0667806 Ga0501032_0667806_262_603 109
2 3300049571 Ga0501034_0076797 Ga0501034_0076797_2570_2911 109
3 3300049823 Ga0501044_0000592 Ga0501044_0000592_37064_37405 109
4 3300053111 Ga0500572_001948 Ga0500572_001948_1141_1482 109
5 3300053120 Ga0500597_031749 Ga0500597_031749_1054_1395 109
6 iso_pu_bacteria 2524614857 2526062312 109
7 iso_pu_bacteria 2739367875 2740063662 109
8 3300005327 Ga0070658_11265579 Ga0070658_112655791 110
9 3300005339 Ga0070660_101794878 Ga0070660_1017948781 110
10 3300005366 Ga0070659_100366053 Ga0070659_1003660532 110
11 3300005434 Ga0070709_11012827 Ga0070709_110128271 110
12 3300005438 Ga0070701_10473183 Ga0070701_104731832 110
13 3300005455 Ga0070663_100584190 Ga0070663_1005841902 110
14 3300005466 Ga0070685_10766245 Ga0070685_107662452 110
15 3300005535 Ga0070684_100323835 Ga0070684_1003238352 110
16 3300005564 Ga0070664_101056004 Ga0070664_1010560042 110
17 3300005617 Ga0068859_101147802 Ga0068859_1011478022 110
18 3300005718 Ga0068866_11127837 Ga0068866_111278371 110
19 3300005719 Ga0068861_101444378 Ga0068861_1014443781 110
20 3300005841 Ga0068863_100678653 Ga0068863_1006786531 110
21 3300005844 Ga0068862_100026756 Ga0068862_1000267562 110
22 3300005937 Ga0081455_10073987 Ga0081455_100739872 110
23 3300006881 Ga0068865_100785660 Ga0068865_1007856602 110
24 3300006931 Ga0097620_101147679 Ga0097620_1011476792 110
25 3300009093 Ga0105240_10082732 Ga0105240_100827324 110
26 3300009098 Ga0105245_12411142 Ga0105245_124111421 110
27 3300009148 Ga0105243_12970934 Ga0105243_129709341 110
28 3300009174 Ga0105241_10684773 Ga0105241_106847732 110
29 3300009553 Ga0105249_11070861 Ga0105249_110708611 110
30 3300013296 Ga0157374_11027442 Ga0157374_110274422 110
31 3300013308 Ga0157375_10894633 Ga0157375_108946331 110
32 3300014745 Ga0157377_10184742 Ga0157377_101847421 110
33 3300014968 Ga0157379_11226226 Ga0157379_112262262 110
34 3300021384 Ga0213876_10121302 Ga0213876_101213021 110
35 3300025909 Ga0207705_10000407 Ga0207705_1000040712 110
36 3300025913 Ga0207695_10848594 Ga0207695_108485942 110
37 3300025919 Ga0207657_10313067 Ga0207657_103130672 110
38 3300025932 Ga0207690_10115909 Ga0207690_101159092 110
39 3300039437 Ga0436365_0628761 Ga0436365_0628761_3373_3714 110
40 3300042012 Ga0439455_0152838 Ga0439455_0152838_253_597 110
41 3300044658 Ga0466972_0493804 Ga0466972_0493804_107_457 110
42 3300044693 Ga0466961_0737438 Ga0466961_0737438_134_478 110
43 3300044694 Ga0466963_0022238 Ga0466963_0022238_2612_2956 110
44 3300044706 Ga0466964_0094003 Ga0466964_0094003_536_880 110
45 3300044719 Ga0466971_0192056 Ga0466971_0192056_548_892 110
46 3300044842 Ga0466957_0670230 Ga0466957_0670230_136_480 110
47 3300045836 Ga0466958_0052185 Ga0466958_0052185_521_865 110
48 3300046460 Ga0495638_0193416 Ga0495638_0193416_187_531 110
49 3300046506 Ga0495583_0024591 Ga0495583_0024591_58_402 110
50 3300046616 Ga0495668_0046642 Ga0495668_0046642_1923_2267 110
51 3300046660 Ga0495625_0411209 Ga0495625_0411209_122_466 110
52 3300047445 Ga0495677_0006914 Ga0495677_0006914_445_789 110
53 3300061719 Ga0466962_0159968 Ga0466962_0159968_119_463 110
54 3300005456 Ga0070678_100832474 Ga0070678_1008324742 111
55 3300006358 Ga0068871_100670438 Ga0068871_1006704382 111
56 3300009176 Ga0105242_10068582 Ga0105242_100685824 111
57 3300013306 Ga0163162_12151268 Ga0163162_121512682 111
58 3300013308 Ga0157375_10637572 Ga0157375_106375722 111
59 3300014969 Ga0157376_10610376 Ga0157376_106103763 111
60 3300017792 Ga0163161_11583066 Ga0163161_115830661 111
61 3300025934 Ga0207686_10047917 Ga0207686_100479172 111
62 3300026121 Ga0207683_11098641 Ga0207683_110986412 111
63 3300028379 Ga0268266_10431804 Ga0268266_104318042 111
64 3300031595 Ga0265313_10120314 Ga0265313_101203142 111
65 3300042438 Ga0439459_0036691 Ga0439459_0036691_393_734 111
66 3300049675 Ga0501243_070317 Ga0501243_070317_50_385 111
67 3300050491 nmdc:mga00v17_1069395_c1 nmdc:mga00v17_1069395_c1_35_388 111
68 3300050492 nmdc:mga0yw44_1045807_c1 nmdc:mga0yw44_1045807_c1_136_477 111
69 3300050493 nmdc:mga0k408_627456_c1 nmdc:mga0k408_627456_c1_172_525 111
70 3300005330 Ga0070690_100314310 Ga0070690_1003143102 112
71 3300005333 Ga0070677_10198919 Ga0070677_101989192 112
72 3300005334 Ga0068869_100369276 Ga0068869_1003692763 112
73 3300005336 Ga0070680_100053923 Ga0070680_1000539233 112
74 3300005343 Ga0070687_100647769 Ga0070687_1006477692 112
