metagRoot

F462691

General Info

Members	Datasets	Scaffolds	Average Seq Length
552	320	552	92

Family's Representative Sequence

Representative Sequence	3300005339\|Ga0070660_100870576\|Ga0070660_1008705762
Length	103
Sequence	MTGRCHSRYASRAMSDPTRDDVDALVGPATPHFAFQIRARVRELVRGLPESHEVRRYAAGKMELLDRLATASSKAEQGPREPESRPGWAEMPSSAPADAPLPR

Samples

	Sample ID	Description	Type	Environment
1	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
2	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
3	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
4	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
5	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
6	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
7	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
8	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
9	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
10	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
11	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
12	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
13	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
14	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
15	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
16	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
17	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
18	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
19	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
20	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
21	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
22	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
23	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
24	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
25	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
26	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
27	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
28	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
29	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
30	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
31	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
32	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
35	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
36	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
37	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
38	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
39	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
40	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
41	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
42	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
43	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
44	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
45	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
46	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
47	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
48	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
49	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
50	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
51	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
52	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
53	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
54	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
55	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
56	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
57	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
58	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
59	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
60	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
61	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
62	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
63	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
64	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
65	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
66	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
67	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
68	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
69	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
71	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
72	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
73	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
76	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
77	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
78	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
79	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
80	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
81	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
82	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
83	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
84	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
85	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
86	3300012494	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610	Metagenome	Rhizosphere
87	3300012510	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610	Metagenome	Rhizosphere
88	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
89	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
90	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
91	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
92	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
93	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
94	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
95	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
96	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
97	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
98	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
99	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
100	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
101	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
102	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
103	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
104	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
159	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
160	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
161	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
162	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
163	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
164	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
165	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
166	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
167	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
168	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
169	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
170	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
171	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
172	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
173	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
174	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
175	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
176	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
177	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
178	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
179	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
180	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
181	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
182	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
183	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
184	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
185	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
186	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
187	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
188	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
189	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
190	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
191	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
192	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
193	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
194	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
195	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
196	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
197	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
198	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
199	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
200	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
201	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
202	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
203	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
204	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
205	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
206	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
207	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
208	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
209	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
210	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
211	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
212	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
213	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
214	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
215	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
216	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
217	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
218	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
