F462830
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 553 | 235 | 553 | 197 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100269588|Ga0070707_1002695882 |
| Length | 224 |
| Sequence | MSNLFMPKVENSKLGTTDNSYSTSLPGSSESISRRDVLKSLTMGVLAGSVLRVIPAQAAEYAHHLVQAEKASAGGAYAPKFFSPQQYKTLQALCQAIIPPDNHSGGAIEAAAPEFIDLLTSENSDYQLKLGGGLMWLDSTCNDRYGKNYLDCTPEQQKQILDLIAYRKNAKADPSISQGVEFFSFLRSLTADGFFTSAIGIKDLQYIGNKYMKDFPGCPAVPEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 108 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 163 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 173 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 175 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 179 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 192 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 193 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 194 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 217 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 229 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.55 |
| Metatranscriptomes | 1.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.41 |
| Rhizosphere | 91.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10048788 | 3300003320 | Bacteria | 5610 |
| 2 | rootH2_10150870 | 3300003320 | Unclassified | 3250 |
| 3 | Ga0065715_10317810 | 3300005293 | Unclassified | 1002 |
| 4 | Ga0065707_10314487 | 3300005295 | Unclassified | 969 |
| 5 | Ga0070683_100009054 | 3300005329 | Bacteria | 8497 |
| 6 | Ga0070683_100054795 | 3300005329 | Unclassified | 3698 |
| 7 | Ga0070690_100040445 | 3300005330 | Bacteria | 2949 |
| 8 | Ga0070670_100356855 | 3300005331 | Unclassified | 1285 |
| 9 | Ga0070677_10065822 | 3300005333 | Bacteria | 1509 |
| 10 | Ga0068869_100032775 | 3300005334 | Bacteria | 3663 |
| 11 | Ga0070666_10002725 | 3300005335 | Bacteria | 10673 |
| 12 | Ga0070682_100027590 | 3300005337 | Unclassified | 3408 |
| 13 | Ga0070682_100049852 | 3300005337 | Unclassified | 2612 |
| 14 | Ga0068868_100107040 | 3300005338 | Unclassified | 2269 |
| 15 | Ga0068868_100221756 | 3300005338 | Bacteria | 1583 |
| 16 | Ga0070660_100035237 | 3300005339 | Bacteria | 3787 |
| 17 | Ga0070660_100627570 | 3300005339 | Bacteria | 899 |
| 18 | Ga0070661_100005979 | 3300005344 | Bacteria | 8378 |
| 19 | Ga0070692_10062447 | 3300005345 | Unclassified | 1966 |
| 20 | Ga0070668_100006081 | 3300005347 | Bacteria | 8952 |
| 21 | Ga0070669_100022835 | 3300005353 | Bacteria | 4475 |
| 22 | Ga0070671_100053887 | 3300005355 | Unclassified | 3343 |
| 23 | Ga0070674_100046373 | 3300005356 | Bacteria | 2973 |
| 24 | Ga0070674_101025938 | 3300005356 | Unclassified | 725 |
| 25 | Ga0070659_100011058 | 3300005366 | Bacteria | 6666 |
| 26 | Ga0070667_100005223 | 3300005367 | Bacteria | 10853 |
| 27 | Ga0070667_100584506 | 3300005367 | Unclassified | 1028 |
| 28 | Ga0070703_10029972 | 3300005406 | Bacteria | 1636 |
| 29 | Ga0070703_10170370 | 3300005406 | Unclassified | 833 |
| 30 | Ga0070709_10031441 | 3300005434 | Unclassified | 3192 |
| 31 | Ga0070709_10033696 | 3300005434 | Bacteria | 3100 |
| 32 | Ga0070709_10074216 | 3300005434 | Bacteria | 2204 |
| 33 | Ga0070709_10086646 | 3300005434 | Bacteria | 2056 |
| 34 | Ga0070709_10106174 | 3300005434 | Bacteria | 1880 |
| 35 | Ga0070714_100006555 | 3300005435 | Bacteria | 9004 |
| 36 | Ga0070714_100051489 | 3300005435 | Bacteria | 3510 |
| 37 | Ga0070714_100190006 | 3300005435 | Unclassified | 1873 |
| 38 | Ga0070714_100513670 | 3300005435 | Bacteria | 1144 |
| 39 | Ga0070714_100675222 | 3300005435 | Bacteria | 996 |
| 40 | Ga0070714_100817417 | 3300005435 | Unclassified | 903 |
| 41 | Ga0070714_100909272 | 3300005435 | Unclassified | 855 |
| 42 | Ga0070713_100000134 | 3300005436 | Bacteria | 48639 |
| 43 | Ga0070713_100041168 | 3300005436 | Unclassified | 3762 |
| 44 | Ga0070713_100102065 | 3300005436 | Unclassified | 2486 |
| 45 | Ga0070713_100613505 | 3300005436 | Unclassified | 1034 |
| 46 | Ga0070710_10848745 | 3300005437 | Bacteria | 656 |
| 47 | Ga0070711_100001063 | 3300005439 | Bacteria | 14659 |
| 48 | Ga0070711_100189442 | 3300005439 | Unclassified | 1580 |
| 49 | Ga0070711_100222082 | 3300005439 | Bacteria | 1469 |
| 50 | Ga0070711_100300812 | 3300005439 | Bacteria | 1276 |
| 51 | Ga0070705_100002589 | 3300005440 | Bacteria | 9064 |
| 52 | Ga0070705_100250029 | 3300005440 | Bacteria | 1244 |
| 53 | Ga0070694_100122448 | 3300005444 | Bacteria | 1868 |
| 54 | Ga0070708_100000598 | 3300005445 | Bacteria | 27157 |
| 55 | Ga0070708_100004228 | 3300005445 | Bacteria | 11275 |
| 56 | Ga0070708_100013577 | 3300005445 | Bacteria | 6675 |
| 57 | Ga0070708_100015179 | 3300005445 | Bacteria | 6351 |
| 58 | Ga0070708_100015797 | 3300005445 | Bacteria | 6242 |
| 59 | Ga0070708_100030590 | 3300005445 | Bacteria | 4654 |
| 60 | Ga0070663_100003084 | 3300005455 | Bacteria | 9526 |
| 61 | Ga0070663_101021088 | 3300005455 | Unclassified | 720 |
| 62 | Ga0070678_100308182 | 3300005456 | Unclassified | 1348 |
| 63 | Ga0070662_100001005 | 3300005457 | Bacteria | 17236 |
| 64 | Ga0070662_100055474 | 3300005457 | Bacteria | 2874 |
| 65 | Ga0070681_10344432 | 3300005458 | Bacteria | 1400 |
| 66 | Ga0070681_11105105 | 3300005458 | Unclassified | 714 |
| 67 | Ga0068867_100028245 | 3300005459 | Bacteria | 4038 |
| 68 | Ga0070706_100000980 | 3300005467 | Bacteria | 31089 |
| 69 | Ga0070706_100001398 | 3300005467 | Bacteria | 25511 |
| 70 | Ga0070706_100033580 | 3300005467 | Bacteria | 4736 |
| 71 | Ga0070706_100098351 | 3300005467 | Bacteria | 2719 |
| 72 | Ga0070707_100000915 | 3300005468 | Bacteria | 29244 |
| 73 | Ga0070707_100009766 | 3300005468 | Bacteria | 8921 |
| 74 | Ga0070707_100092473 | 3300005468 | Unclassified | 2928 |
| 75 | Ga0070707_100269588 | 3300005468 | Unclassified | 1655 |
| 76 | Ga0070707_100664030 | 3300005468 | Unclassified | 1005 |
| 77 | Ga0070698_100000140 | 3300005471 | Bacteria | 65074 |