75 3300005353 Ga0070669_101007972 Ga0070669_1010079722 112
76 3300005354 Ga0070675_100101865 Ga0070675_1001018653 112
77 3300005354 Ga0070675_100509761 Ga0070675_1005097613 112
78 3300005364 Ga0070673_100271857 Ga0070673_1002718572 112
79 3300005365 Ga0070688_100022487 Ga0070688_1000224872 112
80 3300005367 Ga0070667_100037627 Ga0070667_1000376274 112
81 3300005441 Ga0070700_100813023 Ga0070700_1008130232 112
82 3300005457 Ga0070662_101129824 Ga0070662_1011298241 112
83 3300005459 Ga0068867_100236054 Ga0068867_1002360543 112
84 3300005459 Ga0068867_100284606 Ga0068867_1002846062 112
85 3300005466 Ga0070685_10089724 Ga0070685_100897242 112
86 3300005518 Ga0070699_101318179 Ga0070699_1013181791 112
87 3300005543 Ga0070672_100407074 Ga0070672_1004070742 112
88 3300005544 Ga0070686_100478108 Ga0070686_1004781082 112
89 3300005548 Ga0070665_100446443 Ga0070665_1004464431 112
90 3300005563 Ga0068855_100435511 Ga0068855_1004355112 112
91 3300005614 Ga0068856_100223689 Ga0068856_1002236894 112
92 3300005617 Ga0068859_100120967 Ga0068859_1001209674 112
93 3300005618 Ga0068864_101220038 Ga0068864_1012200381 112
94 3300005718 Ga0068866_10033981 Ga0068866_100339812 112
95 3300005840 Ga0068870_10835118 Ga0068870_108351182 112
96 3300005844 Ga0068862_100270241 Ga0068862_1002702412 112
97 3300005983 Ga0081540_1057637 Ga0081540_10576372 112
98 3300006237 Ga0097621_101227557 Ga0097621_1012275572 112
99 3300006881 Ga0068865_100693278 Ga0068865_1006932782 112
100 3300006881 Ga0068865_101456158 Ga0068865_1014561581 112
101 3300006931 Ga0097620_100120972 Ga0097620_1001209724 112
102 3300009098 Ga0105245_10270961 Ga0105245_102709612 112
103 3300009098 Ga0105245_10607042 Ga0105245_106070422 112
104 3300009148 Ga0105243_10311946 Ga0105243_103119462 112
105 3300009174 Ga0105241_10258338 Ga0105241_102583381 112
106 3300009176 Ga0105242_10310553 Ga0105242_103105533 112
107 3300009177 Ga0105248_10150763 Ga0105248_101507634 112
108 3300009545 Ga0105237_12776148 Ga0105237_127761481 112
109 3300009551 Ga0105238_10334639 Ga0105238_103346391 112
110 3300010375 Ga0105239_10180195 Ga0105239_101801954 112
111 3300010375 Ga0105239_13037038 Ga0105239_130370381 112
112 3300011119 Ga0105246_10106759 Ga0105246_101067594 112
113 3300013297 Ga0157378_10244355 Ga0157378_102443551 112
114 3300013306 Ga0163162_11809085 Ga0163162_118090851 112
115 3300013308 Ga0157375_10184299 Ga0157375_101842992 112
116 3300013308 Ga0157375_10652362 Ga0157375_106523621 112
117 3300014745 Ga0157377_10084608 Ga0157377_100846083 112
118 3300014968 Ga0157379_10061108 Ga0157379_100611085 112
119 3300014969 Ga0157376_10371469 Ga0157376_103714692 112
120 3300025315 Ga0207697_10287869 Ga0207697_102878692 112
121 3300025899 Ga0207642_10129956 Ga0207642_101299562 112
122 3300025903 Ga0207680_10157605 Ga0207680_101576052 112
123 3300025907 Ga0207645_10045363 Ga0207645_100453632 112
124 3300025918 Ga0207662_10023902 Ga0207662_1002390210 112
125 3300025923 Ga0207681_11240492 Ga0207681_112404921 112
126 3300025926 Ga0207659_10375050 Ga0207659_103750503 112
127 3300025927 Ga0207687_10582299 Ga0207687_105822992 112
128 3300025933 Ga0207706_10316801 Ga0207706_103168012 112
129 3300025934 Ga0207686_10332454 Ga0207686_103324542 112
130 3300025934 Ga0207686_10705828 Ga0207686_107058282 112
131 3300025935 Ga0207709_10360238 Ga0207709_103602383 112
132 3300025936 Ga0207670_10020693 Ga0207670_100206933 112
133 3300025937 Ga0207669_10460234 Ga0207669_104602342 112
134 3300025938 Ga0207704_11459344 Ga0207704_114593442 112
135 3300025940 Ga0207691_10158456 Ga0207691_101584562 112
136 3300025942 Ga0207689_10096208 Ga0207689_100962083 112
137 3300025945 Ga0207679_10214911 Ga0207679_102149112 112
138 3300025949 Ga0207667_10681584 Ga0207667_106815842 112
139 3300025960 Ga0207651_10030459 Ga0207651_100304598 112
140 3300025972 Ga0207668_10109711 Ga0207668_101097113 112
141 3300025986 Ga0207658_10221273 Ga0207658_102212733 112
142 3300026041 Ga0207639_11096959 Ga0207639_110969591 112
143 3300026078 Ga0207702_11289715 Ga0207702_112897151 112
144 3300026089 Ga0207648_10074436 Ga0207648_100744367 112
145 3300026142 Ga0207698_11217435 Ga0207698_112174352 112
146 3300028379 Ga0268266_10414999 Ga0268266_104149993 112
147 3300028380 Ga0268265_10067781 Ga0268265_100677812 112
148 3300028381 Ga0268264_10443534 Ga0268264_104435342 112