219	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
220	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
221	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
222	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
223	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
224	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
225	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
226	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
227	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
228	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
229	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
230	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
231	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
232	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
233	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
234	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
235	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
236	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
237	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
238	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
239	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
240	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
241	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
242	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
243	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
244	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
245	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
246	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
247	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
248	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
249	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
250	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
251	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
252	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
253	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
254	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
255	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
256	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
257	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
258	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
259	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
260	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
261	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
262	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
263	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
264	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
265	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
266	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
267	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
268	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
269	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
270	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
271	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
272	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
273	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
274	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
275	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
276	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
277	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
278	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
279	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
280	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
281	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
282	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
283	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
284	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
285	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
286	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
287	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
288	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
289	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
290	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
291	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
292	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
293	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
294	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
295	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
296	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
297	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
298	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
299	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
300	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
301	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
302	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
303	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
304	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
305	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
306	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
307	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
308	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
309	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
310	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
311	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
312	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
313	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
314	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
315	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
316	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
317	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
318	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
319	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
320	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.82
Metatranscriptomes	0.18
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	11.41
Rhizosphere	87.5
Stem	0
Stem Tuber	0
Unclassified	1.09

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0070690_100087408	3300005330	Bacteria	2047
2	Ga0070677_10148211	3300005333	Bacteria	1089
3	Ga0068869_100162886	3300005334	Bacteria	1737
4	Ga0068869_100306748	3300005334	Unclassified	1283
5	Ga0070666_10108953	3300005335	Bacteria	1914
6	Ga0070680_100055891	3300005336	Bacteria	3226
7	Ga0070680_100877518	3300005336	Bacteria	774
8	Ga0070682_100098180	3300005337	Bacteria	1929
9	Ga0070682_101068889	3300005337	Unclassified	674
10	Ga0068868_100001720	3300005338	Bacteria	14987
11	Ga0068868_101136519	3300005338	Unclassified	720
12	Ga0070660_100870576	3300005339	Bacteria	759
13	Ga0070689_100004508	3300005340	Bacteria	9431
14	Ga0070691_10183436	3300005341	Bacteria	1091
15	Ga0070691_10750581	3300005341	Bacteria	590
16	Ga0070687_100009004	3300005343	Bacteria	4256
17	Ga0070687_100992446	3300005343	Bacteria	608
18	Ga0070692_10011327	3300005345	Bacteria	4089
19	Ga0070668_100011855	3300005347	Bacteria	6494
20	Ga0070668_100884510	3300005347	Bacteria	798
21	Ga0070669_100168101	3300005353	Bacteria	1708
22	Ga0070675_101029383	3300005354	Bacteria	756
23	Ga0070675_101357097	3300005354	Bacteria	655
24	Ga0070671_100421551	3300005355	Bacteria	1143
25	Ga0070674_100001495	3300005356	Bacteria	12454
26	Ga0070674_100075116	3300005356	Bacteria	2399
27	Ga0070688_100028815	3300005365	Bacteria	3319
28	Ga0070688_101144512	3300005365	Unclassified	623
29	Ga0070659_100053053	3300005366	Bacteria	3191
30	Ga0070659_100986739	3300005366	Bacteria	739
31	Ga0070703_10010057	3300005406	Bacteria	2669
32	Ga0070703_10558170	3300005406	Unclassified	523
33	Ga0070709_10966499	3300005434	Bacteria	676
34	Ga0070714_100232790	3300005435	Bacteria	1698
35	Ga0070714_100347185	3300005435	Bacteria	1393
36	Ga0070714_100930682	3300005435	Bacteria	844
37	Ga0070713_100071531	3300005436	Bacteria	2931
38	Ga0070713_100171141	3300005436	Bacteria	1946
39	Ga0070713_100606561	3300005436	Bacteria	1040
40	Ga0070710_10000694	3300005437	Bacteria	16017
41	Ga0070710_10265218	3300005437	Bacteria	1109
42	Ga0070701_10000635	3300005438	Bacteria	12309
43	Ga0070711_100005165	3300005439	Bacteria	7784
44	Ga0070711_100125599	3300005439	Bacteria	1904
45	Ga0070705_100031541	3300005440	Bacteria	2935
46	Ga0070705_100427036	3300005440	Bacteria	988
47	Ga0070700_100001994	3300005441	Bacteria	10366
48	Ga0070700_100067234	3300005441	Bacteria	2276
49	Ga0070700_101636848	3300005441	Bacteria	551
50	Ga0070694_100006493	3300005444	Bacteria	7104
51	Ga0070708_100009274	3300005445	Bacteria	7931
52	Ga0070708_100555556	3300005445	Bacteria	1083
53	Ga0070663_100006086	3300005455	Bacteria	7222
54	Ga0070678_100001440	3300005456	Bacteria	12678
55	Ga0070678_100163852	3300005456	Bacteria	1804
56	Ga0070662_100033632	3300005457	Bacteria	3611
57	Ga0070662_100579580	3300005457	Bacteria	942
58	Ga0070681_10550176	3300005458	Bacteria	1068
59	Ga0068867_100002296	3300005459	Bacteria	13445
60	Ga0068867_101311148	3300005459	Bacteria	669
61	Ga0070685_10001240	3300005466	Bacteria	13557
62	Ga0070706_100033804	3300005467	Bacteria	4720
63	Ga0070707_100007620	3300005468	Bacteria	10054
64	Ga0070707_100115509	3300005468	Bacteria	2605
65	Ga0070707_100261785	3300005468	Bacteria	1683
66	Ga0070698_100375820	3300005471	Bacteria	1353
67	Ga0070698_100765980	3300005471	Unclassified	908
68	Ga0070699_100275671	3300005518	Bacteria	1506
69	Ga0070699_100739362	3300005518	Bacteria	899
70	Ga0070699_100793084	3300005518	Bacteria	867
71	Ga0070679_100830390	3300005530	Unclassified	867
72	Ga0070679_101644584	3300005530	Bacteria	590
73	Ga0070684_100278151	3300005535	Bacteria	1533