| 78 | Ga0070698_100000158 | 3300005471 | Bacteria | 61818 |
| 79 | Ga0070698_100152939 | 3300005471 | Bacteria | 2254 |
| 80 | Ga0070698_100543470 | 3300005471 | Bacteria | 1101 |
| 81 | Ga0070699_100006667 | 3300005518 | Bacteria | 10040 |
| 82 | Ga0070699_100006913 | 3300005518 | Bacteria | 9865 |
| 83 | Ga0070699_100035282 | 3300005518 | Unclassified | 4323 |
| 84 | Ga0070679_100022913 | 3300005530 | Bacteria | 6108 |
| 85 | Ga0070679_100627846 | 3300005530 | Bacteria | 1017 |
| 86 | Ga0070684_100011109 | 3300005535 | Bacteria | 7164 |
| 87 | Ga0070697_100000518 | 3300005536 | Bacteria | 29110 |
| 88 | Ga0070697_100001215 | 3300005536 | Bacteria | 19429 |
| 89 | Ga0070697_100008196 | 3300005536 | Bacteria | 8157 |
| 90 | Ga0070697_100009318 | 3300005536 | Bacteria | 7675 |
| 91 | Ga0070697_100012341 | 3300005536 | Bacteria | 6693 |
| 92 | Ga0070697_100110342 | 3300005536 | Bacteria | 2292 |
| 93 | Ga0070697_100157742 | 3300005536 | Bacteria | 1916 |
| 94 | Ga0070697_100414562 | 3300005536 | Unclassified | 1170 |
| 95 | Ga0070697_100435552 | 3300005536 | Bacteria | 1140 |
| 96 | Ga0068853_100043685 | 3300005539 | Bacteria | 3834 |
| 97 | Ga0068853_100132519 | 3300005539 | Bacteria | 2232 |
| 98 | Ga0070672_100167104 | 3300005543 | Bacteria | 1828 |
| 99 | Ga0070686_100023364 | 3300005544 | Bacteria | 3694 |
| 100 | Ga0070695_100000210 | 3300005545 | Bacteria | 28472 |
| 101 | Ga0070695_100371555 | 3300005545 | Bacteria | 1077 |
| 102 | Ga0070695_100558306 | 3300005545 | Bacteria | 893 |
| 103 | Ga0070696_100002816 | 3300005546 | Bacteria | 11551 |
| 104 | Ga0070696_100231835 | 3300005546 | Bacteria | 1389 |
| 105 | Ga0070696_100303997 | 3300005546 | Bacteria | 1223 |
| 106 | Ga0070693_100000105 | 3300005547 | Bacteria | 37510 |
| 107 | Ga0070693_100891929 | 3300005547 | Unclassified | 666 |
| 108 | Ga0070665_100003940 | 3300005548 | Bacteria | 15664 |
| 109 | Ga0070665_100010236 | 3300005548 | Bacteria | 9487 |
| 110 | Ga0070704_100570955 | 3300005549 | Bacteria | 991 |
| 111 | Ga0068855_100506571 | 3300005563 | Unclassified | 1311 |
| 112 | Ga0068855_100550895 | 3300005563 | Unclassified | 1248 |
| 113 | Ga0068855_100602790 | 3300005563 | Bacteria | 1184 |
| 114 | Ga0068855_100784803 | 3300005563 | Bacteria | 1013 |
| 115 | Ga0070664_100010450 | 3300005564 | Bacteria | 7525 |
| 116 | Ga0068857_100333903 | 3300005577 | Unclassified | 1401 |
| 117 | Ga0068854_100033290 | 3300005578 | Bacteria | 3592 |
| 118 | Ga0068856_100008986 | 3300005614 | Bacteria | 9721 |
| 119 | Ga0068856_100279673 | 3300005614 | Bacteria | 1685 |
| 120 | Ga0068852_100031868 | 3300005616 | Bacteria | 4358 |
| 121 | Ga0068852_100449019 | 3300005616 | Unclassified | 1276 |
| 122 | Ga0068859_100006285 | 3300005617 | Bacteria | 12052 |
| 123 | Ga0068866_10022326 | 3300005718 | Bacteria | 2927 |
| 124 | Ga0068851_10003049 | 3300005834 | Bacteria | 7409 |
| 125 | Ga0068851_10042607 | 3300005834 | Unclassified | 2286 |
| 126 | Ga0068863_100010773 | 3300005841 | Bacteria | 8870 |
| 127 | Ga0068863_100089612 | 3300005841 | Unclassified | 2917 |
| 128 | Ga0068863_100196853 | 3300005841 | Unclassified | 1937 |
| 129 | Ga0068863_100224760 | 3300005841 | Bacteria | 1809 |
| 130 | Ga0068863_100747970 | 3300005841 | Unclassified | 973 |
| 131 | Ga0068858_100025578 | 3300005842 | Bacteria | 5492 |
| 132 | Ga0068858_100316924 | 3300005842 | Bacteria | 1490 |
| 133 | Ga0068860_100008766 | 3300005843 | Bacteria | 10076 |
| 134 | Ga0068860_100039273 | 3300005843 | Bacteria | 4527 |
| 135 | Ga0068860_100319318 | 3300005843 | Bacteria | 1524 |
| 136 | Ga0068862_100036976 | 3300005844 | Bacteria | 4137 |
| 137 | Ga0070717_10001280 | 3300006028 | Bacteria | 17207 |
| 138 | Ga0070717_10004636 | 3300006028 | Bacteria | 9964 |
| 139 | Ga0070717_10009698 | 3300006028 | Bacteria | 7246 |
| 140 | Ga0070717_10381421 | 3300006028 | Bacteria | 1264 |
| 141 | Ga0070715_10001337 | 3300006163 | Bacteria | 7105 |
| 142 | Ga0070715_10017499 | 3300006163 | Bacteria | 2714 |
| 143 | Ga0070716_100002507 | 3300006173 | Bacteria | 8497 |
| 144 | Ga0070716_100002526 | 3300006173 | Bacteria | 8474 |
| 145 | Ga0070716_100006521 | 3300006173 | Bacteria | 5705 |
| 146 | Ga0070716_100006812 | 3300006173 | Bacteria | 5600 |
| 147 | Ga0070716_100011190 | 3300006173 | Bacteria | 4516 |
| 148 | Ga0070716_100025668 | 3300006173 | Bacteria | 3147 |
| 149 | Ga0070716_100128742 | 3300006173 | Unclassified | 1597 |
| 150 | Ga0070716_100198548 | 3300006173 | Unclassified | 1331 |
| 151 | Ga0070716_100227149 | 3300006173 | Unclassified | 1258 |
| 152 | Ga0070716_100229652 | 3300006173 | Bacteria | 1252 |
| 153 | Ga0070712_100001951 | 3300006175 | Bacteria | 12648 |
| 154 | Ga0070712_100036702 | 3300006175 | Unclassified | 3336 |
| 155 | Ga0070712_100055043 | 3300006175 | Unclassified | 2784 |
| 156 | Ga0070712_100056545 | 3300006175 | Bacteria | 2752 |
| 157 | Ga0070712_100220237 | 3300006175 | Bacteria | 1502 |
| 158 | Ga0070712_100296506 | 3300006175 | Bacteria | 1307 |
| 159 | Ga0097621_100005597 | 3300006237 | Bacteria | 8858 |
| 160 | Ga0097621_100007474 | 3300006237 | Bacteria | 7818 |
| 161 | Ga0097621_100022905 | 3300006237 | Bacteria | 4854 |
| 162 | Ga0068871_100049819 | 3300006358 | Bacteria | 3387 |
| 163 | Ga0068871_100105067 | 3300006358 | Bacteria | 2369 |
| 164 | Ga0075433_10000213 | 3300006852 | Bacteria | 32853 |
| 165 | Ga0075433_10182058 | 3300006852 | Bacteria | 1870 |
| 166 | Ga0075433_10612426 | 3300006852 | Bacteria | 956 |
| 167 | Ga0075434_100000122 | 3300006871 | Bacteria | 45781 |
| 168 | Ga0075434_100001669 | 3300006871 | Bacteria | 18928 |
| 169 | Ga0075434_100009940 | 3300006871 | Bacteria | 8901 |
| 170 | Ga0075434_100015193 | 3300006871 | Bacteria | 7376 |
| 171 | Ga0075434_100371612 | 3300006871 | Bacteria | 1451 |
| 172 | Ga0068865_100005168 | 3300006881 | Bacteria | 7897 |
| 173 | Ga0068865_100087130 | 3300006881 | Bacteria | 2256 |