149 3300031548 Ga0307408_100879472 Ga0307408_1008794722 112
150 3300031901 Ga0307406_10260190 Ga0307406_102601902 112
151 3300031995 Ga0307409_100347579 Ga0307409_1003475792 112
152 3300032002 Ga0307416_100778662 Ga0307416_1007786621 112
153 3300032126 Ga0307415_101201040 Ga0307415_1012010402 112
154 3300037418 Ga0395900_1618718 Ga0395900_1618718_92_430 112
155 3300037466 Ga0395898_0717188 Ga0395898_0717188_178_516 112
156 3300038443 Ga0395901_0274485 Ga0395901_0274485_196_534 112
157 3300041486 Ga0451807_0389216 Ga0451807_0389216_477_815 112
158 3300044693 Ga0466961_0422909 Ga0466961_0422909_230_601 112
159 3300044694 Ga0466963_0167816 Ga0466963_0167816_272_640 112
160 3300044842 Ga0466957_0174616 Ga0466957_0174616_784_1152 112
161 3300044901 Ga0466960_0368280 Ga0466960_0368280_302_676 112
162 3300045976 Ga0466967_0017231 Ga0466967_0017231_2195_2569 112
163 3300046616 Ga0495668_0343906 Ga0495668_0343906_278_628 112
164 3300047318 Ga0495636_0303089 Ga0495636_0303089_208_546 112
165 3300047320 Ga0495672_0096587 Ga0495672_0096587_397_735 112
166 3300053156 Ga0500622_0041761 Ga0500622_0041761_1807_2157 112
167 3300053730 Ga0500645_074541 Ga0500645_074541_406_756 112
168 3300061734 Ga0530510_0327961 Ga0530510_0327961_524_862 112
169 iso_pu_bacteria 2873314349 2873319711 112
170 3300005457 Ga0070662_101180322 Ga0070662_1011803221 113
171 3300005547 Ga0070693_100464661 Ga0070693_1004646612 113
172 3300005563 Ga0068855_102132200 Ga0068855_1021322001 113
173 3300005578 Ga0068854_100822179 Ga0068854_1008221792 113
174 3300005615 Ga0070702_100704141 Ga0070702_1007041412 113
175 3300009098 Ga0105245_10137089 Ga0105245_101370891 113
176 3300010375 Ga0105239_10183550 Ga0105239_101835501 113
177 3300013297 Ga0157378_11570310 Ga0157378_115703102 113
178 3300013306 Ga0163162_11157771 Ga0163162_111577712 113
179 3300025927 Ga0207687_10330797 Ga0207687_103307971 113
180 3300025981 Ga0207640_12060093 Ga0207640_120600932 113
181 3300048905 Ga0496102_0755178 Ga0496102_0755178_446_862 113
182 3300048906 Ga0496103_0388052 Ga0496103_0388052_431_847 113
183 3300005937 Ga0081455_10001225 Ga0081455_1000122532 114
184 3300005937 Ga0081455_10081019 Ga0081455_100810192 114
185 3300009147 Ga0114129_11908741 Ga0114129_119087411 114
186 3300014325 Ga0163163_11991918 Ga0163163_119919182 114
187 3300025928 Ga0207700_10604025 Ga0207700_106040252 114
188 3300037471 Ga0395905_0750164 Ga0395905_0750164_150_503 114
189 3300039437 Ga0436365_1753766 Ga0436365_1753766_799_1143 114
190 3300045836 Ga0466958_0361384 Ga0466958_0361384_542_889 114
191 3300049572 Ga0501036_0855117 Ga0501036_0855117_17_361 114
192 3300049574 Ga0501038_0218010 Ga0501038_0218010_459_809 114
193 3300049580 Ga0501046_0492926 Ga0501046_0492926_243_587 114
194 3300049585 Ga0501069_0462342 Ga0501069_0462342_32_376 114
195 3300049587 Ga0501071_0031088 Ga0501071_0031088_960_1304 114
196 3300049589 Ga0501073_0619925 Ga0501073_0619925_223_567 114
197 3300049591 Ga0501075_0226434 Ga0501075_0226434_1045_1389 114
198 3300049593 Ga0501077_0435195 Ga0501077_0435195_474_818 114
199 3300049741 Ga0501079_0242753 Ga0501079_0242753_505_849 114
200 3300049743 Ga0501081_0072861 Ga0501081_0072861_964_1308 114
201 3300049823 Ga0501044_0305741 Ga0501044_0305741_1109_1459 114
202 3300053730 Ga0500645_041111 Ga0500645_041111_974_1318 114
203 3300053730 Ga0500645_099259 Ga0500645_099259_100_444 114
204 3300054114 Ga0501084_0113541 Ga0501084_0113541_1283_1627 114
205 3300005329 Ga0070683_100043908 Ga0070683_1000439082 115
206 3300005336 Ga0070680_100032107 Ga0070680_1000321071 115
207 3300005336 Ga0070680_100370845 Ga0070680_1003708451 115
208 3300005337 Ga0070682_100411639 Ga0070682_1004116393 115
209 3300005339 Ga0070660_101878942 Ga0070660_1018789421 115
210 3300005345 Ga0070692_10424222 Ga0070692_104242222 115
211 3300005355 Ga0070671_100453224 Ga0070671_1004532242 115
212 3300005356 Ga0070674_100649593 Ga0070674_1006495931 115
213 3300005435 Ga0070714_100027701 Ga0070714_1000277012 115
214 3300005435 Ga0070714_101215031 Ga0070714_1012150311 115
215 3300005436 Ga0070713_100000219 Ga0070713_10000021927 115
216 3300005436 Ga0070713_100020793 Ga0070713_1000207931 115
217 3300005436 Ga0070713_100028455 Ga0070713_1000284555 115
218 3300005436 Ga0070713_100210306 Ga0070713_1002103063 115
219 3300005437 Ga0070710_10387228 Ga0070710_103872282 115