74	Ga0070697_100101746	3300005536	Bacteria	2387
75	Ga0068853_100001846	3300005539	Bacteria	15562
76	Ga0070672_100125776	3300005543	Bacteria	2102
77	Ga0070686_100000541	3300005544	Bacteria	22572
78	Ga0070686_100035773	3300005544	Bacteria	3069
79	Ga0070686_100312339	3300005544	Bacteria	1169
80	Ga0070695_100263417	3300005545	Bacteria	1260
81	Ga0070695_100343787	3300005545	Bacteria	1116
82	Ga0070696_100023876	3300005546	Bacteria	4155
83	Ga0070696_100033325	3300005546	Bacteria	3538
84	Ga0070696_100369646	3300005546	Bacteria	1115
85	Ga0070696_101661524	3300005546	Unclassified	550
86	Ga0070693_100004097	3300005547	Bacteria	6862
87	Ga0070693_100347193	3300005547	Bacteria	1014
88	Ga0070704_100004721	3300005549	Bacteria	7885
89	Ga0068855_100078216	3300005563	Bacteria	3838
90	Ga0070664_100638538	3300005564	Unclassified	989
91	Ga0068857_100983737	3300005577	Bacteria	812
92	Ga0068854_100054356	3300005578	Bacteria	2879
93	Ga0068854_100330261	3300005578	Bacteria	1242
94	Ga0068856_100002949	3300005614	Bacteria	17441
95	Ga0068856_100050960	3300005614	Bacteria	4081
96	Ga0070702_100001525	3300005615	Bacteria	9531
97	Ga0070702_100200528	3300005615	Bacteria	1320
98	Ga0070702_100586165	3300005615	Bacteria	833
99	Ga0068859_100010474	3300005617	Bacteria	9328
100	Ga0068864_101495816	3300005618	Bacteria	678
101	Ga0068864_102513077	3300005618	Unclassified	521
102	Ga0068866_10002187	3300005718	Bacteria	8140
103	Ga0068866_10396546	3300005718	Unclassified	889
104	Ga0068861_100033868	3300005719	Bacteria	3772
105	Ga0068861_102366879	3300005719	Unclassified	534
106	Ga0068851_10289554	3300005834	Bacteria	939
107	Ga0068860_100034266	3300005843	Bacteria	4869
108	Ga0081455_10182617	3300005937	Bacteria	1587
109	Ga0081455_10287982	3300005937	Bacteria	1184
110	Ga0081455_10695980	3300005937	Bacteria	648
111	Ga0081539_10035462	3300005985	Bacteria	2997
112	Ga0070717_10834212	3300006028	Bacteria	839
113	Ga0070715_10177896	3300006163	Bacteria	1065
114	Ga0070716_100325832	3300006173	Bacteria	1078
115	Ga0070716_100516582	3300006173	Bacteria	884
116	Ga0070716_101300683	3300006173	Bacteria	588
117	Ga0070712_100002690	3300006175	Bacteria	10966
118	Ga0070712_100406103	3300006175	Bacteria	1126
119	Ga0097621_100017319	3300006237	Bacteria	5470
120	Ga0097621_101381665	3300006237	Bacteria	666
121	Ga0068871_100019042	3300006358	Bacteria	5233
122	Ga0075429_101020436	3300006880	Bacteria	723
123	Ga0075429_101833663	3300006880	Unclassified	526
124	Ga0068865_100000372	3300006881	Bacteria	24843
125	Ga0068865_100132297	3300006881	Bacteria	1870
126	Ga0068865_100618084	3300006881	Unclassified	918
127	Ga0068865_101476239	3300006881	Bacteria	609
128	Ga0097620_100010474	3300006931	Bacteria	9328
129	Ga0111539_10980297	3300009094	Bacteria	983
130	Ga0105245_10003696	3300009098	Bacteria	13653
131	Ga0105245_10080646	3300009098	Bacteria	2973
132	Ga0105245_10116740	3300009098	Bacteria	2488
133	Ga0105247_10068836	3300009101	Bacteria	2207
134	Ga0105243_10000793	3300009148	Bacteria	30289
135	Ga0105243_10229701	3300009148	Bacteria	1645
136	Ga0105243_10514701	3300009148	Bacteria	1137
137	Ga0105243_11943220	3300009148	Bacteria	622
138	Ga0105243_12149657	3300009148	Unclassified	594
139	Ga0105241_10012847	3300009174	Bacteria	6147
140	Ga0105241_11978024	3300009174	Unclassified	573
141	Ga0105242_10013582	3300009176	Bacteria	6300
142	Ga0105242_10159212	3300009176	Bacteria	1975
143	Ga0105242_10513060	3300009176	Unclassified	1142
144	Ga0105248_10107070	3300009177	Bacteria	3152
145	Ga0105248_10165715	3300009177	Bacteria	2492
146	Ga0105237_11890058	3300009545	Bacteria	605
147	Ga0105238_10107073	3300009551	Bacteria	2777
148	Ga0105238_11974656	3300009551	Unclassified	617
149	Ga0105249_10001946	3300009553	Bacteria	17925
150	Ga0105249_11844591	3300009553	Bacteria	677
151	Ga0105239_10002279	3300010375	Bacteria	24494
152	Ga0105239_10234686	3300010375	Bacteria	2058
153	Ga0105246_10198563	3300011119	Bacteria	1558
154	Ga0105246_10235591	3300011119	Unclassified	1444
155	Ga0157341_1003483	3300012494	Bacteria	1100
156	Ga0157316_1025640	3300012510	Bacteria	679
157	Ga0157373_11344374	3300013100	Bacteria	542
158	Ga0157371_10447808	3300013102	Bacteria	949
159	Ga0157369_10039184	3300013105	Bacteria	5179
160	Ga0157374_10024720	3300013296	Bacteria	5385
161	Ga0157374_10074109	3300013296	Bacteria	3213
162	Ga0157374_10158024	3300013296	Bacteria	2207
163	Ga0157378_10004177	3300013297	Bacteria	12749
164	Ga0163162_10001930	3300013306	Bacteria	19506
165	Ga0163162_10482653	3300013306	Bacteria	1371
166	Ga0157375_10034422	3300013308	Bacteria	4826
167	Ga0157375_10091117	3300013308	Bacteria	3109
168	Ga0157375_12155825	3300013308	Bacteria	664
169	Ga0163163_11118345	3300014325	Bacteria	851
170	Ga0157380_10007997	3300014326	Bacteria	7532
171	Ga0157380_10016662	3300014326	Bacteria	5426
172	Ga0157380_10124948	3300014326	Unclassified	2185
173	Ga0182008_10087488	3300014497	Bacteria	1535
174	Ga0157377_10022629	3300014745	Bacteria	3321
175	Ga0157377_11598335	3300014745	Unclassified	522
176	Ga0157379_10215156	3300014968	Bacteria	1740
177	Ga0157379_10523036	3300014968	Bacteria	1101
178	Ga0157376_10002471	3300014969	Bacteria	12500
179	Ga0157376_10534642	3300014969	Bacteria	1157
180	Ga0157376_10698182	3300014969	Bacteria	1019
181	Ga0157376_11803589	3300014969	Bacteria	648
182	Ga0163161_10281659	3300017792	Bacteria	1304
183	Ga0206356_11647156	3300020070	Bacteria	534
184	Ga0213875_10095257	3300021388	Bacteria	1388
185	Ga0207656_10194105	3300025321	Bacteria	979
186	Ga0207653_10013826	3300025885	Bacteria	2529
187	Ga0207682_10432640	3300025893	Bacteria	623
188	Ga0207692_10005865	3300025898	Bacteria	4950
189	Ga0207642_10000288	3300025899	Bacteria	15083
190	Ga0207710_10049006	3300025900	Bacteria	1892
191	Ga0207688_10037492	3300025901	Bacteria	2689
192	Ga0207688_10875878	3300025901	Bacteria	569
193	Ga0207685_10070605	3300025905	Bacteria	1414
194	Ga0207699_10033220	3300025906	Bacteria	2915
195	Ga0207699_10494369	3300025906	Bacteria	882
196	Ga0207699_11138295	3300025906	Bacteria	578
197	Ga0207645_10167336	3300025907	Bacteria	1440
198	Ga0207684_10079460	3300025910	Bacteria	2790
199	Ga0207654_10008658	3300025911	Bacteria	5156
200	Ga0207707_10459013	3300025912	Bacteria	1090
201	Ga0207693_10002317	3300025915	Bacteria	16545
202	Ga0207693_10004482	3300025915	Bacteria	11809
203	Ga0207693_10599487	3300025915	Bacteria	858
204	Ga0207693_10665144	3300025915	Unclassified	808
205	Ga0207663_10276802	3300025916	Bacteria	1245
206	Ga0207663_11233439	3300025916	Bacteria	602
207	Ga0207660_10069124	3300025917	Bacteria	2563
208	Ga0207660_10224387	3300025917	Bacteria	1476
209	Ga0207662_10011413	3300025918	Bacteria	4928
210	Ga0207652_11834495	3300025921	Bacteria	511
211	Ga0207646_10003386	3300025922	Bacteria	18036
212	Ga0207646_10158300	3300025922	Bacteria	2043
213	Ga0207646_11547491	3300025922	Bacteria	573
214	Ga0207687_10032358	3300025927	Bacteria	3542
215	Ga0207687_10851849	3300025927	Bacteria	779
216	Ga0207700_10157542	3300025928	Bacteria	1883
217	Ga0207700_10453187	3300025928	Bacteria	1131
218	Ga0207664_10204055	3300025929	Bacteria	1708
219	Ga0207664_10348747	3300025929	Bacteria	1310
220	Ga0207644_10016684	3300025931	Bacteria	4945
221	Ga0207644_10659412	3300025931	Bacteria	871
222	Ga0207644_11474324	3300025931	Bacteria	571
223	Ga0207690_10150627	3300025932	Bacteria	1724
224	Ga0207706_10098767	3300025933	Bacteria	2568
225	Ga0207706_11140347	3300025933	Unclassified	650
226	Ga0207686_10014409	3300025934	Bacteria	4401
227	Ga0207709_10001055	3300025935	Bacteria	20352
228	Ga0207709_10097882	3300025935	Bacteria	1933
229	Ga0207709_10511789	3300025935	Bacteria	938
230	Ga0207670_10054576	3300025936	Bacteria	2697
231	Ga0207669_10017563	3300025937	Bacteria	3674
232	Ga0207669_10052208	3300025937	Bacteria	2454
233	Ga0207669_10258552	3300025937	Bacteria	1301
234	Ga0207704_10003364	3300025938	Bacteria	7258
235	Ga0207704_10128535	3300025938	Bacteria	1749
236	Ga0207704_10152686	3300025938	Bacteria	1632
237	Ga0207704_10480412	3300025938	Bacteria	997
238	Ga0207665_10066145	3300025939	Bacteria	2459
239	Ga0207665_10133570	3300025939	Bacteria	1764
240	Ga0207665_10884237	3300025939	Bacteria	708
241	Ga0207691_10005679	3300025940	Bacteria	12061
242	Ga0207711_10018927	3300025941	Bacteria	5728
243	Ga0207711_10117670	3300025941	Bacteria	2370
244	Ga0207689_10205878	3300025942	Bacteria	1625
245	Ga0207689_10408976	3300025942	Unclassified	1132
246	Ga0207651_10092306	3300025960	Bacteria	2220
247	Ga0207712_10001816	3300025961	Bacteria	14094
248	Ga0207712_10356783	3300025961	Bacteria	1217
249	Ga0207712_11138391	3300025961	Bacteria	695
250	Ga0207668_10143105	3300025972	Bacteria	1842
251	Ga0207640_10879464	3300025981	Bacteria	781
252	Ga0207640_10953481	3300025981	Unclassified	752
253	Ga0207677_10565857	3300026023	Bacteria	993
254	Ga0207677_10572850	3300026023	Bacteria	987
255	Ga0207703_11635079	3300026035	Unclassified	620
256	Ga0207639_10032728	3300026041	Bacteria	3830
257	Ga0207678_10016091	3300026067	Bacteria	6568
258	Ga0207678_10220693	3300026067	Bacteria	1623
259	Ga0207708_10000064	3300026075	Bacteria	85366
260	Ga0207708_10015142	3300026075	Bacteria	5778
261	Ga0207702_10029887	3300026078	Bacteria	4537
262	Ga0207648_10000958	3300026089	Bacteria	32650
263	Ga0207648_10039576	3300026089	Bacteria	4145
264	Ga0207676_11248804	3300026095	Bacteria	737
265	Ga0207676_11727234	3300026095	Unclassified	624
266	Ga0207674_11796622	3300026116	Bacteria	580
267	Ga0207675_100050414	3300026118	Bacteria	3884
268	Ga0207675_100183766	3300026118	Bacteria	2003
269	Ga0207683_10000450	3300026121	Bacteria	38100
270	Ga0207683_10486910	3300026121	Bacteria	1139
271	Ga0207683_10560275	3300026121	Bacteria	1057