| 174 | Ga0068865_100365961 | 3300006881 | Bacteria | 1172 |
| 175 | Ga0075436_100002250 | 3300006914 | Bacteria | 13326 |
| 176 | Ga0075436_100005656 | 3300006914 | Bacteria | 8581 |
| 177 | Ga0075436_100014222 | 3300006914 | Bacteria | 5449 |
| 178 | Ga0075436_100041204 | 3300006914 | Bacteria | 3186 |
| 179 | Ga0075436_100109039 | 3300006914 | Bacteria | 1931 |
| 180 | Ga0075436_100176807 | 3300006914 | Bacteria | 1508 |
| 181 | Ga0075436_100486112 | 3300006914 | Bacteria | 902 |
| 182 | Ga0097620_100006285 | 3300006931 | Bacteria | 12052 |
| 183 | Ga0075435_100000038 | 3300007076 | Bacteria | 67821 |
| 184 | Ga0075435_100029450 | 3300007076 | Bacteria | 4309 |
| 185 | Ga0075435_100031021 | 3300007076 | Bacteria | 4208 |
| 186 | Ga0075435_100225426 | 3300007076 | Unclassified | 1592 |
| 187 | Ga0075435_100250449 | 3300007076 | Bacteria | 1508 |
| 188 | Ga0075435_100322397 | 3300007076 | Unclassified | 1322 |
| 189 | Ga0099794_10007517 | 3300007265 | Bacteria | 4482 |
| 190 | Ga0099794_10071736 | 3300007265 | Bacteria | 1697 |
| 191 | Ga0099794_10309659 | 3300007265 | Unclassified | 818 |
| 192 | Ga0105240_10016695 | 3300009093 | Bacteria | 9929 |
| 193 | Ga0105240_10022638 | 3300009093 | Bacteria | 8325 |
| 194 | Ga0105240_10026434 | 3300009093 | Bacteria | 7615 |
| 195 | Ga0105240_10062894 | 3300009093 | Bacteria | 4619 |
| 196 | Ga0105240_10083446 | 3300009093 | Bacteria | 3921 |
| 197 | Ga0105240_10116590 | 3300009093 | Bacteria | 3221 |
| 198 | Ga0105240_10185604 | 3300009093 | Bacteria | 2450 |
| 199 | Ga0105240_10303723 | 3300009093 | Unclassified | 1825 |
| 200 | Ga0105245_10039439 | 3300009098 | Bacteria | 4203 |
| 201 | Ga0105245_10064479 | 3300009098 | Unclassified | 3311 |
| 202 | Ga0105247_10003343 | 3300009101 | Bacteria | 10499 |
| 203 | Ga0105247_10052555 | 3300009101 | Bacteria | 2512 |
| 204 | Ga0105247_10953716 | 3300009101 | Bacteria | 666 |
| 205 | Ga0114129_10094507 | 3300009147 | Bacteria | 4141 |
| 206 | Ga0114129_10494583 | 3300009147 | Bacteria | 1598 |
| 207 | Ga0105243_10056060 | 3300009148 | Bacteria | 3132 |
| 208 | Ga0105241_10018950 | 3300009174 | Bacteria | 5072 |
| 209 | Ga0105241_10053903 | 3300009174 | Unclassified | 3077 |
| 210 | Ga0105241_10412773 | 3300009174 | Unclassified | 1187 |
| 211 | Ga0105241_10416357 | 3300009174 | Unclassified | 1182 |
| 212 | Ga0105242_10056234 | 3300009176 | Bacteria | 3219 |
| 213 | Ga0105242_10061499 | 3300009176 | Unclassified | 3089 |
| 214 | Ga0105242_10090589 | 3300009176 | Bacteria | 2573 |
| 215 | Ga0105248_10000003 | 3300009177 | Bacteria | 1019601 |
| 216 | Ga0105248_10155332 | 3300009177 | Bacteria | 2582 |
| 217 | Ga0105237_10076278 | 3300009545 | Unclassified | 3343 |
| 218 | Ga0105237_10186374 | 3300009545 | Bacteria | 2075 |
| 219 | Ga0105237_10662855 | 3300009545 | Bacteria | 1050 |
| 220 | Ga0105237_10870809 | 3300009545 | Unclassified | 908 |
| 221 | Ga0105237_11315919 | 3300009545 | Unclassified | 729 |
| 222 | Ga0105238_10033715 | 3300009551 | Bacteria | 5210 |
| 223 | Ga0105238_10614563 | 3300009551 | Bacteria | 1095 |
| 224 | Ga0105238_11123849 | 3300009551 | Bacteria | 809 |
| 225 | Ga0105249_10026101 | 3300009553 | Bacteria | 5262 |
| 226 | Ga0105249_10161356 | 3300009553 | Bacteria | 2167 |
| 227 | Ga0099796_10002143 | 3300010159 | Bacteria | 4252 |
| 228 | Ga0105239_10472365 | 3300010375 | Bacteria | 1424 |
| 229 | Ga0105239_10730824 | 3300010375 | Bacteria | 1133 |
| 230 | Ga0105239_11722332 | 3300010375 | Bacteria | 726 |
| 231 | Ga0105246_10065671 | 3300011119 | Bacteria | 2538 |
| 232 | Ga0105246_10116297 | 3300011119 | Unclassified | 1974 |
| 233 | Ga0157373_10015048 | 3300013100 | Bacteria | 5659 |
| 234 | Ga0157373_10042013 | 3300013100 | Unclassified | 3269 |
| 235 | Ga0157373_10432142 | 3300013100 | Bacteria | 946 |
| 236 | Ga0157371_10031814 | 3300013102 | Bacteria | 3799 |
| 237 | Ga0157370_10262990 | 3300013104 | Bacteria | 1594 |
| 238 | Ga0157370_10600937 | 3300013104 | Unclassified | 1007 |
| 239 | Ga0157369_10113928 | 3300013105 | Bacteria | 2872 |
| 240 | Ga0157369_10286887 | 3300013105 | Unclassified | 1714 |
| 241 | Ga0157374_10003917 | 3300013296 | Bacteria | 12506 |
| 242 | Ga0157374_10015000 | 3300013296 | Bacteria | 6791 |
| 243 | Ga0157374_10251360 | 3300013296 | Unclassified | 1740 |
| 244 | Ga0157374_10391603 | 3300013296 | Bacteria | 1385 |
| 245 | Ga0157374_10440978 | 3300013296 | Unclassified | 1303 |
| 246 | Ga0157374_10521445 | 3300013296 | Bacteria | 1194 |
| 247 | Ga0157378_10000114 | 3300013297 | Bacteria | 77298 |
| 248 | Ga0157378_10004037 | 3300013297 | Bacteria | 12960 |
| 249 | Ga0157378_10028879 | 3300013297 | Bacteria | 4896 |
| 250 | Ga0157378_10029642 | 3300013297 | Bacteria | 4832 |
| 251 | Ga0157378_10133895 | 3300013297 | Bacteria | 2296 |
| 252 | Ga0157378_10230917 | 3300013297 | Bacteria | 1763 |
| 253 | Ga0163162_10005493 | 3300013306 | Bacteria | 12250 |
| 254 | Ga0163162_10030398 | 3300013306 | Bacteria | 5352 |
| 255 | Ga0163162_10095694 | 3300013306 | Bacteria | 3057 |
| 256 | Ga0163162_10375950 | 3300013306 | Bacteria | 1554 |
| 257 | Ga0157372_10000504 | 3300013307 | Bacteria | 42933 |
| 258 | Ga0157372_10143191 | 3300013307 | Bacteria | 2756 |
| 259 | Ga0157372_10353343 | 3300013307 | Bacteria | 1712 |
| 260 | Ga0157372_10358884 | 3300013307 | Bacteria | 1698 |
| 261 | Ga0157375_10027686 | 3300013308 | Bacteria | 5302 |
| 262 | Ga0157375_10064353 | 3300013308 | Unclassified | 3651 |
| 263 | Ga0157375_11096674 | 3300013308 | Bacteria | 932 |
| 264 | Ga0163163_10137364 | 3300014325 | Bacteria | 2486 |
| 265 | Ga0163163_10163706 | 3300014325 | Bacteria | 2270 |
| 266 | Ga0163163_10257438 | 3300014325 | Unclassified | 1796 |
| 267 | Ga0163163_10922546 | 3300014325 | Bacteria | 937 |
| 268 | Ga0182008_10004291 | 3300014497 | Bacteria | 8350 |
| 269 | Ga0182008_10099269 | 3300014497 | Bacteria | 1438 |
| 270 | Ga0157379_10021319 | 3300014968 | Bacteria | 5734 |