220 3300005439 Ga0070711_100031442 Ga0070711_1000314426 115
221 3300005439 Ga0070711_100494924 Ga0070711_1004949241 115
222 3300005440 Ga0070705_100062181 Ga0070705_1000621814 115
223 3300005455 Ga0070663_101429024 Ga0070663_1014290242 115
224 3300005456 Ga0070678_100001493 Ga0070678_1000014933 115
225 3300005458 Ga0070681_10002467 Ga0070681_100024675 115
226 3300005458 Ga0070681_10117873 Ga0070681_101178734 115
227 3300005530 Ga0070679_100001208 Ga0070679_10000120815 115
228 3300005530 Ga0070679_100391964 Ga0070679_1003919643 115
229 3300005535 Ga0070684_100182336 Ga0070684_1001823363 115
230 3300005535 Ga0070684_100591267 Ga0070684_1005912672 115
231 3300005547 Ga0070693_100010836 Ga0070693_1000108365 115
232 3300005547 Ga0070693_100233386 Ga0070693_1002333862 115
233 3300005549 Ga0070704_100119118 Ga0070704_1001191183 115
234 3300005564 Ga0070664_100129718 Ga0070664_1001297183 115
235 3300005615 Ga0070702_100000533 Ga0070702_1000005335 115
236 3300005718 Ga0068866_10012152 Ga0068866_100121524 115
237 3300005842 Ga0068858_100088267 Ga0068858_1000882675 115
238 3300005843 Ga0068860_100073596 Ga0068860_1000735963 115
239 3300006028 Ga0070717_10003026 Ga0070717_100030263 115
240 3300006028 Ga0070717_10141943 Ga0070717_101419433 115
241 3300006028 Ga0070717_11870182 Ga0070717_118701821 115
242 3300006175 Ga0070712_100011885 Ga0070712_1000118854 115
243 3300006175 Ga0070712_100222335 Ga0070712_1002223351 115
244 3300006195 Ga0075366_10656302 Ga0075366_106563022 115
245 3300006358 Ga0068871_100009075 Ga0068871_1000090754 115
246 3300006847 Ga0075431_100006065 Ga0075431_1000060656 115
247 3300006880 Ga0075429_100272969 Ga0075429_1002729693 115
248 3300006881 Ga0068865_100165181 Ga0068865_1001651812 115
249 3300006914 Ga0075436_100182293 Ga0075436_1001822932 115
250 3300007076 Ga0075435_100312736 Ga0075435_1003127362 115
251 3300007076 Ga0075435_100746826 Ga0075435_1007468262 115
252 3300009101 Ga0105247_10103594 Ga0105247_101035943 115
253 3300009148 Ga0105243_10049264 Ga0105243_100492645 115
254 3300009174 Ga0105241_10050728 Ga0105241_100507284 115
255 3300009176 Ga0105242_10025480 Ga0105242_100254805 115
256 3300009177 Ga0105248_10082363 Ga0105248_100823633 115
257 3300013297 Ga0157378_10007611 Ga0157378_1000761110 115
258 3300013308 Ga0157375_10963019 Ga0157375_109630191 115
259 3300014969 Ga0157376_10077699 Ga0157376_100776995 115
260 3300017792 Ga0163161_10824816 Ga0163161_108248162 115
261 3300025898 Ga0207692_10100950 Ga0207692_101009501 115
262 3300025898 Ga0207692_10451875 Ga0207692_104518751 115
263 3300025899 Ga0207642_10075972 Ga0207642_100759723 115
264 3300025906 Ga0207699_10017017 Ga0207699_100170172 115
265 3300025906 Ga0207699_10862092 Ga0207699_108620921 115
266 3300025911 Ga0207654_10150567 Ga0207654_101505673 115
267 3300025912 Ga0207707_10001284 Ga0207707_1000128416 115
268 3300025912 Ga0207707_10071867 Ga0207707_100718674 115
269 3300025912 Ga0207707_10728918 Ga0207707_107289182 115
270 3300025915 Ga0207693_10019292 Ga0207693_100192923 115
271 3300025916 Ga0207663_10154127 Ga0207663_101541272 115
272 3300025916 Ga0207663_10527985 Ga0207663_105279851 115
273 3300025917 Ga0207660_10022758 Ga0207660_100227581 115
274 3300025917 Ga0207660_10457328 Ga0207660_104573281 115
275 3300025921 Ga0207652_10000678 Ga0207652_100006784 115
276 3300025921 Ga0207652_10189071 Ga0207652_101890712 115
277 3300025921 Ga0207652_10764553 Ga0207652_107645532 115
278 3300025927 Ga0207687_10042207 Ga0207687_100422073 115
279 3300025928 Ga0207700_10000651 Ga0207700_1000065115 115
280 3300025928 Ga0207700_10049844 Ga0207700_100498441 115
281 3300025929 Ga0207664_10089661 Ga0207664_100896615 115
282 3300025929 Ga0207664_10654531 Ga0207664_106545312 115
283 3300025934 Ga0207686_10051012 Ga0207686_100510124 115
284 3300025935 Ga0207709_10167645 Ga0207709_101676454 115
285 3300025935 Ga0207709_10660088 Ga0207709_106600882 115
286 3300025937 Ga0207669_10576531 Ga0207669_105765311 115
287 3300025938 Ga0207704_11574655 Ga0207704_115746551 115
288 3300025941 Ga0207711_10435694 Ga0207711_104356943 115
289 3300025949 Ga0207667_10546578 Ga0207667_105465782 115
290 3300025960 Ga0207651_11784058 Ga0207651_117840581 115
291 3300026035 Ga0207703_11279563 Ga0207703_112795631 115
292 3300026067 Ga0207678_10050249 Ga0207678_100502495 115
293 3300026089 Ga0207648_10253604 Ga0207648_102536042 115