272	Ga0207698_10164629	3300026142	Bacteria	1944
273	Ga0209966_1047134	3300027695	Bacteria	910
274	Ga0268266_10065607	3300028379	Bacteria	3138
275	Ga0268265_10333829	3300028380	Bacteria	1378
276	Ga0268264_10061866	3300028381	Bacteria	3142
277	Ga0265326_10208229	3300028558	Unclassified	562
278	Ga0265319_1034231	3300028563	Bacteria	1749
279	Ga0265319_1220348	3300028563	Bacteria	580
280	Ga0265334_10044883	3300028573	Bacteria	1714
281	Ga0265318_10235670	3300028577	Bacteria	668
282	Ga0265318_10296825	3300028577	Unclassified	589
283	Ga0265323_10215019	3300028653	Bacteria	603
284	Ga0265336_10002195	3300028666	Bacteria	8214
285	Ga0265336_10032594	3300028666	Unclassified	1615
286	Ga0265336_10196008	3300028666	Bacteria	600
287	Ga0265338_10031209	3300028800	Bacteria	5227
288	Ga0265338_10040106	3300028800	Bacteria	4403
289	Ga0265330_10195826	3300031235	Bacteria	855
290	Ga0265320_10203601	3300031240	Bacteria	883
291	Ga0265320_10206061	3300031240	Bacteria	877
292	Ga0265325_10511605	3300031241	Unclassified	520
293	Ga0265340_10161358	3300031247	Bacteria	1018
294	Ga0265340_10166836	3300031247	Unclassified	998
295	Ga0265327_10040368	3300031251	Bacteria	2525
296	Ga0265316_10523407	3300031344	Unclassified	846
297	Ga0265313_10019210	3300031595	Bacteria	3812
298	Ga0265313_10135003	3300031595	Bacteria	1066
299	Ga0265314_10248641	3300031711	Bacteria	1022
300	Ga0265342_10056157	3300031712	Bacteria	2335
301	Ga0307416_101125743	3300032002	Bacteria	890
302	Ga0373953_0184072	3300035117	Archaea	902
303	Ga0373943_0286860	3300035170	Bacteria	932
304	Ga0373955_0151207	3300035172	Bacteria	1366
305	Ga0373942_0089955	3300035207	Bacteria	924
306	Ga0373924_0098038	3300035410	Bacteria	1259
307	Ga0373935_0331930	3300035692	Bacteria	1081
308	Ga0373935_1006143	3300035692	Bacteria	619
309	Ga0373933_0100901	3300035724	Bacteria	1791
310	Ga0373947_0658574	3300035725	Bacteria	714
311	Ga0373947_0778945	3300035725	Bacteria	653
312	Ga0373937_0258357	3300036401	Bacteria	1642
313	Ga0373937_2165437	3300036401	Bacteria	502
314	Ga0373925_0577542	3300037068	Bacteria	925
315	Ga0395899_0110817	3300037312	Bacteria	1974
316	Ga0395899_0433940	3300037312	Bacteria	863
317	Ga0395900_0073679	3300037418	Bacteria	3511
318	Ga0395900_0074692	3300037418	Bacteria	3485
319	Ga0395900_0250871	3300037418	Bacteria	1771
320	Ga0395898_0050584	3300037466	Bacteria	4066
321	Ga0395898_0243815	3300037466	Bacteria	1714
322	Ga0395898_0751038	3300037466	Bacteria	917
323	Ga0395898_0878275	3300037466	Bacteria	835
324	Ga0395905_0133148	3300037471	Bacteria	2338
325	Ga0395905_1121935	3300037471	Bacteria	690
326	Ga0395905_1259958	3300037471	Bacteria	643
327	Ga0395905_1684383	3300037471	Bacteria	539
328	Ga0436364_0134103	3300037853	Bacteria	1545
329	Ga0395901_0031034	3300038443	Bacteria	5509
330	Ga0395901_0038874	3300038443	Bacteria	4922
331	Ga0395901_0149771	3300038443	Bacteria	2452
332	Ga0395901_0247231	3300038443	Bacteria	1859
333	Ga0395901_0379345	3300038443	Bacteria	1455
334	Ga0395901_0470438	3300038443	Bacteria	1283
335	Ga0395901_0908103	3300038443	Bacteria	862
336	Ga0395901_1231291	3300038443	Bacteria	713
337	Ga0436365_1616725	3300039437	Bacteria	1370
338	Ga0436363_0383435	3300039450	Unclassified	1080
339	Ga0439438_008793	3300041405	Bacteria	3316
340	Ga0439461_0003095	3300041410	Bacteria	2712
341	Ga0451841_0205042	3300041498	Unclassified	610
342	Ga0451853_4038478	3300041512	Bacteria	647
343	Ga0439448_0122518	3300042005	Unclassified	893
344	Ga0450898_118792	3300042134	Bacteria	563
345	Ga0439446_0003346	3300042156	Bacteria	3968
346	Ga0439434_0019064	3300042435	Bacteria	2056
347	Ga0466966_0250324	3300044684	Bacteria	1067
348	Ga0466961_0003867	3300044693	Bacteria	9361
349	Ga0466961_0277340	3300044693	Bacteria	1026
350	Ga0466963_0000006	3300044694	Bacteria	89515
351	Ga0466963_0012646	3300044694	Bacteria	5170
352	Ga0466963_0958035	3300044694	Bacteria	603
353	Ga0466963_1212821	3300044694	Bacteria	530
354	Ga0466964_0092071	3300044706	Bacteria	1321
355	Ga0466968_0040443	3300044735	Bacteria	1966
356	Ga0466957_0102116	3300044842	Bacteria	1809
357	Ga0466957_0336788	3300044842	Bacteria	1021
358	Ga0466959_0010168	3300045049	Bacteria	6716
359	Ga0466959_0071918	3300045049	Bacteria	2504
360	Ga0466959_0809549	3300045049	Unclassified	626
361	Ga0466958_0003079	3300045836	Bacteria	8553
362	Ga0466967_0000231	3300045976	Bacteria	24177
363	Ga0466967_0079155	3300045976	Bacteria	2962
364	Ga0466967_0111930	3300045976	Bacteria	2509
365	Ga0466967_0243188	3300045976	Bacteria	1717
366	Ga0466967_1534881	3300045976	Bacteria	663
367	Ga0495592_0229421	3300046454	Unclassified	1237
368	Ga0495603_0113839	3300046455	Bacteria	1577
369	Ga0495591_155286	3300046458	Bacteria	549
370	Ga0495629_0067488	3300046459	Bacteria	2496
371	Ga0495629_0464443	3300046459	Bacteria	856
372	Ga0495641_0045659	3300046461	Bacteria	2017
373	Ga0495651_0057737	3300046462	Bacteria	2979
374	Ga0495653_0021709	3300046463	Bacteria	5199
375	Ga0495653_0078382	3300046463	Unclassified	2450
376	Ga0495580_0383151	3300046472	Bacteria	950
377	Ga0495582_0035727	3300046473	Bacteria	2733
378	Ga0495582_0715688	3300046473	Unclassified	579
379	Ga0495605_0054459	3300046474	Bacteria	1937
380	Ga0495639_0092371	3300046475	Bacteria	1421
381	Ga0495639_0166697	3300046475	Bacteria	1068
382	Ga0495584_0144737	3300046491	Unclassified	1207
383	Ga0495585_0471272	3300046492	Unclassified	599
384	Ga0495594_0176869	3300046499	Bacteria	1214
385	Ga0495607_0051689	3300046501	Bacteria	2385
386	Ga0495607_0377777	3300046501	Unclassified	649
387	Ga0495608_0250383	3300046511	Bacteria	1105
388	Ga0495608_0517504	3300046511	Bacteria	721
389	Ga0495616_0320410	3300046513	Unclassified	651
390	Ga0495618_0461466	3300046514	Bacteria	770
391	Ga0495628_0289161	3300046516	Bacteria	1215
392	Ga0495630_1170383	3300046517	Bacteria	582
393	Ga0495631_0115190	3300046518	Unclassified	1156
394	Ga0495631_0317334	3300046518	Bacteria	663
395	Ga0495637_0286402	3300046520	Unclassified	587
396	Ga0495644_0036135	3300046523	Unclassified	1864
397	Ga0495644_0153544	3300046523	Unclassified	882
398	Ga0495663_0087895	3300046525	Unclassified	1009
399	Ga0495663_0242102	3300046525	Bacteria	638
400	Ga0495642_0036625	3300046528	Unclassified	1983
401	Ga0495642_0412310	3300046528	Unclassified	596
402	Ga0495652_0154540	3300046529	Bacteria	1788
403	Ga0495652_0286437	3300046529	Bacteria	1204
404	Ga0495665_0663735	3300046531	Bacteria	518
405	Ga0495598_0052433	3300046537	Bacteria	1232
406	Ga0495598_0195062	3300046537	Unclassified	729
407	Ga0495609_0190667	3300046538	Unclassified	860
408	Ga0495633_0494894	3300046558	Bacteria	551
409	Ga0495667_0056305	3300046559	Bacteria	2586
410	Ga0495656_0027868	3300046615	Bacteria	2260
411	Ga0495668_0279222	3300046616	Unclassified	915
412	Ga0495634_0094917	3300046642	Bacteria	1932
413	Ga0495611_0260552	3300046648	Unclassified	803
414	Ga0495659_0319984	3300046664	Unclassified	658
415	Ga0495661_0166088	3300046665	Bacteria	1181
416	Ga0495661_0273069	3300046665	Bacteria	855
417	Ga0495588_0058487	3300046674	Bacteria	1993
418	Ga0495588_0314574	3300046674	Unclassified	824
419	Ga0495657_0016614	3300046675	Bacteria	5360
420	Ga0495657_0264633	3300046675	Bacteria	1032
421	Ga0495657_0736655	3300046675	Bacteria	565
422	Ga0495623_0229846	3300046679	Bacteria	1053
423	Ga0495647_0204295	3300046681	Bacteria	867
424	Ga0495658_0153703	3300046683	Bacteria	1415
425	Ga0495658_0219093	3300046683	Unclassified	1191
426	Ga0495669_0213217	3300046684	Unclassified	925
427	Ga0495669_0225942	3300046684	Bacteria	898
428	Ga0495613_0419684	3300046689	Bacteria	910
429	Ga0495624_0196895	3300046690	Bacteria	1225
430	Ga0495670_0161590	3300046691	Unclassified	1177
431	Ga0495589_0122323	3300046794	Unclassified	1253
432	Ga0495600_0131484	3300046809	Bacteria	1627
433	Ga0495600_0300436	3300046809	Unclassified	1013
434	Ga0495581_0033808	3300047315	Bacteria	2959
435	Ga0495581_0192074	3300047315	Bacteria	1194
436	Ga0495636_0314015	3300047318	Bacteria	735
437	Ga0495676_0112055	3300047321	Bacteria	2000
438	Ga0495680_0009986	3300047322	Bacteria	8495
439	Ga0495683_0431728	3300047323	Unclassified	543
440	Ga0495677_0029307	3300047445	Bacteria	2001
441	Ga0495677_0056958	3300047445	Unclassified	1444
442	Ga0495679_201321	3300047446	Bacteria	523
443	Ga0495685_083442	3300047447	Bacteria	1063
444	Ga0495602_0164739	3300048088	Bacteria	1727
445	Ga0496100_0008087	3300048903	Bacteria	5849
446	Ga0496100_0023691	3300048903	Bacteria	3733
447	Ga0496100_0073645	3300048903	Bacteria	2286
448	Ga0496100_0218315	3300048903	Bacteria	1398
449	Ga0496101_0008141	3300048904	Bacteria	6843
450	Ga0496101_0077440	3300048904	Bacteria	2450
451	Ga0496101_0118131	3300048904	Bacteria	2003
452	Ga0496101_0130300	3300048904	Bacteria	1909
453	Ga0496101_0584301	3300048904	Bacteria	883
454	Ga0496101_0822319	3300048904	Bacteria	732
455	Ga0496102_0021551	3300048905	Bacteria	5699
456	Ga0496102_0277814	3300048905	Bacteria	1579
457	Ga0496102_0430713	3300048905	Bacteria	1238
458	Ga0496103_0001171	3300048906	Bacteria	18044
459	Ga0496103_0726868	3300048906	Unclassified	629
460	Ga0496104_0001428	3300048907	Bacteria	20678
461	Ga0496104_0049469	3300048907	Bacteria	3964
462	Ga0496104_0376973	3300048907	Bacteria	1331
463	Ga0496105_0003075	3300048908	Bacteria	12268
464	Ga0496105_0109330	3300048908	Bacteria	2282
465	Ga0496105_0801489	3300048908	Bacteria	716
466	Ga0496105_1219806	3300048908	Bacteria	553
467	Ga0496106_0003735	3300048909	Bacteria	11359
468	Ga0496106_0005883	3300048909	Bacteria	9068
469	Ga0496106_0110624	3300048909	Bacteria	2139
470	Ga0496106_0458877	3300048909	Bacteria	1023
471	Ga0496107_0000731	3300048910	Bacteria	18789
472	Ga0496107_0001236	3300048910	Bacteria	15609
473	Ga0496107_0003922	3300048910	Bacteria	10000