| 271 | Ga0157379_10043840 | 3300014968 | Unclassified | 3994 |
| 272 | Ga0157379_10292769 | 3300014968 | Bacteria | 1483 |
| 273 | Ga0157379_10475549 | 3300014968 | Unclassified | 1156 |
| 274 | Ga0157376_10000023 | 3300014969 | Bacteria | 223978 |
| 275 | Ga0157376_10057382 | 3300014969 | Bacteria | 3256 |
| 276 | Ga0157376_10135309 | 3300014969 | Bacteria | 2204 |
| 277 | Ga0157376_10818833 | 3300014969 | Unclassified | 945 |
| 278 | Ga0182006_1018515 | 3300015261 | Unclassified | 2941 |
| 279 | Ga0182007_10005476 | 3300015262 | Bacteria | 5572 |
| 280 | Ga0182005_1039684 | 3300015265 | Bacteria | 1280 |
| 281 | Ga0213876_10111152 | 3300021384 | Bacteria | 1454 |
| 282 | Ga0224569_102112 | 3300022732 | Bacteria | 1644 |
| 283 | Ga0207653_10034523 | 3300025885 | Bacteria | 1643 |
| 284 | Ga0207653_10140514 | 3300025885 | Unclassified | 883 |
| 285 | Ga0207682_10266035 | 3300025893 | Bacteria | 800 |
| 286 | Ga0207692_10235925 | 3300025898 | Unclassified | 1090 |
| 287 | Ga0207642_10015333 | 3300025899 | Bacteria | 2852 |
| 288 | Ga0207710_10135149 | 3300025900 | Unclassified | 1187 |
| 289 | Ga0207680_10032847 | 3300025903 | Bacteria | 2954 |
| 290 | Ga0207685_10001246 | 3300025905 | Bacteria | 5189 |
| 291 | Ga0207699_10028244 | 3300025906 | Bacteria | 3116 |
| 292 | Ga0207699_10029731 | 3300025906 | Unclassified | 3049 |
| 293 | Ga0207699_10111952 | 3300025906 | Unclassified | 1751 |
| 294 | Ga0207699_10317108 | 3300025906 | Unclassified | 1092 |
| 295 | Ga0207699_10345746 | 3300025906 | Unclassified | 1049 |
| 296 | Ga0207645_10003288 | 3300025907 | Bacteria | 12327 |
| 297 | Ga0207705_10044818 | 3300025909 | Unclassified | 3179 |
| 298 | Ga0207684_10001117 | 3300025910 | Bacteria | 29965 |
| 299 | Ga0207684_10007311 | 3300025910 | Bacteria | 9962 |
| 300 | Ga0207684_10007842 | 3300025910 | Bacteria | 9548 |
| 301 | Ga0207684_10086066 | 3300025910 | Unclassified | 2677 |
| 302 | Ga0207684_10098505 | 3300025910 | Bacteria | 2497 |
| 303 | Ga0207654_10007623 | 3300025911 | Bacteria | 5457 |
| 304 | Ga0207654_10037774 | 3300025911 | Bacteria | 2705 |
| 305 | Ga0207654_10322744 | 3300025911 | Unclassified | 1056 |
| 306 | Ga0207707_10045887 | 3300025912 | Bacteria | 3806 |
| 307 | Ga0207707_10691626 | 3300025912 | Unclassified | 857 |
| 308 | Ga0207695_10043213 | 3300025913 | Bacteria | 4804 |
| 309 | Ga0207695_10044444 | 3300025913 | Bacteria | 4725 |
| 310 | Ga0207695_10110645 | 3300025913 | Bacteria | 2727 |
| 311 | Ga0207671_10010795 | 3300025914 | Bacteria | 7495 |
| 312 | Ga0207671_10075610 | 3300025914 | Bacteria | 2519 |
| 313 | Ga0207671_10181981 | 3300025914 | Unclassified | 1636 |
| 314 | Ga0207693_10000275 | 3300025915 | Bacteria | 47590 |
| 315 | Ga0207693_10011260 | 3300025915 | Bacteria | 7240 |
| 316 | Ga0207693_10042748 | 3300025915 | Bacteria | 3567 |
| 317 | Ga0207693_10047262 | 3300025915 | Bacteria | 3381 |
| 318 | Ga0207693_10174310 | 3300025915 | Bacteria | 1693 |
| 319 | Ga0207693_10240842 | 3300025915 | Bacteria | 1420 |
| 320 | Ga0207693_10360997 | 3300025915 | Bacteria | 1137 |
| 321 | Ga0207663_10002133 | 3300025916 | Bacteria | 9437 |
| 322 | Ga0207663_10145788 | 3300025916 | Unclassified | 1655 |
| 323 | Ga0207663_10243974 | 3300025916 | Bacteria | 1319 |
| 324 | Ga0207663_10767584 | 3300025916 | Bacteria | 766 |
| 325 | Ga0207660_10018437 | 3300025917 | Bacteria | 4652 |
| 326 | Ga0207657_10000254 | 3300025919 | Bacteria | 56893 |
| 327 | Ga0207657_10002735 | 3300025919 | Bacteria | 18996 |
| 328 | Ga0207652_10357849 | 3300025921 | Bacteria | 1317 |
| 329 | Ga0207646_10000471 | 3300025922 | Bacteria | 53728 |
| 330 | Ga0207646_10001706 | 3300025922 | Bacteria | 26669 |
| 331 | Ga0207646_10032934 | 3300025922 | Unclassified | 4687 |
| 332 | Ga0207646_10158189 | 3300025922 | Bacteria | 2044 |
| 333 | Ga0207646_10232725 | 3300025922 | Unclassified | 1665 |
| 334 | Ga0207694_10247742 | 3300025924 | Bacteria | 1457 |
| 335 | Ga0207694_10291873 | 3300025924 | Bacteria | 1341 |
| 336 | Ga0207694_10776849 | 3300025924 | Bacteria | 809 |
| 337 | Ga0207687_10004264 | 3300025927 | Bacteria | 9564 |
| 338 | Ga0207687_10084379 | 3300025927 | Bacteria | 2302 |
| 339 | Ga0207687_10208604 | 3300025927 | Unclassified | 1531 |
| 340 | Ga0207700_10000111 | 3300025928 | Bacteria | 48784 |
| 341 | Ga0207700_10038908 | 3300025928 | Bacteria | 3456 |
| 342 | Ga0207700_10056938 | 3300025928 | Unclassified | 2945 |
| 343 | Ga0207700_10824728 | 3300025928 | Bacteria | 830 |
| 344 | Ga0207664_10025215 | 3300025929 | Bacteria | 4476 |
| 345 | Ga0207664_10320793 | 3300025929 | Bacteria | 1367 |
| 346 | Ga0207664_10498784 | 3300025929 | Bacteria | 1090 |
| 347 | Ga0207664_10692927 | 3300025929 | Unclassified | 916 |
| 348 | Ga0207664_10711309 | 3300025929 | Unclassified | 903 |
| 349 | Ga0207690_10447803 | 3300025932 | Bacteria | 1037 |
| 350 | Ga0207706_10003488 | 3300025933 | Bacteria | 15016 |
| 351 | Ga0207706_10033194 | 3300025933 | Bacteria | 4594 |
| 352 | Ga0207686_10264580 | 3300025934 | Bacteria | 1262 |
| 353 | Ga0207709_10355731 | 3300025935 | Bacteria | 1107 |
| 354 | Ga0207704_10006270 | 3300025938 | Bacteria | 5531 |
| 355 | Ga0207665_10006116 | 3300025939 | Bacteria | 7992 |
| 356 | Ga0207665_10009881 | 3300025939 | Bacteria | 6262 |
| 357 | Ga0207665_10011970 | 3300025939 | Bacteria | 5698 |
| 358 | Ga0207665_10019746 | 3300025939 | Bacteria | 4429 |
| 359 | Ga0207665_10045237 | 3300025939 | Bacteria | 2947 |
| 360 | Ga0207665_10148218 | 3300025939 | Bacteria | 1678 |
| 361 | Ga0207665_10213410 | 3300025939 | Bacteria | 1411 |
| 362 | Ga0207665_11070604 | 3300025939 | Bacteria | 642 |
| 363 | Ga0207691_10299112 | 3300025940 | Bacteria | 1383 |
| 364 | Ga0207711_10000013 | 3300025941 | Bacteria | 514850 |
| 365 | Ga0207711_10000708 | 3300025941 | Bacteria | 32770 |
| 366 | Ga0207689_10024883 | 3300025942 | Bacteria | 5019 |
| 367 | Ga0207661_10083173 | 3300025944 | Bacteria | 2648 |