294 3300026121 Ga0207683_10000047 Ga0207683_1000004753 115
295 3300028381 Ga0268264_11347047 Ga0268264_113470471 115
296 3300035083 Ga0373926_0018857 Ga0373926_0018857_463_810 115
297 3300035113 Ga0373936_0174471 Ga0373936_0174471_576_923 115
298 3300035170 Ga0373943_0006364 Ga0373943_0006364_35_382 115
299 3300035695 Ga0373927_0006883 Ga0373927_0006883_3242_3589 115
300 3300035725 Ga0373947_0071235 Ga0373947_0071235_804_1151 115
301 3300037068 Ga0373925_0070547 Ga0373925_0070547_1887_2234 115
302 3300038443 Ga0395901_1071864 Ga0395901_1071864_217_564 115
303 3300044842 Ga0466957_0471964 Ga0466957_0471964_60_407 115
304 3300045051 Ga0451576_0150876 Ga0451576_0150876_1066_1413 115
305 3300045051 Ga0451576_0400396 Ga0451576_0400396_392_739 115
306 3300046455 Ga0495603_0010428 Ga0495603_0010428_1404_1751 115
307 3300046472 Ga0495580_0000637 Ga0495580_0000637_11210_11557 115
308 3300046473 Ga0495582_0011894 Ga0495582_0011894_2201_2548 115
309 3300046475 Ga0495639_0000056 Ga0495639_0000056_42478_42825 115
310 3300046499 Ga0495594_0170593 Ga0495594_0170593_478_825 115
311 3300046517 Ga0495630_0005645 Ga0495630_0005645_7760_8107 115
312 3300046526 Ga0495666_0111702 Ga0495666_0111702_475_822 115
313 3300046531 Ga0495665_0014021 Ga0495665_0014021_2372_2719 115
314 3300046557 Ga0495622_0037031 Ga0495622_0037031_25_372 115
315 3300046674 Ga0495588_0001209 Ga0495588_0001209_8512_8859 115
316 3300046683 Ga0495658_0000566 Ga0495658_0000566_2015_2362 115
317 3300046689 Ga0495613_0062081 Ga0495613_0062081_2033_2380 115
318 3300047315 Ga0495581_0003660 Ga0495581_0003660_8217_8564 115
319 3300047321 Ga0495676_0754553 Ga0495676_0754553_27_374 115
320 3300047673 Ga0495593_0000127 Ga0495593_0000127_25676_26023 115
321 3300048089 Ga0495614_0000162 Ga0495614_0000162_13168_13515 115
322 3300048904 Ga0496101_0111519 Ga0496101_0111519_1009_1356 115
323 3300048905 Ga0496102_0149556 Ga0496102_0149556_992_1339 115
324 3300048906 Ga0496103_0030997 Ga0496103_0030997_475_822 115
325 3300048907 Ga0496104_0113254 Ga0496104_0113254_84_431 115
326 3300048909 Ga0496106_0015424 Ga0496106_0015424_3976_4323 115
327 3300048910 Ga0496107_0148680 Ga0496107_0148680_354_701 115
328 3300048917 Ga0496114_0008930 Ga0496114_0008930_2576_2923 115
329 3300048918 Ga0496115_0026648 Ga0496115_0026648_1923_2270 115
330 3300049823 Ga0501044_1353957 Ga0501044_1353957_40_387 115
331 3300050490 nmdc:mga03n38_475328_c1 nmdc:mga03n38_475328_c1_130_504 115
332 3300050493 nmdc:mga0k408_373844_c1 nmdc:mga0k408_373844_c1_142_516 115
333 3300050494 nmdc:mga06z11_900713_c1 nmdc:mga06z11_900713_c1_12_386 115
334 3300050508 nmdc:mga09592_379490_c1 nmdc:mga09592_379490_c1_188_541 115
335 3300050510 nmdc:mga06r32_4911_c1 nmdc:mga06r32_4911_c1_5491_5844 115
336 3300050512 nmdc:mga0n895_132903_c1 nmdc:mga0n895_132903_c1_565_912 115
337 3300050513 nmdc:mga0rr50_1800895_c1 nmdc:mga0rr50_1800895_c1_106_453 115
338 3300050513 nmdc:mga0rr50_419315_c1 nmdc:mga0rr50_419315_c1_615_962 115
339 3300050513 nmdc:mga0rr50_549406_c1 nmdc:mga0rr50_549406_c1_56_403 115
340 3300050514 nmdc:mga08x19_340868_c1 nmdc:mga08x19_340868_c1_566_913 115
341 3300003373 JGI25407J50210_10012745 JGI25407J50210_100127453 116
342 3300003911 JGI25405J52794_10091079 JGI25405J52794_100910792 116
343 3300005289 Ga0065704_10426355 Ga0065704_104263552 116
344 3300005295 Ga0065707_10040831 Ga0065707_100408312 116
345 3300005329 Ga0070683_100001731 Ga0070683_1000017317 116
346 3300005329 Ga0070683_100010807 Ga0070683_1000108075 116
347 3300005329 Ga0070683_100056699 Ga0070683_1000566994 116
348 3300005329 Ga0070683_100196858 Ga0070683_1001968584 116
349 3300005334 Ga0068869_100206381 Ga0068869_1002063812 116
350 3300005337 Ga0070682_100614535 Ga0070682_1006145351 116
351 3300005339 Ga0070660_101381420 Ga0070660_1013814201 116
352 3300005344 Ga0070661_100231271 Ga0070661_1002312712 116
353 3300005347 Ga0070668_100531040 Ga0070668_1005310402 116
354 3300005354 Ga0070675_100222423 Ga0070675_1002224231 116
355 3300005354 Ga0070675_100919685 Ga0070675_1009196851 116
356 3300005356 Ga0070674_100266151 Ga0070674_1002661512 116
357 3300005364 Ga0070673_101947879 Ga0070673_1019478792 116
358 3300005365 Ga0070688_100341239 Ga0070688_1003412391 116
359 3300005435 Ga0070714_100090540 Ga0070714_1000905405 116
360 3300005436 Ga0070713_100753388 Ga0070713_1007533882 116