474	Ga0496107_0048525	3300048910	Bacteria	3059
475	Ga0496108_0007697	3300048911	Bacteria	8727
476	Ga0496108_0098150	3300048911	Bacteria	2496
477	Ga0496108_0177708	3300048911	Bacteria	1843
478	Ga0496108_0414368	3300048911	Bacteria	1177
479	Ga0496109_0013979	3300048912	Bacteria	6979
480	Ga0496109_0017246	3300048912	Bacteria	6327
481	Ga0496109_0035387	3300048912	Bacteria	4504
482	Ga0496110_0017920	3300048913	Bacteria	5930
483	Ga0496110_0035131	3300048913	Bacteria	4347
484	Ga0496110_1655699	3300048913	Unclassified	550
485	Ga0496111_0001758	3300048914	Bacteria	12683
486	Ga0496111_0023970	3300048914	Bacteria	4290
487	Ga0496111_0449831	3300048914	Bacteria	950
488	Ga0496112_0007804	3300048915	Bacteria	9524
489	Ga0496112_0145125	3300048915	Bacteria	2341
490	Ga0496112_0345274	3300048915	Bacteria	1431
491	Ga0496112_0390171	3300048915	Bacteria	1333
492	Ga0496112_0774077	3300048915	Bacteria	885
493	Ga0496112_1830771	3300048915	Unclassified	519
494	Ga0496113_0047276	3300048916	Bacteria	3197
495	Ga0496113_0062368	3300048916	Bacteria	2815
496	Ga0496113_0066953	3300048916	Bacteria	2722
497	Ga0496113_0508637	3300048916	Bacteria	967
498	Ga0496114_0001048	3300048917	Bacteria	20763
499	Ga0496114_0004003	3300048917	Bacteria	11385
500	Ga0496114_0084525	3300048917	Bacteria	2687
501	Ga0496114_1611424	3300048917	Bacteria	537
502	Ga0496115_0000885	3300048918	Bacteria	21776
503	Ga0496115_0048323	3300048918	Bacteria	3403
504	Ga0496115_0066563	3300048918	Bacteria	2912
505	Ga0496115_0089466	3300048918	Bacteria	2514
506	Ga0496115_0216493	3300048918	Bacteria	1581
507	Ga0496115_0868487	3300048918	Bacteria	697
508	Ga0501031_0008660	3300049568	Bacteria	6617
509	Ga0501032_0013232	3300049569	Bacteria	5871
510	Ga0501033_0002324	3300049570	Bacteria	16197
511	Ga0501033_0627172	3300049570	Unclassified	736
512	Ga0501034_1224112	3300049571	Bacteria	629
513	Ga0501036_0001238	3300049572	Bacteria	19518
514	Ga0501037_0007588	3300049573	Bacteria	7941
515	Ga0501038_0003492	3300049574	Bacteria	14650
516	Ga0501039_0002841	3300049575	Bacteria	12938
517	Ga0501040_0059918	3300049576	Bacteria	2615
518	Ga0501041_0012605	3300049577	Bacteria	5007
519	Ga0501042_0130706	3300049578	Bacteria	1809
520	Ga0501043_0012065	3300049579	Bacteria	6757
521	Ga0501046_0026784	3300049580	Bacteria	4708
522	Ga0501047_0785614	3300049581	Bacteria	767
523	Ga0501048_0007605	3300049582	Bacteria	8215
524	Ga0501068_0007410	3300049584	Bacteria	6075
525	Ga0501069_0000447	3300049585	Bacteria	18775
526	Ga0501069_0463522	3300049585	Bacteria	754
527	Ga0501069_0507855	3300049585	Bacteria	719
528	Ga0501070_0013760	3300049586	Bacteria	6815
529	Ga0501071_0008980	3300049587	Bacteria	6632
530	Ga0501072_0053296	3300049588	Bacteria	3185
531	Ga0501073_0003867	3300049589	Bacteria	11246
532	Ga0501074_0050958	3300049590	Bacteria	2987
533	Ga0501074_0634565	3300049590	Bacteria	755
534	Ga0501075_0108946	3300049591	Bacteria	2105
535	Ga0501075_1480903	3300049591	Unclassified	514
536	Ga0501076_0016975	3300049592	Bacteria	5525
537	Ga0501077_0050974	3300049593	Bacteria	2630
538	Ga0501079_0065935	3300049741	Bacteria	2793
539	Ga0501080_0013628	3300049742	Bacteria	7486
540	Ga0501081_0023960	3300049743	Bacteria	4094
541	Ga0501083_0003188	3300049744	Bacteria	11423
542	Ga0501035_0009832	3300049822	Bacteria	8885
543	Ga0501044_0055544	3300049823	Bacteria	4067
544	Ga0501045_0002107	3300049824	Bacteria	13457
545	nmdc:mga0rr50_1297967_c1	3300050513	Bacteria	617
546	nmdc:mga0a205_346971_c1	3300050515	Bacteria	1352
547	Ga0495655_0043622	3300053083	Unclassified	1157
548	Ga0501084_0108109	3300054114	Bacteria	2336
549	Ga0501084_0641962	3300054114	Unclassified	896
550	Ga0501082_0127022	3300060353	Bacteria	2211
551	Ga0501082_1339070	3300060353	Unclassified	625
552	Ga0530510_0015100	3300061734	Bacteria	5454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300013105	Ga0157369_10039184	Ga0157369_100391846	86
2	3300025921	Ga0207652_11834495	Ga0207652_118344951	88
3	3300049570	Ga0501033_0627172	Ga0501033_0627172_295_573	89
4	3300049591	Ga0501075_1480903	Ga0501075_1480903_94_372	89
5	3300054114	Ga0501084_0641962	Ga0501084_0641962_219_497	89
6	3300060353	Ga0501082_1339070	Ga0501082_1339070_100_378	89
7	3300005339	Ga0070660_100870576	Ga0070660_1008705762	90
8	3300005437	Ga0070710_10265218	Ga0070710_102652182	90
9	3300005530	Ga0070679_101644584	Ga0070679_1016445841	90
10	3300005937	Ga0081455_10287982	Ga0081455_102879822	90
11	3300009551	Ga0105238_11974656	Ga0105238_119746561	90
12	3300036401	Ga0373937_2165437	Ga0373937_2165437_57_329	90
13	3300037312	Ga0395899_0110817	Ga0395899_0110817_863_1144	90
14	3300037312	Ga0395899_0433940	Ga0395899_0433940_452_733	90
15	3300037418	Ga0395900_0073679	Ga0395900_0073679_1034_1315	90
16	3300037418	Ga0395900_0074692	Ga0395900_0074692_42_323	90
17	3300037466	Ga0395898_0243815	Ga0395898_0243815_1212_1493	90
18	3300037471	Ga0395905_1121935	Ga0395905_1121935_171_452	90
19	3300037471	Ga0395905_1684383	Ga0395905_1684383_183_464	90
20	3300038443	Ga0395901_0031034	Ga0395901_0031034_4883_5164	90
21	3300038443	Ga0395901_0149771	Ga0395901_0149771_120_401	90
22	3300046463	Ga0495653_0078382	Ga0495653_0078382_653_925	90
23	3300046511	Ga0495608_0250383	Ga0495608_0250383_493_765	90
24	3300046675	Ga0495657_0264633	Ga0495657_0264633_124_396	90
25	3300046675	Ga0495657_0736655	Ga0495657_0736655_22_294	90
26	3300046809	Ga0495600_0300436	Ga0495600_0300436_197_469	90
27	3300048915	Ga0496112_0007804	Ga0496112_0007804_1445_1726	90
28	3300048915	Ga0496112_0390171	Ga0496112_0390171_166_447	90
29	3300005436	Ga0070713_100071531	Ga0070713_1000715313	91
30	3300005441	Ga0070700_101636848	Ga0070700_1016368481	91
31	3300005468	Ga0070707_100261785	Ga0070707_1002617853	91
32	3300009545	Ga0105237_11890058	Ga0105237_118900581	91
33	3300013296	Ga0157374_10024720	Ga0157374_100247205	91
34	3300020070	Ga0206356_11647156	Ga0206356_116471562	91
35	3300028563	Ga0265319_1220348	Ga0265319_12203482	91
36	3300028666	Ga0265336_10002195	Ga0265336_100021953	91
37	3300028666	Ga0265336_10032594	Ga0265336_100325942	91
38	3300031251	Ga0265327_10040368	Ga0265327_100403682	91
39	3300031595	Ga0265313_10019210	Ga0265313_100192102	91
40	3300037471	Ga0395905_1259958	Ga0395905_1259958_90_374	91
41	3300038443	Ga0395901_0908103	Ga0395901_0908103_362_646	91
42	3300044694	Ga0466963_0000006	Ga0466963_0000006_80609_80884	91
43	3300044706	Ga0466964_0092071	Ga0466964_0092071_960_1235	91
44	3300044842	Ga0466957_0102116	Ga0466957_0102116_398_673	91
45	3300045836	Ga0466958_0003079	Ga0466958_0003079_8057_8332	91
46	3300045976	Ga0466967_0000231	Ga0466967_0000231_10094_10369	91
47	3300045976	Ga0466967_0079155	Ga0466967_0079155_921_1196	91
48	3300046514	Ga0495618_0461466	Ga0495618_0461466_277_552	91
49	3300048903	Ga0496100_0218315	Ga0496100_0218315_1109_1387	91
50	3300048904	Ga0496101_0118131	Ga0496101_0118131_729_1007	91
51	3300048908	Ga0496105_0801489	Ga0496105_0801489_213_491	91
52	3300048915	Ga0496112_1830771	Ga0496112_1830771_220_501	91
53	3300048917	Ga0496114_1611424	Ga0496114_1611424_38_316	91
54	3300048918	Ga0496115_0066563	Ga0496115_0066563_852_1130	91
55	3300048918	Ga0496115_0216493	Ga0496115_0216493_303_581	91
56	3300005330	Ga0070690_100087408	Ga0070690_1000874082	92
57	3300005333	Ga0070677_10148211	Ga0070677_101482112	92
58	3300005334	Ga0068869_100162886	Ga0068869_1001628862	92
59	3300005334	Ga0068869_100306748	Ga0068869_1003067481	92
60	3300005335	Ga0070666_10108953	Ga0070666_101089532	92
61	3300005336	Ga0070680_100055891	Ga0070680_1000558912	92
62	3300005336	Ga0070680_100877518	Ga0070680_1008775182	92
63	3300005337	Ga0070682_100098180	Ga0070682_1000981802	92
64	3300005337	Ga0070682_101068889	Ga0070682_1010688892	92
65	3300005338	Ga0068868_100001720	Ga0068868_1000017203	92
66	3300005338	Ga0068868_101136519	Ga0068868_1011365191	92
67	3300005340	Ga0070689_100004508	Ga0070689_10000450810	92
68	3300005341	Ga0070691_10183436	Ga0070691_101834362	92
69	3300005341	Ga0070691_10750581	Ga0070691_107505811	92
70	3300005343	Ga0070687_100009004	Ga0070687_1000090042	92
71	3300005343	Ga0070687_100992446	Ga0070687_1009924462	92
72	3300005345	Ga0070692_10011327	Ga0070692_100113273	92
73	3300005347	Ga0070668_100011855	Ga0070668_1000118557	92
74	3300005347	Ga0070668_100884510	Ga0070668_1008845102	92
75	3300005353	Ga0070669_100168101	Ga0070669_1001681012	92
76	3300005354	Ga0070675_101029383	Ga0070675_1010293832	92
77	3300005354	Ga0070675_101357097	Ga0070675_1013570971	92
78	3300005355	Ga0070671_100421551	Ga0070671_1004215512	92
79	3300005356	Ga0070674_100001495	Ga0070674_1000014952	92
80	3300005356	Ga0070674_100075116	Ga0070674_1000751162	92
81	3300005365	Ga0070688_100028815	Ga0070688_1000288154	92
82	3300005365	Ga0070688_101144512	Ga0070688_1011445122	92
83	3300005366	Ga0070659_100053053	Ga0070659_1000530533	92
84	3300005366	Ga0070659_100986739	Ga0070659_1009867392	92
85	3300005406	Ga0070703_10010057	Ga0070703_100100572	92
86	3300005406	Ga0070703_10558170	Ga0070703_105581702	92
87	3300005434	Ga0070709_10966499	Ga0070709_109664991	92
88	3300005435	Ga0070714_100232790	Ga0070714_1002327902	92
89	3300005435	Ga0070714_100347185	Ga0070714_1003471852	92
90	3300005435	Ga0070714_100930682	Ga0070714_1009306822	92
91	3300005436	Ga0070713_100171141	Ga0070713_1001711412	92
92	3300005436	Ga0070713_100606561	Ga0070713_1006065612	92
93	3300005437	Ga0070710_10000694	Ga0070710_100006945	92
94	3300005438	Ga0070701_10000635	Ga0070701_1000063514	92
95	3300005439	Ga0070711_100005165	Ga0070711_1000051657	92
96	3300005439	Ga0070711_100125599	Ga0070711_1001255992	92
97	3300005440	Ga0070705_100031541	Ga0070705_1000315413	92
98	3300005440	Ga0070705_100427036	Ga0070705_1004270362	92
99	3300005441	Ga0070700_100001994	Ga0070700_1000019948	92