| 368 | Ga0207679_10036880 | 3300025945 | Bacteria | 3471 |
| 369 | Ga0207679_10215994 | 3300025945 | Bacteria | 1611 |
| 370 | Ga0207667_10005768 | 3300025949 | Bacteria | 15107 |
| 371 | Ga0207651_10380789 | 3300025960 | Bacteria | 1196 |
| 372 | Ga0207712_10006914 | 3300025961 | Bacteria | 7158 |
| 373 | Ga0207668_10003703 | 3300025972 | Bacteria | 8999 |
| 374 | Ga0207640_10013067 | 3300025981 | Bacteria | 4748 |
| 375 | Ga0207640_10060810 | 3300025981 | Bacteria | 2499 |
| 376 | Ga0207658_10528222 | 3300025986 | Unclassified | 1054 |
| 377 | Ga0207677_10018639 | 3300026023 | Bacteria | 4170 |
| 378 | Ga0207703_10087614 | 3300026035 | Bacteria | 2611 |
| 379 | Ga0207703_10171510 | 3300026035 | Bacteria | 1908 |
| 380 | Ga0207639_10094322 | 3300026041 | Unclassified | 2402 |
| 381 | Ga0207639_10485670 | 3300026041 | Bacteria | 1126 |
| 382 | Ga0207639_10849573 | 3300026041 | Unclassified | 852 |
| 383 | Ga0207678_10000256 | 3300026067 | Bacteria | 48140 |
| 384 | Ga0207702_10034140 | 3300026078 | Bacteria | 4252 |
| 385 | Ga0207702_10196777 | 3300026078 | Bacteria | 1866 |
| 386 | Ga0207702_10462628 | 3300026078 | Bacteria | 1232 |
| 387 | Ga0207641_10003212 | 3300026088 | Bacteria | 14628 |
| 388 | Ga0207641_10066043 | 3300026088 | Bacteria | 3096 |
| 389 | Ga0207641_10196325 | 3300026088 | Bacteria | 1858 |
| 390 | Ga0207641_10718457 | 3300026088 | Unclassified | 985 |
| 391 | Ga0207648_10006028 | 3300026089 | Bacteria | 12087 |
| 392 | Ga0207676_10166021 | 3300026095 | Bacteria | 1918 |
| 393 | Ga0207674_10049130 | 3300026116 | Bacteria | 4315 |
| 394 | Ga0207674_10184025 | 3300026116 | Bacteria | 2040 |
| 395 | Ga0207683_10006753 | 3300026121 | Bacteria | 9816 |
| 396 | Ga0207698_10010630 | 3300026142 | Bacteria | 5931 |
| 397 | Ga0209588_1004706 | 3300027671 | Unclassified | 3869 |
| 398 | Ga0209588_1026778 | 3300027671 | Bacteria | 1832 |
| 399 | Ga0209588_1027849 | 3300027671 | Bacteria | 1798 |
| 400 | Ga0209588_1035042 | 3300027671 | Bacteria | 1613 |
| 401 | Ga0265354_1005228 | 3300028016 | Bacteria | 1324 |
| 402 | Ga0265356_1000027 | 3300028017 | Bacteria | 22799 |
| 403 | Ga0268266_10000276 | 3300028379 | Bacteria | 84981 |
| 404 | Ga0268266_10071304 | 3300028379 | Bacteria | 3011 |
| 405 | Ga0268265_10084865 | 3300028380 | Bacteria | 2511 |
| 406 | Ga0268264_10028085 | 3300028381 | Bacteria | 4602 |
| 407 | Ga0268264_10035584 | 3300028381 | Bacteria | 4099 |
| 408 | Ga0268264_10134396 | 3300028381 | Bacteria | 2197 |
| 409 | Ga0268264_10546639 | 3300028381 | Bacteria | 1135 |
| 410 | Ga0265338_10061131 | 3300028800 | Unclassified | 3303 |
| 411 | Ga0265762_1000913 | 3300030760 | Bacteria | 5265 |
| 412 | Ga0265762_1002989 | 3300030760 | Bacteria | 3022 |
| 413 | Ga0265770_1004292 | 3300030878 | Unclassified | 1943 |
| 414 | Ga0265765_1000737 | 3300030879 | Unclassified | 2770 |
| 415 | Ga0265760_10001555 | 3300031090 | Bacteria | 6756 |
| 416 | Ga0265760_10002675 | 3300031090 | Bacteria | 5213 |
| 417 | Ga0265760_10088499 | 3300031090 | Unclassified | 967 |
| 418 | Ga0265325_10025063 | 3300031241 | Unclassified | 3240 |
| 419 | Ga0265316_10039227 | 3300031344 | Bacteria | 3805 |
| 420 | Ga0373938_0098457 | 3300034957 | Unclassified | 732 |
| 421 | Ga0373928_0042965 | 3300035084 | Bacteria | 1044 |
| 422 | Ga0373940_0139147 | 3300035088 | Unclassified | 766 |
| 423 | Ga0373932_0004078 | 3300035112 | Bacteria | 3471 |
| 424 | Ga0373939_0045488 | 3300035114 | Bacteria | 1340 |
| 425 | Ga0373941_0162558 | 3300035115 | Bacteria | 827 |
| 426 | Ga0373954_0000112 | 3300035118 | Bacteria | 27502 |
| 427 | Ga0373956_0027503 | 3300035119 | Unclassified | 2469 |
| 428 | Ga0373943_0015940 | 3300035170 | Unclassified | 3421 |
| 429 | Ga0373943_0219662 | 3300035170 | Bacteria | 1058 |
| 430 | Ga0373943_0523520 | 3300035170 | Archaea | 694 |
| 431 | Ga0373955_0009223 | 3300035172 | Bacteria | 4617 |
| 432 | Ga0373931_0012563 | 3300035691 | Bacteria | 4105 |
| 433 | Ga0373931_0092729 | 3300035691 | Unclassified | 1685 |
| 434 | Ga0373931_0135623 | 3300035691 | Bacteria | 1421 |
| 435 | Ga0373935_0299357 | 3300035692 | Unclassified | 1136 |
| 436 | Ga0373927_0145595 | 3300035695 | Bacteria | 1551 |
| 437 | Ga0373927_0171092 | 3300035695 | Unclassified | 1424 |
| 438 | Ga0373933_0003817 | 3300035724 | Bacteria | 8331 |
| 439 | Ga0373933_0030512 | 3300035724 | Bacteria | 3122 |
| 440 | Ga0373933_0036014 | 3300035724 | Bacteria | 2894 |
| 441 | Ga0373947_0051731 | 3300035725 | Unclassified | 2472 |
| 442 | Ga0373947_0309529 | 3300035725 | Unclassified | 1055 |
| 443 | Ga0373937_0001579 | 3300036401 | Bacteria | 19154 |
| 444 | Ga0373937_0031660 | 3300036401 | Unclassified | 4794 |
| 445 | Ga0373937_0061034 | 3300036401 | Bacteria | 3466 |
| 446 | Ga0373937_0200327 | 3300036401 | Bacteria | 1877 |
| 447 | Ga0373937_0505133 | 3300036401 | Bacteria | 1149 |
| 448 | Ga0373925_0004053 | 3300037068 | Bacteria | 11132 |
| 449 | Ga0373925_0012233 | 3300037068 | Bacteria | 6210 |
| 450 | Ga0373925_0063691 | 3300037068 | Bacteria | 2775 |
| 451 | Ga0373925_0165017 | 3300037068 | Bacteria | 1746 |
| 452 | Ga0373925_0198267 | 3300037068 | Archaea | 1596 |
| 453 | Ga0436364_1416704 | 3300037853 | Bacteria | 2085 |
| 454 | Ga0436365_1656802 | 3300039437 | Bacteria | 9654 |
| 455 | Ga0436361_0586051 | 3300039447 | Bacteria | 725 |
| 456 | Ga0466961_0236673 | 3300044693 | Bacteria | 1123 |
| 457 | Ga0451576_0441814 | 3300045051 | Bacteria | 1365 |
| 458 | Ga0466967_0026613 | 3300045976 | Bacteria | 4793 |
| 459 | Ga0466967_0086910 | 3300045976 | Bacteria | 2834 |
| 460 | Ga0466967_0261194 | 3300045976 | Bacteria | 1657 |
| 461 | Ga0495603_0118668 | 3300046455 | Bacteria | 1542 |
| 462 | Ga0495641_0028581 | 3300046461 | Bacteria | 2697 |
| 463 | Ga0495653_0051892 | 3300046463 | Unclassified | 3146 |
| 464 | Ga0495580_0004417 | 3300046472 | Bacteria | 11814 |
| 465 | Ga0495580_0085113 | 3300046472 | Bacteria | 2202 |