361 3300005438 Ga0070701_10165316 Ga0070701_101653162 116
362 3300005439 Ga0070711_100385699 Ga0070711_1003856992 116
363 3300005440 Ga0070705_100018221 Ga0070705_1000182215 116
364 3300005441 Ga0070700_100361694 Ga0070700_1003616942 116
365 3300005444 Ga0070694_100189979 Ga0070694_1001899792 116
366 3300005466 Ga0070685_10206539 Ga0070685_102065392 116
367 3300005466 Ga0070685_10225086 Ga0070685_102250862 116
368 3300005467 Ga0070706_100095094 Ga0070706_1000950942 116
369 3300005467 Ga0070706_100963564 Ga0070706_1009635642 116
370 3300005467 Ga0070706_101868879 Ga0070706_1018688791 116
371 3300005468 Ga0070707_100870743 Ga0070707_1008707431 116
372 3300005471 Ga0070698_100578560 Ga0070698_1005785602 116
373 3300005518 Ga0070699_100234079 Ga0070699_1002340793 116
374 3300005530 Ga0070679_100066217 Ga0070679_1000662172 116
375 3300005535 Ga0070684_100045914 Ga0070684_1000459143 116
376 3300005535 Ga0070684_100173863 Ga0070684_1001738633 116
377 3300005535 Ga0070684_100403570 Ga0070684_1004035702 116
378 3300005535 Ga0070684_100592299 Ga0070684_1005922992 116
379 3300005535 Ga0070684_100650492 Ga0070684_1006504922 116
380 3300005536 Ga0070697_100703215 Ga0070697_1007032152 116
381 3300005543 Ga0070672_100908339 Ga0070672_1009083391 116
382 3300005544 Ga0070686_100242369 Ga0070686_1002423691 116
383 3300005545 Ga0070695_100821930 Ga0070695_1008219302 116
384 3300005546 Ga0070696_100648892 Ga0070696_1006488922 116
385 3300005549 Ga0070704_100057156 Ga0070704_1000571562 116
386 3300005549 Ga0070704_100172980 Ga0070704_1001729802 116
387 3300005549 Ga0070704_100590488 Ga0070704_1005904882 116
388 3300005563 Ga0068855_100131564 Ga0068855_1001315644 116
389 3300005563 Ga0068855_102302015 Ga0068855_1023020151 116
390 3300005564 Ga0070664_100257045 Ga0070664_1002570452 116
391 3300005564 Ga0070664_100423729 Ga0070664_1004237292 116
392 3300005564 Ga0070664_101187397 Ga0070664_1011873972 116
393 3300005564 Ga0070664_101228521 Ga0070664_1012285212 116
394 3300005577 Ga0068857_100076372 Ga0068857_1000763722 116
395 3300005614 Ga0068856_100106706 Ga0068856_1001067063 116
396 3300005616 Ga0068852_100122754 Ga0068852_1001227543 116
397 3300005617 Ga0068859_100000004 Ga0068859_10000000415 116
398 3300005617 Ga0068859_100529217 Ga0068859_1005292173 116
399 3300005617 Ga0068859_100747940 Ga0068859_1007479402 116
400 3300005617 Ga0068859_101924276 Ga0068859_1019242763 116
401 3300005618 Ga0068864_100437074 Ga0068864_1004370742 116
402 3300005841 Ga0068863_101156751 Ga0068863_1011567512 116
403 3300005842 Ga0068858_100806268 Ga0068858_1008062682 116
404 3300005844 Ga0068862_101927688 Ga0068862_1019276882 116
405 3300005937 Ga0081455_10000045 Ga0081455_1000004526 116
406 3300005937 Ga0081455_10100019 Ga0081455_101000194 116
407 3300005937 Ga0081455_10117249 Ga0081455_101172494 116
408 3300005981 Ga0081538_10006629 Ga0081538_100066294 116
409 3300005985 Ga0081539_10235588 Ga0081539_102355882 116
410 3300006038 Ga0075365_10731836 Ga0075365_107318362 116
411 3300006175 Ga0070712_100634420 Ga0070712_1006344202 116
412 3300006844 Ga0075428_101373175 Ga0075428_1013731752 116
413 3300006846 Ga0075430_100263651 Ga0075430_1002636512 116
414 3300006847 Ga0075431_100618947 Ga0075431_1006189472 116
415 3300006852 Ga0075433_10948374 Ga0075433_109483741 116
416 3300006871 Ga0075434_101000206 Ga0075434_1010002062 116
417 3300006931 Ga0097620_100000004 Ga0097620_10000000415 116
418 3300006931 Ga0097620_100529214 Ga0097620_1005292143 116
419 3300006931 Ga0097620_100747940 Ga0097620_1007479402 116
420 3300006931 Ga0097620_101924134 Ga0097620_1019241341 116
421 3300009093 Ga0105240_10360328 Ga0105240_103603283 116
422 3300009094 Ga0111539_10068460 Ga0111539_100684602 116
423 3300009147 Ga0114129_10708488 Ga0114129_107084882 116
424 3300009147 Ga0114129_11037649 Ga0114129_110376491 116
425 3300009148 Ga0105243_11791159 Ga0105243_117911591 116
426 3300009174 Ga0105241_10774849 Ga0105241_107748492 116
427 3300009545 Ga0105237_10072449 Ga0105237_100724494 116
428 3300009545 Ga0105237_11112191 Ga0105237_111121912 116
429 3300009553 Ga0105249_10220678 Ga0105249_102206782 116
430 3300009553 Ga0105249_10821839 Ga0105249_108218392 116
431 3300009553 Ga0105249_12417995 Ga0105249_124179952 116
432 3300010375 Ga0105239_10832402 Ga0105239_108324022 116
433 3300013104 Ga0157370_10083213 Ga0157370_100832134 116