100	3300005441	Ga0070700_100067234	Ga0070700_1000672342	92
101	3300005444	Ga0070694_100006493	Ga0070694_1000064936	92
102	3300005445	Ga0070708_100009274	Ga0070708_1000092742	92
103	3300005445	Ga0070708_100555556	Ga0070708_1005555561	92
104	3300005455	Ga0070663_100006086	Ga0070663_1000060863	92
105	3300005456	Ga0070678_100001440	Ga0070678_10000144017	92
106	3300005456	Ga0070678_100163852	Ga0070678_1001638522	92
107	3300005457	Ga0070662_100033632	Ga0070662_1000336323	92
108	3300005457	Ga0070662_100579580	Ga0070662_1005795802	92
109	3300005458	Ga0070681_10550176	Ga0070681_105501762	92
110	3300005459	Ga0068867_100002296	Ga0068867_1000022962	92
111	3300005459	Ga0068867_101311148	Ga0068867_1013111482	92
112	3300005466	Ga0070685_10001240	Ga0070685_1000124012	92
113	3300005467	Ga0070706_100033804	Ga0070706_1000338042	92
114	3300005468	Ga0070707_100007620	Ga0070707_1000076202	92
115	3300005468	Ga0070707_100115509	Ga0070707_1001155094	92
116	3300005471	Ga0070698_100375820	Ga0070698_1003758202	92
117	3300005471	Ga0070698_100765980	Ga0070698_1007659802	92
118	3300005518	Ga0070699_100275671	Ga0070699_1002756712	92
119	3300005518	Ga0070699_100739362	Ga0070699_1007393622	92
120	3300005518	Ga0070699_100793084	Ga0070699_1007930842	92
121	3300005530	Ga0070679_100830390	Ga0070679_1008303902	92
122	3300005535	Ga0070684_100278151	Ga0070684_1002781512	92
123	3300005536	Ga0070697_100101746	Ga0070697_1001017462	92
124	3300005539	Ga0068853_100001846	Ga0068853_10000184614	92
125	3300005543	Ga0070672_100125776	Ga0070672_1001257762	92
126	3300005544	Ga0070686_100000541	Ga0070686_10000054117	92
127	3300005544	Ga0070686_100035773	Ga0070686_1000357734	92
128	3300005544	Ga0070686_100312339	Ga0070686_1003123392	92
129	3300005545	Ga0070695_100263417	Ga0070695_1002634171	92
130	3300005545	Ga0070695_100343787	Ga0070695_1003437872	92
131	3300005546	Ga0070696_100023876	Ga0070696_1000238762	92
132	3300005546	Ga0070696_100033325	Ga0070696_1000333252	92
133	3300005546	Ga0070696_100369646	Ga0070696_1003696462	92
134	3300005546	Ga0070696_101661524	Ga0070696_1016615241	92
135	3300005547	Ga0070693_100004097	Ga0070693_1000040972	92
136	3300005547	Ga0070693_100347193	Ga0070693_1003471932	92
137	3300005549	Ga0070704_100004721	Ga0070704_1000047215	92
138	3300005563	Ga0068855_100078216	Ga0068855_1000782164	92
139	3300005564	Ga0070664_100638538	Ga0070664_1006385382	92
140	3300005577	Ga0068857_100983737	Ga0068857_1009837372	92
141	3300005578	Ga0068854_100054356	Ga0068854_1000543562	92
142	3300005578	Ga0068854_100330261	Ga0068854_1003302612	92
143	3300005614	Ga0068856_100002949	Ga0068856_1000029496	92
144	3300005614	Ga0068856_100050960	Ga0068856_1000509603	92
145	3300005615	Ga0070702_100001525	Ga0070702_1000015255	92
146	3300005615	Ga0070702_100200528	Ga0070702_1002005282	92
147	3300005615	Ga0070702_100586165	Ga0070702_1005861651	92
148	3300005617	Ga0068859_100010474	Ga0068859_10001047411	92
149	3300005618	Ga0068864_101495816	Ga0068864_1014958161	92
150	3300005618	Ga0068864_102513077	Ga0068864_1025130771	92
151	3300005718	Ga0068866_10002187	Ga0068866_100021875	92
152	3300005718	Ga0068866_10396546	Ga0068866_103965462	92
153	3300005719	Ga0068861_100033868	Ga0068861_1000338682	92
154	3300005719	Ga0068861_102366879	Ga0068861_1023668791	92
155	3300005834	Ga0068851_10289554	Ga0068851_102895542	92
156	3300005843	Ga0068860_100034266	Ga0068860_1000342662	92
157	3300005937	Ga0081455_10182617	Ga0081455_101826172	92
158	3300005937	Ga0081455_10695980	Ga0081455_106959802	92
159	3300005985	Ga0081539_10035462	Ga0081539_100354623	92
160	3300006028	Ga0070717_10834212	Ga0070717_108342122	92
161	3300006163	Ga0070715_10177896	Ga0070715_101778962	92
162	3300006173	Ga0070716_100325832	Ga0070716_1003258322	92
163	3300006173	Ga0070716_100516582	Ga0070716_1005165822	92
164	3300006173	Ga0070716_101300683	Ga0070716_1013006832	92
165	3300006175	Ga0070712_100002690	Ga0070712_10000269014	92
166	3300006175	Ga0070712_100406103	Ga0070712_1004061032	92
167	3300006237	Ga0097621_100017319	Ga0097621_1000173196	92
168	3300006237	Ga0097621_101381665	Ga0097621_1013816651	92
169	3300006358	Ga0068871_100019042	Ga0068871_1000190422	92
170	3300006880	Ga0075429_101020436	Ga0075429_1010204362	92
171	3300006880	Ga0075429_101833663	Ga0075429_1018336631	92
172	3300006881	Ga0068865_100000372	Ga0068865_1000003726	92
173	3300006881	Ga0068865_100132297	Ga0068865_1001322972	92
174	3300006881	Ga0068865_100618084	Ga0068865_1006180842	92
175	3300006881	Ga0068865_101476239	Ga0068865_1014762392	92
176	3300006931	Ga0097620_100010474	Ga0097620_10001047411	92
177	3300009094	Ga0111539_10980297	Ga0111539_109802972	92
178	3300009098	Ga0105245_10003696	Ga0105245_100036963	92
179	3300009098	Ga0105245_10080646	Ga0105245_100806463	92
180	3300009098	Ga0105245_10116740	Ga0105245_101167402	92
181	3300009101	Ga0105247_10068836	Ga0105247_100688362	92
182	3300009148	Ga0105243_10000793	Ga0105243_1000079316	92
183	3300009148	Ga0105243_10229701	Ga0105243_102297011	92
184	3300009148	Ga0105243_10514701	Ga0105243_105147013	92
185	3300009148	Ga0105243_11943220	Ga0105243_119432202	92
186	3300009148	Ga0105243_12149657	Ga0105243_121496571	92
187	3300009174	Ga0105241_10012847	Ga0105241_100128474	92
188	3300009174	Ga0105241_11978024	Ga0105241_119780241	92
189	3300009176	Ga0105242_10013582	Ga0105242_100135825	92
190	3300009176	Ga0105242_10159212	Ga0105242_101592122	92
191	3300009176	Ga0105242_10513060	Ga0105242_105130602	92
192	3300009177	Ga0105248_10107070	Ga0105248_101070705	92
193	3300009177	Ga0105248_10165715	Ga0105248_101657152	92
194	3300009551	Ga0105238_10107073	Ga0105238_101070733	92
195	3300009553	Ga0105249_10001946	Ga0105249_1000194622	92
196	3300009553	Ga0105249_11844591	Ga0105249_118445911	92
197	3300010375	Ga0105239_10002279	Ga0105239_1000227918	92
198	3300010375	Ga0105239_10234686	Ga0105239_102346862	92
199	3300011119	Ga0105246_10198563	Ga0105246_101985633	92
200	3300011119	Ga0105246_10235591	Ga0105246_102355912	92
201	3300012494	Ga0157341_1003483	Ga0157341_10034832	92
202	3300012510	Ga0157316_1025640	Ga0157316_10256402	92
203	3300013100	Ga0157373_11344374	Ga0157373_113443741	92
204	3300013102	Ga0157371_10447808	Ga0157371_104478082	92
205	3300013296	Ga0157374_10074109	Ga0157374_100741092	92
206	3300013296	Ga0157374_10158024	Ga0157374_101580242	92
207	3300013297	Ga0157378_10004177	Ga0157378_1000417717	92
208	3300013306	Ga0163162_10001930	Ga0163162_1000193011	92
209	3300013306	Ga0163162_10482653	Ga0163162_104826532	92
210	3300013308	Ga0157375_10034422	Ga0157375_100344222	92
211	3300013308	Ga0157375_10091117	Ga0157375_100911173	92
212	3300013308	Ga0157375_12155825	Ga0157375_121558252	92
213	3300014325	Ga0163163_11118345	Ga0163163_111183452	92
214	3300014326	Ga0157380_10007997	Ga0157380_100079977	92
215	3300014326	Ga0157380_10016662	Ga0157380_100166625	92
216	3300014326	Ga0157380_10124948	Ga0157380_101249482	92
217	3300014497	Ga0182008_10087488	Ga0182008_100874882	92
218	3300014745	Ga0157377_10022629	Ga0157377_100226292	92
219	3300014745	Ga0157377_11598335	Ga0157377_115983351	92
220	3300014968	Ga0157379_10215156	Ga0157379_102151562	92
221	3300014968	Ga0157379_10523036	Ga0157379_105230362	92
222	3300014969	Ga0157376_10002471	Ga0157376_100024713	92
223	3300014969	Ga0157376_10534642	Ga0157376_105346422	92
224	3300014969	Ga0157376_10698182	Ga0157376_106981822	92
225	3300014969	Ga0157376_11803589	Ga0157376_118035892	92
226	3300017792	Ga0163161_10281659	Ga0163161_102816592	92
227	3300021388	Ga0213875_10095257	Ga0213875_100952572	92
228	3300025321	Ga0207656_10194105	Ga0207656_101941052	92
229	3300025885	Ga0207653_10013826	Ga0207653_100138263	92
230	3300025893	Ga0207682_10432640	Ga0207682_104326402	92
231	3300025898	Ga0207692_10005865	Ga0207692_100058657	92
232	3300025899	Ga0207642_10000288	Ga0207642_1000028817	92
233	3300025900	Ga0207710_10049006	Ga0207710_100490063	92
234	3300025901	Ga0207688_10037492	Ga0207688_100374922	92
235	3300025901	Ga0207688_10875878	Ga0207688_108758782	92
236	3300025905	Ga0207685_10070605	Ga0207685_100706053	92
237	3300025906	Ga0207699_10033220	Ga0207699_100332203	92
238	3300025906	Ga0207699_10494369	Ga0207699_104943692	92
239	3300025906	Ga0207699_11138295	Ga0207699_111382951	92
240	3300025907	Ga0207645_10167336	Ga0207645_101673363	92
241	3300025910	Ga0207684_10079460	Ga0207684_100794602	92
242	3300025911	Ga0207654_10008658	Ga0207654_100086583	92
243	3300025912	Ga0207707_10459013	Ga0207707_104590132	92
244	3300025915	Ga0207693_10002317	Ga0207693_100023177	92
245	3300025915	Ga0207693_10004482	Ga0207693_100044822	92
246	3300025915	Ga0207693_10599487	Ga0207693_105994872	92
247	3300025915	Ga0207693_10665144	Ga0207693_106651442	92
248	3300025916	Ga0207663_10276802	Ga0207663_102768022	92
249	3300025916	Ga0207663_11233439	Ga0207663_112334391	92
250	3300025917	Ga0207660_10069124	Ga0207660_100691242	92
251	3300025917	Ga0207660_10224387	Ga0207660_102243872	92
252	3300025918	Ga0207662_10011413	Ga0207662_100114132	92
253	3300025922	Ga0207646_10003386	Ga0207646_100033862	92
254	3300025922	Ga0207646_10158300	Ga0207646_101583002	92
255	3300025922	Ga0207646_11547491	Ga0207646_115474912	92
256	3300025927	Ga0207687_10032358	Ga0207687_100323583	92
257	3300025927	Ga0207687_10851849	Ga0207687_108518492	92
258	3300025928	Ga0207700_10157542	Ga0207700_101575422	92
259	3300025928	Ga0207700_10453187	Ga0207700_104531872	92
260	3300025929	Ga0207664_10204055	Ga0207664_102040552	92
261	3300025929	Ga0207664_10348747	Ga0207664_103487472	92
262	3300025931	Ga0207644_10016684	Ga0207644_100166844	92
263	3300025931	Ga0207644_10659412	Ga0207644_106594122	92
264	3300025931	Ga0207644_11474324	Ga0207644_114743241	92