| 466 | Ga0495582_0000277 | 3300046473 | Bacteria | 28667 |
| 467 | Ga0495582_0004858 | 3300046473 | Bacteria | 7538 |
| 468 | Ga0495582_0362423 | 3300046473 | Unclassified | 835 |
| 469 | Ga0495628_0664505 | 3300046516 | Bacteria | 739 |
| 470 | Ga0495630_0163073 | 3300046517 | Unclassified | 1697 |
| 471 | Ga0495665_0004469 | 3300046531 | Bacteria | 7546 |
| 472 | Ga0495586_0396522 | 3300046535 | Unclassified | 794 |
| 473 | Ga0495587_0005720 | 3300046536 | Bacteria | 8102 |
| 474 | Ga0495587_0031004 | 3300046536 | Bacteria | 3240 |
| 475 | Ga0495657_0231173 | 3300046675 | Unclassified | 1118 |
| 476 | Ga0495599_0308250 | 3300046678 | Unclassified | 955 |
| 477 | Ga0495623_0351808 | 3300046679 | Unclassified | 802 |
| 478 | Ga0495604_0001581 | 3300047317 | Bacteria | 18770 |
| 479 | Ga0495674_0039876 | 3300047319 | Bacteria | 4205 |
| 480 | Ga0495684_0042822 | 3300047471 | Unclassified | 3467 |
| 481 | Ga0495684_0363073 | 3300047471 | Bacteria | 1025 |
| 482 | Ga0495602_0008520 | 3300048088 | Bacteria | 10705 |
| 483 | Ga0495602_0139247 | 3300048088 | Bacteria | 1923 |
| 484 | Ga0495602_0279633 | 3300048088 | Unclassified | 1230 |
| 485 | Ga0496100_0000958 | 3300048903 | Bacteria | 13809 |
| 486 | Ga0496100_0205140 | 3300048903 | Unclassified | 1439 |
| 487 | Ga0496101_0019396 | 3300048904 | Bacteria | 4642 |
| 488 | Ga0496102_0001575 | 3300048905 | Bacteria | 20118 |
| 489 | Ga0496102_0008044 | 3300048905 | Bacteria | 9018 |
| 490 | Ga0496102_0911696 | 3300048905 | Bacteria | 800 |
| 491 | Ga0496103_0013534 | 3300048906 | Bacteria | 4838 |
| 492 | Ga0496103_0289758 | 3300048906 | Bacteria | 1053 |
| 493 | Ga0496104_0028148 | 3300048907 | Bacteria | 5208 |
| 494 | Ga0496104_0137945 | 3300048907 | Bacteria | 2343 |
| 495 | Ga0496104_0191070 | 3300048907 | Bacteria | 1959 |
| 496 | Ga0496104_0285601 | 3300048907 | Unclassified | 1563 |
| 497 | Ga0496104_0390545 | 3300048907 | Bacteria | 1304 |
| 498 | Ga0496104_0793498 | 3300048907 | Bacteria | 853 |
| 499 | Ga0496105_0086821 | 3300048908 | Bacteria | 2585 |
| 500 | Ga0496105_0124502 | 3300048908 | Bacteria | 2125 |
| 501 | Ga0496105_0172691 | 3300048908 | Bacteria | 1771 |
| 502 | Ga0496105_0253670 | 3300048908 | Unclassified | 1425 |
| 503 | Ga0496105_0460297 | 3300048908 | Bacteria | 1003 |
| 504 | Ga0496106_0200292 | 3300048909 | Bacteria | 1589 |
| 505 | Ga0496106_0496848 | 3300048909 | Bacteria | 980 |
| 506 | Ga0496106_0599842 | 3300048909 | Unclassified | 882 |
| 507 | Ga0496107_0102798 | 3300048910 | Bacteria | 2096 |
| 508 | Ga0496107_0116934 | 3300048910 | Unclassified | 1963 |
| 509 | Ga0496107_0218741 | 3300048910 | Bacteria | 1417 |
| 510 | Ga0496109_0208589 | 3300048912 | Unclassified | 1837 |
| 511 | Ga0496109_0394154 | 3300048912 | Bacteria | 1308 |
| 512 | Ga0496109_0453263 | 3300048912 | Unclassified | 1211 |
| 513 | Ga0496110_0029670 | 3300048913 | Bacteria | 4710 |
| 514 | Ga0496110_0401078 | 3300048913 | Bacteria | 1250 |
| 515 | Ga0496110_0975342 | 3300048913 | Unclassified | 755 |
| 516 | Ga0496112_0065438 | 3300048915 | Bacteria | 3587 |
| 517 | Ga0496112_0179675 | 3300048915 | Unclassified | 2080 |
| 518 | Ga0496112_0247922 | 3300048915 | Bacteria | 1733 |
| 519 | Ga0496113_0016718 | 3300048916 | Bacteria | 5073 |
| 520 | Ga0496113_0073999 | 3300048916 | Bacteria | 2597 |
| 521 | Ga0496114_0015725 | 3300048917 | Bacteria | 6089 |
| 522 | Ga0496114_0036562 | 3300048917 | Bacteria | 4059 |
| 523 | Ga0496115_0003600 | 3300048918 | Bacteria | 11135 |
| 524 | Ga0496115_0006608 | 3300048918 | Bacteria | 8500 |
| 525 | Ga0496115_0390324 | 3300048918 | Unclassified | 1130 |
| 526 | Ga0496126_0043586 | 3300048929 | Bacteria | 4138 |
| 527 | nmdc:mga05p37_402554_c1 | 3300050507 | Bacteria | 1598 |
| 528 | nmdc:mga0n895_102_c1 | 3300050512 | Bacteria | 50003 |
| 529 | nmdc:mga0n895_11535_c1 | 3300050512 | Bacteria | 7891 |
| 530 | nmdc:mga0n895_30546_c1 | 3300050512 | Bacteria | 5151 |
| 531 | nmdc:mga0n895_44202_c1 | 3300050512 | Bacteria | 4344 |
| 532 | nmdc:mga0n895_841193_c1 | 3300050512 | Bacteria | 906 |
| 533 | nmdc:mga0rr50_106242_c1 | 3300050513 | Unclassified | 2215 |
| 534 | nmdc:mga0rr50_110_c1 | 3300050513 | Bacteria | 20297 |
| 535 | nmdc:mga0rr50_163115_c1 | 3300050513 | Unclassified | 1810 |
| 536 | nmdc:mga0rr50_188806_c1 | 3300050513 | Bacteria | 1688 |
| 537 | nmdc:mga0rr50_20743_c1 | 3300050513 | Bacteria | 4469 |
| 538 | nmdc:mga0rr50_352389_c1 | 3300050513 | Bacteria | 1238 |
| 539 | nmdc:mga0rr50_95721_c1 | 3300050513 | Bacteria | 2321 |
| 540 | nmdc:mga0rr50_982319_c1 | 3300050513 | Unclassified | 719 |
| 541 | nmdc:mga08x19_127573_c1 | 3300050514 | Bacteria | 1709 |
| 542 | nmdc:mga08x19_3025_c1 | 3300050514 | Bacteria | 10111 |
| 543 | nmdc:mga08x19_313549_c1 | 3300050514 | Bacteria | 1091 |
| 544 | nmdc:mga08x19_36409_c1 | 3300050514 | Bacteria | 3117 |
| 545 | nmdc:mga08x19_411276_c1 | 3300050514 | Bacteria | 950 |
| 546 | nmdc:mga08x19_449922_c1 | 3300050514 | Bacteria | 906 |
| 547 | nmdc:mga08x19_64868_c1 | 3300050514 | Unclassified | 2371 |
| 548 | nmdc:mga08x19_9881_c1 | 3300050514 | Bacteria | 5721 |
| 549 | nmdc:mga0a205_131_c1 | 3300050515 | Bacteria | 46472 |
| 550 | nmdc:mga0a205_158782_c1 | 3300050515 | Unclassified | 2159 |
| 551 | nmdc:mga0a205_550428_c1 | 3300050515 | Unclassified | 1009 |
| 552 | Ga0495601_0012746 | 3300053077 | Bacteria | 5046 |
| 553 | Ga0587066_067953 | 3300059490 | Unclassified | 743 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005471 | Ga0070698_100152939 | Ga0070698_1001529392 | 177 |
| 2 | 3300006175 | Ga0070712_100056545 | Ga0070712_1000565453 | 177 |
| 3 | 3300025915 | Ga0207693_10042748 | Ga0207693_100427483 | 177 |
| 4 | 3300005434 | Ga0070709_10106174 | Ga0070709_101061742 | 178 |
| 5 | 3300005436 | Ga0070713_100041168 | Ga0070713_1000411683 | 178 |
| 6 | 3300005437 | Ga0070710_10848745 | Ga0070710_108487451 | 178 |
| 7 | 3300006914 | Ga0075436_100005656 | Ga0075436_1000056569 | 178 |