434 3300013104 Ga0157370_10308925 Ga0157370_103089251 116
435 3300013105 Ga0157369_10135324 Ga0157369_101353242 116
436 3300013105 Ga0157369_10269509 Ga0157369_102695091 116
437 3300013297 Ga0157378_10196435 Ga0157378_101964351 116
438 3300013306 Ga0163162_11834134 Ga0163162_118341341 116
439 3300013307 Ga0157372_10024153 Ga0157372_100241535 116
440 3300014325 Ga0163163_10323930 Ga0163163_103239302 116
441 3300014325 Ga0163163_11445615 Ga0163163_114456152 116
442 3300015265 Ga0182005_1129919 Ga0182005_11299192 116
443 3300015265 Ga0182005_1196356 Ga0182005_11963562 116
444 3300021384 Ga0213876_10016077 Ga0213876_100160772 116
445 3300025906 Ga0207699_10061349 Ga0207699_100613493 116
446 3300025910 Ga0207684_10080635 Ga0207684_100806354 116
447 3300025910 Ga0207684_11308668 Ga0207684_113086681 116
448 3300025913 Ga0207695_10002089 Ga0207695_1000208919 116
449 3300025915 Ga0207693_10174874 Ga0207693_101748742 116
450 3300025916 Ga0207663_10167030 Ga0207663_101670302 116
451 3300025917 Ga0207660_10309626 Ga0207660_103096262 116
452 3300025918 Ga0207662_10216580 Ga0207662_102165803 116
453 3300025920 Ga0207649_10217388 Ga0207649_102173882 116
454 3300025922 Ga0207646_11028764 Ga0207646_110287642 116
455 3300025925 Ga0207650_10938190 Ga0207650_109381902 116
456 3300025926 Ga0207659_10342297 Ga0207659_103422972 116
457 3300025928 Ga0207700_10033904 Ga0207700_100339043 116
458 3300025928 Ga0207700_10651300 Ga0207700_106513002 116
459 3300025929 Ga0207664_10144415 Ga0207664_101444153 116
460 3300025935 Ga0207709_10286862 Ga0207709_102868622 116
461 3300025937 Ga0207669_10579928 Ga0207669_105799281 116
462 3300025939 Ga0207665_10984652 Ga0207665_109846521 116
463 3300025942 Ga0207689_10426648 Ga0207689_104266482 116
464 3300025944 Ga0207661_10001479 Ga0207661_1000147914 116
465 3300025944 Ga0207661_10008372 Ga0207661_100083726 116
466 3300025944 Ga0207661_10082034 Ga0207661_100820344 116
467 3300025944 Ga0207661_10182374 Ga0207661_101823741 116
468 3300025945 Ga0207679_10581046 Ga0207679_105810462 116
469 3300025945 Ga0207679_10599550 Ga0207679_105995502 116
470 3300025949 Ga0207667_10180298 Ga0207667_101802982 116
471 3300025972 Ga0207668_10728229 Ga0207668_107282292 116
472 3300026035 Ga0207703_10745562 Ga0207703_107455621 116
473 3300026067 Ga0207678_11963051 Ga0207678_119630511 116
474 3300026078 Ga0207702_10074728 Ga0207702_100747283 116
475 3300026095 Ga0207676_10593250 Ga0207676_105932502 116
476 3300026095 Ga0207676_11130473 Ga0207676_111304731 116
477 3300026095 Ga0207676_11895039 Ga0207676_118950391 116
478 3300026116 Ga0207674_10025595 Ga0207674_100255953 116
479 3300026142 Ga0207698_10654206 Ga0207698_106542061 116
480 3300028381 Ga0268264_11067585 Ga0268264_110675851 116
481 3300031824 Ga0307413_10830441 Ga0307413_108304411 116
482 3300031903 Ga0307407_10348506 Ga0307407_103485062 116
483 3300031995 Ga0307409_100145312 Ga0307409_1001453123 116
484 3300032002 Ga0307416_102436488 Ga0307416_1024364881 116
485 3300032002 Ga0307416_103020368 Ga0307416_1030203681 116
486 3300032005 Ga0307411_10373197 Ga0307411_103731972 116
487 3300032126 Ga0307415_100029141 Ga0307415_1000291413 116
488 3300035117 Ga0373953_0082608 Ga0373953_0082608_789_1145 116
489 3300035118 Ga0373954_0027223 Ga0373954_0027223_373_729 116
490 3300035119 Ga0373956_0010386 Ga0373956_0010386_1805_2161 116
491 3300035120 Ga0373957_0003979 Ga0373957_0003979_1518_1874 116
492 3300035172 Ga0373955_0002853 Ga0373955_0002853_6045_6401 116
493 3300035241 Ga0373961_0034696 Ga0373961_0034696_372_722 116
494 3300035242 Ga0373962_0384566 Ga0373962_0384566_126_476 116
495 3300035410 Ga0373924_0112240 Ga0373924_0112240_699_1055 116
496 3300035692 Ga0373935_0159033 Ga0373935_0159033_1166_1516 116
497 3300035724 Ga0373933_0005266 Ga0373933_0005266_2655_3011 116
498 3300036401 Ga0373937_0000944 Ga0373937_0000944_17663_18019 116
499 3300037418 Ga0395900_0002748 Ga0395900_0002748_244_609 116
500 3300037418 Ga0395900_0116961 Ga0395900_0116961_990_1349 116
501 3300037418 Ga0395900_0832653 Ga0395900_0832653_27_386 116
502 3300037466 Ga0395898_0039888 Ga0395898_0039888_2895_3260 116
503 3300037471 Ga0395905_0118178 Ga0395905_0118178_697_1062 116
504 3300038443 Ga0395901_0016295 Ga0395901_0016295_6986_7351 116
505 3300038443 Ga0395901_0544530 Ga0395901_0544530_196_546 116
506 3300038698 Ga0242419_001701 Ga0242419_001701_48_398 116