265	3300025932	Ga0207690_10150627	Ga0207690_101506271	92
266	3300025933	Ga0207706_10098767	Ga0207706_100987674	92
267	3300025933	Ga0207706_11140347	Ga0207706_111403472	92
268	3300025934	Ga0207686_10014409	Ga0207686_100144095	92
269	3300025935	Ga0207709_10001055	Ga0207709_1000105513	92
270	3300025935	Ga0207709_10097882	Ga0207709_100978822	92
271	3300025935	Ga0207709_10511789	Ga0207709_105117891	92
272	3300025936	Ga0207670_10054576	Ga0207670_100545762	92
273	3300025937	Ga0207669_10017563	Ga0207669_100175634	92
274	3300025937	Ga0207669_10052208	Ga0207669_100522082	92
275	3300025937	Ga0207669_10258552	Ga0207669_102585523	92
276	3300025938	Ga0207704_10003364	Ga0207704_100033644	92
277	3300025938	Ga0207704_10128535	Ga0207704_101285352	92
278	3300025938	Ga0207704_10152686	Ga0207704_101526863	92
279	3300025938	Ga0207704_10480412	Ga0207704_104804122	92
280	3300025939	Ga0207665_10066145	Ga0207665_100661452	92
281	3300025939	Ga0207665_10133570	Ga0207665_101335702	92
282	3300025939	Ga0207665_10884237	Ga0207665_108842371	92
283	3300025940	Ga0207691_10005679	Ga0207691_100056796	92
284	3300025941	Ga0207711_10018927	Ga0207711_100189273	92
285	3300025941	Ga0207711_10117670	Ga0207711_101176704	92
286	3300025942	Ga0207689_10205878	Ga0207689_102058782	92
287	3300025942	Ga0207689_10408976	Ga0207689_104089762	92
288	3300025960	Ga0207651_10092306	Ga0207651_100923062	92
289	3300025961	Ga0207712_10001816	Ga0207712_1000181618	92
290	3300025961	Ga0207712_10356783	Ga0207712_103567832	92
291	3300025961	Ga0207712_11138391	Ga0207712_111383912	92
292	3300025972	Ga0207668_10143105	Ga0207668_101431053	92
293	3300025981	Ga0207640_10879464	Ga0207640_108794642	92
294	3300025981	Ga0207640_10953481	Ga0207640_109534811	92
295	3300026023	Ga0207677_10565857	Ga0207677_105658571	92
296	3300026023	Ga0207677_10572850	Ga0207677_105728502	92
297	3300026035	Ga0207703_11635079	Ga0207703_116350792	92
298	3300026041	Ga0207639_10032728	Ga0207639_100327285	92
299	3300026067	Ga0207678_10016091	Ga0207678_100160912	92
300	3300026067	Ga0207678_10220693	Ga0207678_102206933	92
301	3300026075	Ga0207708_10000064	Ga0207708_1000006419	92
302	3300026075	Ga0207708_10015142	Ga0207708_100151425	92
303	3300026078	Ga0207702_10029887	Ga0207702_100298875	92
304	3300026089	Ga0207648_10000958	Ga0207648_1000095817	92
305	3300026089	Ga0207648_10039576	Ga0207648_100395763	92
306	3300026095	Ga0207676_11248804	Ga0207676_112488041	92
307	3300026095	Ga0207676_11727234	Ga0207676_117272341	92
308	3300026116	Ga0207674_11796622	Ga0207674_117966222	92
309	3300026118	Ga0207675_100050414	Ga0207675_1000504142	92
310	3300026118	Ga0207675_100183766	Ga0207675_1001837662	92
311	3300026121	Ga0207683_10000450	Ga0207683_1000045023	92
312	3300026121	Ga0207683_10486910	Ga0207683_104869102	92
313	3300026121	Ga0207683_10560275	Ga0207683_105602752	92
314	3300026142	Ga0207698_10164629	Ga0207698_101646292	92
315	3300027695	Ga0209966_1047134	Ga0209966_10471342	92
316	3300028379	Ga0268266_10065607	Ga0268266_100656073	92
317	3300028380	Ga0268265_10333829	Ga0268265_103338293	92
318	3300028381	Ga0268264_10061866	Ga0268264_100618662	92
319	3300028558	Ga0265326_10208229	Ga0265326_102082292	92
320	3300028563	Ga0265319_1034231	Ga0265319_10342312	92
321	3300028573	Ga0265334_10044883	Ga0265334_100448832	92
322	3300028577	Ga0265318_10235670	Ga0265318_102356702	92
323	3300028577	Ga0265318_10296825	Ga0265318_102968251	92
324	3300028653	Ga0265323_10215019	Ga0265323_102150192	92
325	3300028666	Ga0265336_10196008	Ga0265336_101960082	92
326	3300028800	Ga0265338_10031209	Ga0265338_100312097	92
327	3300028800	Ga0265338_10040106	Ga0265338_100401063	92
328	3300031235	Ga0265330_10195826	Ga0265330_101958261	92
329	3300031240	Ga0265320_10203601	Ga0265320_102036012	92
330	3300031240	Ga0265320_10206061	Ga0265320_102060612	92
331	3300031241	Ga0265325_10511605	Ga0265325_105116051	92
332	3300031247	Ga0265340_10161358	Ga0265340_101613582	92
333	3300031247	Ga0265340_10166836	Ga0265340_101668362	92
334	3300031344	Ga0265316_10523407	Ga0265316_105234072	92
335	3300031595	Ga0265313_10135003	Ga0265313_101350032	92
336	3300031711	Ga0265314_10248641	Ga0265314_102486412	92
337	3300031712	Ga0265342_10056157	Ga0265342_100561572	92
338	3300032002	Ga0307416_101125743	Ga0307416_1011257432	92
339	3300035117	Ga0373953_0184072	Ga0373953_0184072_46_324	92
340	3300035170	Ga0373943_0286860	Ga0373943_0286860_363_641	92
341	3300035172	Ga0373955_0151207	Ga0373955_0151207_429_707	92
342	3300035207	Ga0373942_0089955	Ga0373942_0089955_100_378	92
343	3300035410	Ga0373924_0098038	Ga0373924_0098038_285_563	92
344	3300035692	Ga0373935_0331930	Ga0373935_0331930_100_384	92
345	3300035692	Ga0373935_1006143	Ga0373935_1006143_198_476	92
346	3300035724	Ga0373933_0100901	Ga0373933_0100901_1226_1504	92
347	3300035725	Ga0373947_0658574	Ga0373947_0658574_291_569	92
348	3300035725	Ga0373947_0778945	Ga0373947_0778945_179_460	92
349	3300036401	Ga0373937_0258357	Ga0373937_0258357_1301_1579	92
350	3300037068	Ga0373925_0577542	Ga0373925_0577542_138_416	92
351	3300037418	Ga0395900_0250871	Ga0395900_0250871_320_598	92
352	3300037466	Ga0395898_0050584	Ga0395898_0050584_579_857	92
353	3300037466	Ga0395898_0751038	Ga0395898_0751038_607_885	92
354	3300037466	Ga0395898_0878275	Ga0395898_0878275_191_472	92
355	3300037471	Ga0395905_0133148	Ga0395905_0133148_1884_2165	92
356	3300037853	Ga0436364_0134103	Ga0436364_0134103_782_1063	92
357	3300038443	Ga0395901_0038874	Ga0395901_0038874_3452_3730	92
358	3300038443	Ga0395901_0247231	Ga0395901_0247231_10_291	92
359	3300038443	Ga0395901_0379345	Ga0395901_0379345_450_728	92
360	3300038443	Ga0395901_0470438	Ga0395901_0470438_110_391	92
361	3300038443	Ga0395901_1231291	Ga0395901_1231291_309_587	92
362	3300039437	Ga0436365_1616725	Ga0436365_1616725_336_617	92
363	3300039450	Ga0436363_0383435	Ga0436363_0383435_578_859	92
364	3300041405	Ga0439438_008793	Ga0439438_008793_2300_2578	92
365	3300041410	Ga0439461_0003095	Ga0439461_0003095_1768_2046	92
366	3300041498	Ga0451841_0205042	Ga0451841_0205042_20_298	92
367	3300041512	Ga0451853_4038478	Ga0451853_4038478_80_358	92
368	3300042005	Ga0439448_0122518	Ga0439448_0122518_466_876	92
369	3300042134	Ga0450898_118792	Ga0450898_118792_115_393	92
370	3300042156	Ga0439446_0003346	Ga0439446_0003346_1485_1763	92
371	3300042435	Ga0439434_0019064	Ga0439434_0019064_201_479	92
372	3300044684	Ga0466966_0250324	Ga0466966_0250324_581_862	92
373	3300044693	Ga0466961_0003867	Ga0466961_0003867_1526_1804	92
374	3300044693	Ga0466961_0277340	Ga0466961_0277340_605_883	92
375	3300044694	Ga0466963_0012646	Ga0466963_0012646_4471_4749	92
376	3300044694	Ga0466963_0958035	Ga0466963_0958035_100_387	92
377	3300044694	Ga0466963_1212821	Ga0466963_1212821_59_340	92
378	3300044735	Ga0466968_0040443	Ga0466968_0040443_1425_1703	92
379	3300044842	Ga0466957_0336788	Ga0466957_0336788_549_827	92
380	3300045049	Ga0466959_0010168	Ga0466959_0010168_3467_3745	92
381	3300045049	Ga0466959_0071918	Ga0466959_0071918_1330_1608	92
382	3300045049	Ga0466959_0809549	Ga0466959_0809549_23_301	92
383	3300045976	Ga0466967_0111930	Ga0466967_0111930_1291_1572	92
384	3300045976	Ga0466967_0243188	Ga0466967_0243188_743_1024	92
385	3300045976	Ga0466967_1534881	Ga0466967_1534881_236_514	92
386	3300046454	Ga0495592_0229421	Ga0495592_0229421_68_346	92
387	3300046455	Ga0495603_0113839	Ga0495603_0113839_218_496	92
388	3300046458	Ga0495591_155286	Ga0495591_155286_136_414	92
389	3300046459	Ga0495629_0067488	Ga0495629_0067488_825_1103	92
390	3300046459	Ga0495629_0464443	Ga0495629_0464443_488_766	92
391	3300046461	Ga0495641_0045659	Ga0495641_0045659_1507_1785	92
392	3300046462	Ga0495651_0057737	Ga0495651_0057737_297_575	92
393	3300046463	Ga0495653_0021709	Ga0495653_0021709_2842_3120	92
394	3300046472	Ga0495580_0383151	Ga0495580_0383151_589_867	92
395	3300046473	Ga0495582_0035727	Ga0495582_0035727_188_466	92
396	3300046473	Ga0495582_0715688	Ga0495582_0715688_41_325	92
397	3300046474	Ga0495605_0054459	Ga0495605_0054459_1266_1544	92
398	3300046475	Ga0495639_0092371	Ga0495639_0092371_720_998	92
399	3300046475	Ga0495639_0166697	Ga0495639_0166697_12_290	92
400	3300046491	Ga0495584_0144737	Ga0495584_0144737_593_871	92
401	3300046492	Ga0495585_0471272	Ga0495585_0471272_92_370	92
402	3300046499	Ga0495594_0176869	Ga0495594_0176869_448_726	92
403	3300046501	Ga0495607_0051689	Ga0495607_0051689_892_1170	92
404	3300046501	Ga0495607_0377777	Ga0495607_0377777_265_543	92
405	3300046511	Ga0495608_0517504	Ga0495608_0517504_70_348	92
406	3300046513	Ga0495616_0320410	Ga0495616_0320410_167_445	92
407	3300046516	Ga0495628_0289161	Ga0495628_0289161_759_1037	92
408	3300046517	Ga0495630_1170383	Ga0495630_1170383_285_563	92
409	3300046518	Ga0495631_0115190	Ga0495631_0115190_59_337	92
410	3300046518	Ga0495631_0317334	Ga0495631_0317334_343_621	92
411	3300046520	Ga0495637_0286402	Ga0495637_0286402_173_451	92
412	3300046523	Ga0495644_0036135	Ga0495644_0036135_235_513	92
413	3300046523	Ga0495644_0153544	Ga0495644_0153544_64_342	92
414	3300046525	Ga0495663_0087895	Ga0495663_0087895_470_748	92
415	3300046525	Ga0495663_0242102	Ga0495663_0242102_136_414	92
416	3300046528	Ga0495642_0036625	Ga0495642_0036625_294_572	92
417	3300046528	Ga0495642_0412310	Ga0495642_0412310_45_323	92
418	3300046529	Ga0495652_0154540	Ga0495652_0154540_409_687	92
419	3300046529	Ga0495652_0286437	Ga0495652_0286437_301_579	92
420	3300046531	Ga0495665_0663735	Ga0495665_0663735_96_374	92
421	3300046537	Ga0495598_0052433	Ga0495598_0052433_472_750	92
422	3300046537	Ga0495598_0195062	Ga0495598_0195062_215_493	92
423	3300046538	Ga0495609_0190667	Ga0495609_0190667_348_626	92
424	3300046558	Ga0495633_0494894	Ga0495633_0494894_144_422	92
425	3300046559	Ga0495667_0056305	Ga0495667_0056305_1183_1461	92