| 8 | 3300006163 | Ga0070715_10017499 | Ga0070715_100174994 | 179 |
| 9 | 3300048908 | Ga0496105_0460297 | Ga0496105_0460297_216_764 | 179 |
| 10 | 3300050512 | nmdc:mga0n895_841193_c1 | nmdc:mga0n895_841193_c1_38_586 | 179 |
| 11 | 3300005293 | Ga0065715_10317810 | Ga0065715_103178101 | 180 |
| 12 | 3300005329 | Ga0070683_100054795 | Ga0070683_1000547953 | 180 |
| 13 | 3300005331 | Ga0070670_100356855 | Ga0070670_1003568552 | 180 |
| 14 | 3300005337 | Ga0070682_100049852 | Ga0070682_1000498522 | 180 |
| 15 | 3300005355 | Ga0070671_100053887 | Ga0070671_1000538873 | 180 |
| 16 | 3300005367 | Ga0070667_100584506 | Ga0070667_1005845062 | 180 |
| 17 | 3300005457 | Ga0070662_100055474 | Ga0070662_1000554742 | 180 |
| 18 | 3300005458 | Ga0070681_10344432 | Ga0070681_103444322 | 180 |
| 19 | 3300005549 | Ga0070704_100570955 | Ga0070704_1005709551 | 180 |
| 20 | 3300007265 | Ga0099794_10007517 | Ga0099794_100075173 | 180 |
| 21 | 3300009093 | Ga0105240_10185604 | Ga0105240_101856044 | 180 |
| 22 | 3300009093 | Ga0105240_10303723 | Ga0105240_103037232 | 180 |
| 23 | 3300009098 | Ga0105245_10039439 | Ga0105245_100394392 | 180 |
| 24 | 3300009101 | Ga0105247_10052555 | Ga0105247_100525552 | 180 |
| 25 | 3300009174 | Ga0105241_10053903 | Ga0105241_100539032 | 180 |
| 26 | 3300009545 | Ga0105237_10870809 | Ga0105237_108708092 | 180 |
| 27 | 3300009551 | Ga0105238_10033715 | Ga0105238_100337152 | 180 |
| 28 | 3300013105 | Ga0157369_10113928 | Ga0157369_101139283 | 180 |
| 29 | 3300013296 | Ga0157374_10521445 | Ga0157374_105214452 | 180 |
| 30 | 3300013297 | Ga0157378_10133895 | Ga0157378_101338953 | 180 |
| 31 | 3300013306 | Ga0163162_10375950 | Ga0163162_103759502 | 180 |
| 32 | 3300013307 | Ga0157372_10358884 | Ga0157372_103588842 | 180 |
| 33 | 3300014325 | Ga0163163_10257438 | Ga0163163_102574382 | 180 |
| 34 | 3300014497 | Ga0182008_10099269 | Ga0182008_100992692 | 180 |
| 35 | 3300014968 | Ga0157379_10043840 | Ga0157379_100438405 | 180 |
| 36 | 3300015261 | Ga0182006_1018515 | Ga0182006_10185153 | 180 |
| 37 | 3300015262 | Ga0182007_10005476 | Ga0182007_100054765 | 180 |
| 38 | 3300015265 | Ga0182005_1039684 | Ga0182005_10396842 | 180 |
| 39 | 3300025960 | Ga0207651_10380789 | Ga0207651_103807892 | 180 |
| 40 | 3300025986 | Ga0207658_10528222 | Ga0207658_105282222 | 180 |
| 41 | 3300035170 | Ga0373943_0523520 | Ga0373943_0523520_139_684 | 180 |
| 42 | 3300035691 | Ga0373931_0092729 | Ga0373931_0092729_11_562 | 180 |
| 43 | 3300039447 | Ga0436361_0586051 | Ga0436361_0586051_159_710 | 180 |
| 44 | 3300048905 | Ga0496102_0911696 | Ga0496102_0911696_153_704 | 180 |
| 45 | 3300048906 | Ga0496103_0013534 | Ga0496103_0013534_3927_4478 | 180 |
| 46 | 3300048907 | Ga0496104_0390545 | Ga0496104_0390545_630_1190 | 180 |
| 47 | 3300048908 | Ga0496105_0253670 | Ga0496105_0253670_327_878 | 180 |
| 48 | 3300048909 | Ga0496106_0599842 | Ga0496106_0599842_179_730 | 180 |
| 49 | 3300048910 | Ga0496107_0116934 | Ga0496107_0116934_42_593 | 180 |
| 50 | 3300048910 | Ga0496107_0218741 | Ga0496107_0218741_37_588 | 180 |
| 51 | 3300048912 | Ga0496109_0453263 | Ga0496109_0453263_624_1175 | 180 |
| 52 | 3300048913 | Ga0496110_0029670 | Ga0496110_0029670_3979_4530 | 180 |
| 53 | 3300048916 | Ga0496113_0016718 | Ga0496113_0016718_3578_4129 | 180 |
| 54 | 3300048929 | Ga0496126_0043586 | Ga0496126_0043586_1529_2080 | 180 |
| 55 | 3300005468 | Ga0070707_100092473 | Ga0070707_1000924732 | 185 |
| 56 | 3300005471 | Ga0070698_100543470 | Ga0070698_1005434702 | 185 |
| 57 | 3300025922 | Ga0207646_10032934 | Ga0207646_100329342 | 185 |
| 58 | 3300028379 | Ga0268266_10071304 | Ga0268266_100713043 | 185 |
| 59 | 3300005445 | Ga0070708_100015179 | Ga0070708_1000151796 | 186 |
| 60 | 3300025927 | Ga0207687_10208604 | Ga0207687_102086042 | 186 |
| 61 | 3300025916 | Ga0207663_10767584 | Ga0207663_107675841 | 187 |
| 62 | 3300022732 | Ga0224569_102112 | Ga0224569_1021121 | 190 |
| 63 | 3300028017 | Ga0265356_1000027 | Ga0265356_100002717 | 190 |
| 64 | 3300030760 | Ga0265762_1000913 | Ga0265762_10009134 | 190 |
| 65 | 3300030760 | Ga0265762_1002989 | Ga0265762_10029892 | 190 |
| 66 | 3300031090 | Ga0265760_10001555 | Ga0265760_100015552 | 190 |
| 67 | 3300005295 | Ga0065707_10314487 | Ga0065707_103144871 | 191 |
| 68 | 3300005356 | Ga0070674_101025938 | Ga0070674_1010259381 | 191 |
| 69 | 3300005434 | Ga0070709_10086646 | Ga0070709_100866462 | 191 |
| 70 | 3300005536 | Ga0070697_100414562 | Ga0070697_1004145622 | 191 |
| 71 | 3300006173 | Ga0070716_100227149 | Ga0070716_1002271492 | 191 |
| 72 | 3300006871 | Ga0075434_100015193 | Ga0075434_1000151935 | 191 |
| 73 | 3300009147 | Ga0114129_10094507 | Ga0114129_100945074 | 191 |
| 74 | 3300009176 | Ga0105242_10061499 | Ga0105242_100614994 | 191 |
| 75 | 3300009545 | Ga0105237_10186374 | Ga0105237_101863742 | 191 |
| 76 | 3300013297 | Ga0157378_10004037 | Ga0157378_100040373 | 191 |
| 77 | 3300013307 | Ga0157372_10353343 | Ga0157372_103533432 | 191 |
| 78 | 3300013308 | Ga0157375_10064353 | Ga0157375_100643532 | 191 |
| 79 | 3300025914 | Ga0207671_10181981 | Ga0207671_101819812 | 191 |
| 80 | 3300036401 | Ga0373937_0505133 | Ga0373937_0505133_487_1071 | 191 |
| 81 | 3300050512 | nmdc:mga0n895_30546_c1 | nmdc:mga0n895_30546_c1_2216_2809 | 191 |
| 82 | 3300050513 | nmdc:mga0rr50_982319_c1 | nmdc:mga0rr50_982319_c1_66_659 | 191 |
| 83 | 3300050515 | nmdc:mga0a205_158782_c1 | nmdc:mga0a205_158782_c1_366_959 | 191 |
| 84 | 3300005436 | Ga0070713_100613505 | Ga0070713_1006135051 | 192 |
| 85 | 3300005439 | Ga0070711_100222082 | Ga0070711_1002220822 | 192 |
| 86 | 3300005445 | Ga0070708_100030590 | Ga0070708_1000305904 | 192 |
| 87 | 3300005468 | Ga0070707_100009766 | Ga0070707_1000097663 | 192 |
| 88 | 3300005468 | Ga0070707_100664030 | Ga0070707_1006640302 | 192 |
| 89 | 3300005518 | Ga0070699_100035282 | Ga0070699_1000352823 | 192 |
| 90 | 3300005536 | Ga0070697_100008196 | Ga0070697_1000081965 | 192 |