507 3300039437 Ga0436365_0866291 Ga0436365_0866291_2095_2445 116
508 3300041512 Ga0451853_2067756 Ga0451853_2067756_182_532 116
509 3300044656 Ga0466969_0308943 Ga0466969_0308943_86_436 116
510 3300044684 Ga0466966_0158704 Ga0466966_0158704_367_717 116
511 3300044693 Ga0466961_0072836 Ga0466961_0072836_1537_1887 116
512 3300045049 Ga0466959_0005273 Ga0466959_0005273_3447_3797 116
513 3300045836 Ga0466958_0947022 Ga0466958_0947022_12_365 116
514 3300045976 Ga0466967_0094629 Ga0466967_0094629_1324_1674 116
515 3300046455 Ga0495603_0069822 Ga0495603_0069822_1684_2034 116
516 3300046463 Ga0495653_0647995 Ga0495653_0647995_135_491 116
517 3300046516 Ga0495628_0056843 Ga0495628_0056843_2617_2973 116
518 3300046529 Ga0495652_0026063 Ga0495652_0026063_3245_3601 116
519 3300046535 Ga0495586_0244490 Ga0495586_0244490_333_689 116
520 3300046536 Ga0495587_0009238 Ga0495587_0009238_1519_1875 116
521 3300046543 Ga0495645_0000922 Ga0495645_0000922_2501_2857 116
522 3300046559 Ga0495667_0002386 Ga0495667_0002386_8778_9134 116
523 3300046675 Ga0495657_0147830 Ga0495657_0147830_565_921 116
524 3300046678 Ga0495599_0028472 Ga0495599_0028472_1457_1813 116
525 3300046679 Ga0495623_0001707 Ga0495623_0001707_6570_6926 116
526 3300046681 Ga0495647_0130603 Ga0495647_0130603_610_960 116
527 3300046809 Ga0495600_0016309 Ga0495600_0016309_1774_2130 116
528 3300047317 Ga0495604_0143162 Ga0495604_0143162_180_536 116
529 3300047321 Ga0495676_0306392 Ga0495676_0306392_666_1016 116
530 3300047444 Ga0495675_0006776 Ga0495675_0006776_1185_1541 116
531 3300047471 Ga0495684_0286361 Ga0495684_0286361_545_901 116
532 3300048905 Ga0496102_0106506 Ga0496102_0106506_121_471 116
533 3300048906 Ga0496103_0596920 Ga0496103_0596920_280_630 116
534 3300048907 Ga0496104_1689478 Ga0496104_1689478_113_463 116
535 3300048909 Ga0496106_0390824 Ga0496106_0390824_115_465 116
536 3300048912 Ga0496109_0000476 Ga0496109_0000476_29774_30127 116
537 3300049742 Ga0501080_0860397 Ga0501080_0860397_346_699 116
538 3300049822 Ga0501035_0227929 Ga0501035_0227929_364_747 116
539 3300049824 Ga0501045_0893114 Ga0501045_0893114_207_560 116
540 3300050492 nmdc:mga0yw44_14658_c1 nmdc:mga0yw44_14658_c1_3700_4062 116
541 3300050509 nmdc:mga0qj67_145670_c1 nmdc:mga0qj67_145670_c1_349_708 116
542 3300050509 nmdc:mga0qj67_259587_c1 nmdc:mga0qj67_259587_c1_487_840 116
543 3300050511 nmdc:mga08y16_344281_c1 nmdc:mga08y16_344281_c1_1113_1463 116
544 3300050513 nmdc:mga0rr50_1204439_c1 nmdc:mga0rr50_1204439_c1_193_585 116
545 3300050515 nmdc:mga0a205_867855_c1 nmdc:mga0a205_867855_c1_385_735 116
546 3300053077 Ga0495601_0451528 Ga0495601_0451528_153_509 116
547 3300053084 Ga0495595_0070250 Ga0495595_0070250_25_381 116
548 3300053085 Ga0495619_0382653 Ga0495619_0382653_267_623 116
549 3300060353 Ga0501082_0170888 Ga0501082_0170888_27_380 116
550 iso_pu_bacteria 2515154129 2515719209 116
551 iso_pu_bacteria 2515154202 2516086278 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

19

65

0.98

PF12840

HTH_20

Helix-turn-helix domain

17

65

0.98

PF01047

MarR

MarR family

20

69

0.9

PF12802

MarR_2

MarR family

12

72

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9288 3 89
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.928 5 92
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9257 4 92
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.9158 9 87
6j0e-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.911 10 81
ID Description Score Start End Superfamily
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9374 17 72 1.10.10.10
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.931 17 72 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9257 4 92 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9189 5 82 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9178 15 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9G072-F1-model_v4 Transcriptional regulator 0.9878 1 73 GO:0003700
AF-A0A350UIW9-F1-model_v4 Transcriptional regulator 0.9871 5 88 GO:0003700
AF-A0A7W0YP81-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9818 5 89 GO:0003700
AF-A0A2W5VFY7-F1-model_v4 HTH arsR-type domain-containing protein 0.9803 5 83 GO:0003700
AF-H1S4V4-F1-model_v4 ArsR family transcriptional regulator 0.9801 3 84 GO:0003700

Feature Viewer

pLDDT pTM Quality
90.88 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map