426	3300046615	Ga0495656_0027868	Ga0495656_0027868_622_900	92
427	3300046616	Ga0495668_0279222	Ga0495668_0279222_293_571	92
428	3300046642	Ga0495634_0094917	Ga0495634_0094917_164_442	92
429	3300046648	Ga0495611_0260552	Ga0495611_0260552_190_468	92
430	3300046664	Ga0495659_0319984	Ga0495659_0319984_70_348	92
431	3300046665	Ga0495661_0166088	Ga0495661_0166088_348_626	92
432	3300046665	Ga0495661_0273069	Ga0495661_0273069_13_291	92
433	3300046674	Ga0495588_0058487	Ga0495588_0058487_720_998	92
434	3300046674	Ga0495588_0314574	Ga0495588_0314574_74_352	92
435	3300046675	Ga0495657_0016614	Ga0495657_0016614_2048_2326	92
436	3300046679	Ga0495623_0229846	Ga0495623_0229846_350_628	92
437	3300046681	Ga0495647_0204295	Ga0495647_0204295_22_300	92
438	3300046683	Ga0495658_0153703	Ga0495658_0153703_1116_1394	92
439	3300046683	Ga0495658_0219093	Ga0495658_0219093_837_1121	92
440	3300046684	Ga0495669_0213217	Ga0495669_0213217_582_860	92
441	3300046684	Ga0495669_0225942	Ga0495669_0225942_445_723	92
442	3300046689	Ga0495613_0419684	Ga0495613_0419684_598_876	92
443	3300046690	Ga0495624_0196895	Ga0495624_0196895_394_672	92
444	3300046691	Ga0495670_0161590	Ga0495670_0161590_528_806	92
445	3300046794	Ga0495589_0122323	Ga0495589_0122323_94_372	92
446	3300046809	Ga0495600_0131484	Ga0495600_0131484_526_804	92
447	3300047315	Ga0495581_0033808	Ga0495581_0033808_2620_2898	92
448	3300047315	Ga0495581_0192074	Ga0495581_0192074_311_595	92
449	3300047318	Ga0495636_0314015	Ga0495636_0314015_390_668	92
450	3300047321	Ga0495676_0112055	Ga0495676_0112055_1016_1300	92
451	3300047322	Ga0495680_0009986	Ga0495680_0009986_282_560	92
452	3300047323	Ga0495683_0431728	Ga0495683_0431728_242_520	92
453	3300047445	Ga0495677_0029307	Ga0495677_0029307_521_799	92
454	3300047445	Ga0495677_0056958	Ga0495677_0056958_396_674	92
455	3300047446	Ga0495679_201321	Ga0495679_201321_17_295	92
456	3300047447	Ga0495685_083442	Ga0495685_083442_622_900	92
457	3300048088	Ga0495602_0164739	Ga0495602_0164739_585_863	92
458	3300048903	Ga0496100_0008087	Ga0496100_0008087_5218_5496	92
459	3300048903	Ga0496100_0023691	Ga0496100_0023691_2318_2599	92
460	3300048903	Ga0496100_0073645	Ga0496100_0073645_150_431	92
461	3300048904	Ga0496101_0008141	Ga0496101_0008141_690_971	92
462	3300048904	Ga0496101_0077440	Ga0496101_0077440_392_670	92
463	3300048904	Ga0496101_0130300	Ga0496101_0130300_555_836	92
464	3300048904	Ga0496101_0584301	Ga0496101_0584301_390_668	92
465	3300048904	Ga0496101_0822319	Ga0496101_0822319_71_349	92
466	3300048905	Ga0496102_0021551	Ga0496102_0021551_2073_2354	92
467	3300048905	Ga0496102_0277814	Ga0496102_0277814_427_705	92
468	3300048905	Ga0496102_0430713	Ga0496102_0430713_942_1220	92
469	3300048906	Ga0496103_0001171	Ga0496103_0001171_12549_12827	92
470	3300048906	Ga0496103_0726868	Ga0496103_0726868_85_363	92
471	3300048907	Ga0496104_0001428	Ga0496104_0001428_10583_10864	92
472	3300048907	Ga0496104_0049469	Ga0496104_0049469_1617_1895	92
473	3300048907	Ga0496104_0376973	Ga0496104_0376973_194_472	92
474	3300048908	Ga0496105_0003075	Ga0496105_0003075_3133_3414	92
475	3300048908	Ga0496105_0109330	Ga0496105_0109330_1919_2197	92
476	3300048908	Ga0496105_1219806	Ga0496105_1219806_37_315	92
477	3300048909	Ga0496106_0003735	Ga0496106_0003735_9159_9440	92
478	3300048909	Ga0496106_0005883	Ga0496106_0005883_2123_2404	92
479	3300048909	Ga0496106_0110624	Ga0496106_0110624_399_677	92
480	3300048909	Ga0496106_0458877	Ga0496106_0458877_392_670	92
481	3300048910	Ga0496107_0000731	Ga0496107_0000731_10699_10977	92
482	3300048910	Ga0496107_0001236	Ga0496107_0001236_8572_8853	92
483	3300048910	Ga0496107_0003922	Ga0496107_0003922_83_364	92
484	3300048910	Ga0496107_0048525	Ga0496107_0048525_282_560	92
485	3300048911	Ga0496108_0007697	Ga0496108_0007697_7754_8035	92
486	3300048911	Ga0496108_0098150	Ga0496108_0098150_1398_1676	92
487	3300048911	Ga0496108_0177708	Ga0496108_0177708_382_660	92
488	3300048911	Ga0496108_0414368	Ga0496108_0414368_834_1115	92
489	3300048912	Ga0496109_0013979	Ga0496109_0013979_2187_2468	92
490	3300048912	Ga0496109_0017246	Ga0496109_0017246_2525_2803	92
491	3300048912	Ga0496109_0035387	Ga0496109_0035387_3607_3885	92
492	3300048913	Ga0496110_0017920	Ga0496110_0017920_1199_1477	92
493	3300048913	Ga0496110_0035131	Ga0496110_0035131_1538_1819	92
494	3300048913	Ga0496110_1655699	Ga0496110_1655699_164_442	92
495	3300048914	Ga0496111_0001758	Ga0496111_0001758_7517_7795	92
496	3300048914	Ga0496111_0023970	Ga0496111_0023970_2698_2979	92
497	3300048914	Ga0496111_0449831	Ga0496111_0449831_333_611	92
498	3300048915	Ga0496112_0145125	Ga0496112_0145125_1457_1735	92
499	3300048915	Ga0496112_0345274	Ga0496112_0345274_987_1268	92
500	3300048915	Ga0496112_0774077	Ga0496112_0774077_257_535	92
501	3300048916	Ga0496113_0047276	Ga0496113_0047276_1384_1662	92
502	3300048916	Ga0496113_0062368	Ga0496113_0062368_570_851	92
503	3300048916	Ga0496113_0066953	Ga0496113_0066953_1824_2102	92
504	3300048916	Ga0496113_0508637	Ga0496113_0508637_404_682	92
505	3300048917	Ga0496114_0001048	Ga0496114_0001048_3864_4145	92
506	3300048917	Ga0496114_0004003	Ga0496114_0004003_10754_11032	92
507	3300048917	Ga0496114_0084525	Ga0496114_0084525_2351_2629	92
508	3300048918	Ga0496115_0000885	Ga0496115_0000885_3287_3568	92
509	3300048918	Ga0496115_0048323	Ga0496115_0048323_2222_2500	92
510	3300048918	Ga0496115_0089466	Ga0496115_0089466_732_1010	92
511	3300048918	Ga0496115_0868487	Ga0496115_0868487_246_527	92
512	3300049568	Ga0501031_0008660	Ga0501031_0008660_1433_1714	92
513	3300049569	Ga0501032_0013232	Ga0501032_0013232_1973_2254	92
514	3300049570	Ga0501033_0002324	Ga0501033_0002324_4631_4912	92
515	3300049571	Ga0501034_1224112	Ga0501034_1224112_242_523	92
516	3300049572	Ga0501036_0001238	Ga0501036_0001238_11683_11964	92
517	3300049573	Ga0501037_0007588	Ga0501037_0007588_6097_6378	92
518	3300049574	Ga0501038_0003492	Ga0501038_0003492_6342_6623	92
519	3300049575	Ga0501039_0002841	Ga0501039_0002841_10414_10695	92
520	3300049576	Ga0501040_0059918	Ga0501040_0059918_704_985	92
521	3300049577	Ga0501041_0012605	Ga0501041_0012605_3586_3867	92
522	3300049578	Ga0501042_0130706	Ga0501042_0130706_978_1259	92
523	3300049579	Ga0501043_0012065	Ga0501043_0012065_4731_5012	92
524	3300049580	Ga0501046_0026784	Ga0501046_0026784_2846_3127	92
525	3300049581	Ga0501047_0785614	Ga0501047_0785614_438_719	92
526	3300049582	Ga0501048_0007605	Ga0501048_0007605_1391_1672	92
527	3300049584	Ga0501068_0007410	Ga0501068_0007410_5044_5325	92
528	3300049585	Ga0501069_0000447	Ga0501069_0000447_11759_12040	92
529	3300049585	Ga0501069_0463522	Ga0501069_0463522_85_363	92
530	3300049585	Ga0501069_0507855	Ga0501069_0507855_49_327	92
531	3300049586	Ga0501070_0013760	Ga0501070_0013760_1951_2232	92
532	3300049587	Ga0501071_0008980	Ga0501071_0008980_5121_5402	92
533	3300049588	Ga0501072_0053296	Ga0501072_0053296_1706_1987	92
534	3300049589	Ga0501073_0003867	Ga0501073_0003867_2683_2964	92
535	3300049590	Ga0501074_0050958	Ga0501074_0050958_704_985	92
536	3300049590	Ga0501074_0634565	Ga0501074_0634565_190_471	92
537	3300049591	Ga0501075_0108946	Ga0501075_0108946_1402_1683	92
538	3300049592	Ga0501076_0016975	Ga0501076_0016975_705_986	92
539	3300049593	Ga0501077_0050974	Ga0501077_0050974_978_1259	92
540	3300049741	Ga0501079_0065935	Ga0501079_0065935_1141_1422	92
541	3300049742	Ga0501080_0013628	Ga0501080_0013628_4735_5016	92
542	3300049743	Ga0501081_0023960	Ga0501081_0023960_1939_2220	92
543	3300049744	Ga0501083_0003188	Ga0501083_0003188_3588_3869	92
544	3300049822	Ga0501035_0009832	Ga0501035_0009832_7036_7317	92
545	3300049823	Ga0501044_0055544	Ga0501044_0055544_962_1243	92
546	3300049824	Ga0501045_0002107	Ga0501045_0002107_1875_2156	92
547	3300050513	nmdc:mga0rr50_1297967_c1	nmdc:mga0rr50_1297967_c1_44_325	92
548	3300050515	nmdc:mga0a205_346971_c1	nmdc:mga0a205_346971_c1_775_1053	92
549	3300053083	Ga0495655_0043622	Ga0495655_0043622_692_970	92
550	3300054114	Ga0501084_0108109	Ga0501084_0108109_1372_1653	92
551	3300060353	Ga0501082_0127022	Ga0501082_0127022_732_1013	92
552	3300061734	Ga0530510_0015100	Ga0530510_0015100_732_1013	92

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6ait-assembly1.cif.gz_E	crystal structure of e. coli bepa	0.7909	6	58
6ait-assembly1.cif.gz_F	crystal structure of e. coli bepa	0.7903	6	58
6ait-assembly1.cif.gz_B	crystal structure of e. coli bepa	0.7882	6	58
6ait-assembly1.cif.gz_A	crystal structure of e. coli bepa	0.7851	6	58
6ait-assembly1.cif.gz_D	crystal structure of e. coli bepa	0.7773	6	58

ID	Description	Score	Start	End	Superfamily
af_A0A1D6GXX4_27_139_1.20.140.40	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein	0.8566	18	58	1.20.140.40
af_Q56JH6_26_161_1.20.1250.10	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;	0.8379	17	64	1.20.1250.10
af_A1ZAB5_1100_1343_1.25.40.10	Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain	0.818	21	58	1.25.40.10
af_Q5SSL4_84_282_1.20.900.10	Mainly Alpha;Up-down Bundle;Dbl Homology Domain; Chain A;Dbl homology (DH) domain	0.7948	21	58	1.20.900.10
af_Q6PAJ1_486_690_1.20.900.10	Mainly Alpha;Up-down Bundle;Dbl Homology Domain; Chain A;Dbl homology (DH) domain	0.7882	21	58	1.20.900.10

ID	Description	Score	Start	End
AF-A0A1Q3ND56-F1-model_v4	deleted	0.9159	2	62
AF-A0A7V9K4Q1-F1-model_v4	Uncharacterized protein	0.9105	6	55
AF-A0A7W0X8Q8-F1-model_v4	Uncharacterized protein	0.8928	7	62
AF-A0A1M3BIB1-F1-model_v4	Uncharacterized protein	0.8899	2	69
AF-A0A2G4H4Y6-F1-model_v4	Uncharacterized protein	0.8859	2	69

Feature Viewer

pLDDT	pTM	Quality
81.88	0.6	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F462691

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map