| 91 | 3300005536 | Ga0070697_100435552 | Ga0070697_1004355522 | 192 |
| 92 | 3300005548 | Ga0070665_100003940 | Ga0070665_1000039402 | 192 |
| 93 | 3300005841 | Ga0068863_100010773 | Ga0068863_1000107733 | 192 |
| 94 | 3300005841 | Ga0068863_100747970 | Ga0068863_1007479702 | 192 |
| 95 | 3300005842 | Ga0068858_100316924 | Ga0068858_1003169242 | 192 |
| 96 | 3300005843 | Ga0068860_100039273 | Ga0068860_1000392732 | 192 |
| 97 | 3300005843 | Ga0068860_100319318 | Ga0068860_1003193181 | 192 |
| 98 | 3300006173 | Ga0070716_100002507 | Ga0070716_1000025072 | 192 |
| 99 | 3300006173 | Ga0070716_100128742 | Ga0070716_1001287422 | 192 |
| 100 | 3300006173 | Ga0070716_100229652 | Ga0070716_1002296522 | 192 |
| 101 | 3300006175 | Ga0070712_100055043 | Ga0070712_1000550432 | 192 |
| 102 | 3300006237 | Ga0097621_100005597 | Ga0097621_1000055976 | 192 |
| 103 | 3300006358 | Ga0068871_100049819 | Ga0068871_1000498192 | 192 |
| 104 | 3300006852 | Ga0075433_10182058 | Ga0075433_101820582 | 192 |
| 105 | 3300006852 | Ga0075433_10612426 | Ga0075433_106124262 | 192 |
| 106 | 3300006871 | Ga0075434_100001669 | Ga0075434_1000016694 | 192 |
| 107 | 3300006871 | Ga0075434_100009940 | Ga0075434_1000099404 | 192 |
| 108 | 3300006871 | Ga0075434_100371612 | Ga0075434_1003716122 | 192 |
| 109 | 3300006881 | Ga0068865_100365961 | Ga0068865_1003659612 | 192 |
| 110 | 3300006914 | Ga0075436_100109039 | Ga0075436_1001090392 | 192 |
| 111 | 3300006914 | Ga0075436_100486112 | Ga0075436_1004861121 | 192 |
| 112 | 3300007076 | Ga0075435_100029450 | Ga0075435_1000294504 | 192 |
| 113 | 3300007076 | Ga0075435_100031021 | Ga0075435_1000310212 | 192 |
| 114 | 3300007076 | Ga0075435_100225426 | Ga0075435_1002254262 | 192 |
| 115 | 3300007076 | Ga0075435_100250449 | Ga0075435_1002504492 | 192 |
| 116 | 3300007265 | Ga0099794_10309659 | Ga0099794_103096592 | 192 |
| 117 | 3300009093 | Ga0105240_10026434 | Ga0105240_100264348 | 192 |
| 118 | 3300009545 | Ga0105237_10662855 | Ga0105237_106628552 | 192 |
| 119 | 3300009545 | Ga0105237_11315919 | Ga0105237_113159192 | 192 |
| 120 | 3300010159 | Ga0099796_10002143 | Ga0099796_100021432 | 192 |
| 121 | 3300013296 | Ga0157374_10391603 | Ga0157374_103916032 | 192 |
| 122 | 3300013297 | Ga0157378_10029642 | Ga0157378_100296422 | 192 |
| 123 | 3300013308 | Ga0157375_10027686 | Ga0157375_100276862 | 192 |
| 124 | 3300014968 | Ga0157379_10021319 | Ga0157379_100213193 | 192 |
| 125 | 3300014969 | Ga0157376_10000023 | Ga0157376_10000023103 | 192 |
| 126 | 3300021384 | Ga0213876_10111152 | Ga0213876_101111522 | 192 |
| 127 | 3300025910 | Ga0207684_10098505 | Ga0207684_100985052 | 192 |
| 128 | 3300025915 | Ga0207693_10174310 | Ga0207693_101743102 | 192 |
| 129 | 3300025915 | Ga0207693_10240842 | Ga0207693_102408422 | 192 |
| 130 | 3300025916 | Ga0207663_10243974 | Ga0207663_102439742 | 192 |
| 131 | 3300025922 | Ga0207646_10001706 | Ga0207646_100017062 | 192 |
| 132 | 3300025922 | Ga0207646_10158189 | Ga0207646_101581892 | 192 |
| 133 | 3300025939 | Ga0207665_10148218 | Ga0207665_101482181 | 192 |
| 134 | 3300025939 | Ga0207665_10213410 | Ga0207665_102134102 | 192 |
| 135 | 3300026035 | Ga0207703_10171510 | Ga0207703_101715102 | 192 |
| 136 | 3300026088 | Ga0207641_10003212 | Ga0207641_100032127 | 192 |
| 137 | 3300026088 | Ga0207641_10718457 | Ga0207641_107184572 | 192 |
| 138 | 3300028379 | Ga0268266_10000276 | Ga0268266_1000027660 | 192 |
| 139 | 3300028381 | Ga0268264_10028085 | Ga0268264_100280854 | 192 |
| 140 | 3300028381 | Ga0268264_10546639 | Ga0268264_105466391 | 192 |
| 141 | 3300035088 | Ga0373940_0139147 | Ga0373940_0139147_67_663 | 192 |
| 142 | 3300035691 | Ga0373931_0135623 | Ga0373931_0135623_317_913 | 192 |
| 143 | 3300035695 | Ga0373927_0145595 | Ga0373927_0145595_465_1061 | 192 |
| 144 | 3300039437 | Ga0436365_1656802 | Ga0436365_1656802_5383_5985 | 192 |
| 145 | 3300044693 | Ga0466961_0236673 | Ga0466961_0236673_68_658 | 192 |
| 146 | 3300046455 | Ga0495603_0118668 | Ga0495603_0118668_413_1009 | 192 |
| 147 | 3300046461 | Ga0495641_0028581 | Ga0495641_0028581_45_641 | 192 |
| 148 | 3300046472 | Ga0495580_0085113 | Ga0495580_0085113_1500_2096 | 192 |
| 149 | 3300046473 | Ga0495582_0000277 | Ga0495582_0000277_11806_12402 | 192 |
| 150 | 3300048913 | Ga0496110_0975342 | Ga0496110_0975342_13_609 | 192 |
| 151 | 3300048917 | Ga0496114_0036562 | Ga0496114_0036562_3293_3889 | 192 |
| 152 | 3300048918 | Ga0496115_0006608 | Ga0496115_0006608_162_758 | 192 |
| 153 | 3300050512 | nmdc:mga0n895_11535_c1 | nmdc:mga0n895_11535_c1_6186_6782 | 192 |
| 154 | 3300050512 | nmdc:mga0n895_44202_c1 | nmdc:mga0n895_44202_c1_1823_2419 | 192 |
| 155 | 3300050513 | nmdc:mga0rr50_163115_c1 | nmdc:mga0rr50_163115_c1_613_1209 | 192 |
| 156 | 3300050513 | nmdc:mga0rr50_188806_c1 | nmdc:mga0rr50_188806_c1_885_1481 | 192 |
| 157 | 3300050513 | nmdc:mga0rr50_20743_c1 | nmdc:mga0rr50_20743_c1_3038_3634 | 192 |
| 158 | 3300050513 | nmdc:mga0rr50_352389_c1 | nmdc:mga0rr50_352389_c1_241_837 | 192 |
| 159 | 3300050514 | nmdc:mga08x19_411276_c1 | nmdc:mga08x19_411276_c1_255_851 | 192 |
| 160 | 3300050514 | nmdc:mga08x19_449922_c1 | nmdc:mga08x19_449922_c1_269_865 | 192 |
| 161 | 3300050514 | nmdc:mga08x19_64868_c1 | nmdc:mga08x19_64868_c1_791_1387 | 192 |
| 162 | 3300050515 | nmdc:mga0a205_550428_c1 | nmdc:mga0a205_550428_c1_400_996 | 192 |
| 163 | 3300003320 | rootH2_10048788 | rootH2_100487884 | 193 |
| 164 | 3300003320 | rootH2_10150870 | rootH2_101508704 | 193 |
| 165 | 3300005329 | Ga0070683_100009054 | Ga0070683_1000090546 | 193 |
| 166 | 3300005330 | Ga0070690_100040445 | Ga0070690_1000404452 | 193 |
| 167 | 3300005333 | Ga0070677_10065822 | Ga0070677_100658222 | 193 |
| 168 | 3300005334 | Ga0068869_100032775 | Ga0068869_1000327752 | 193 |
| 169 | 3300005335 | Ga0070666_10002725 | Ga0070666_100027256 | 193 |
| 170 | 3300005337 | Ga0070682_100027590 | Ga0070682_1000275905 | 193 |
| 171 | 3300005338 | Ga0068868_100107040 | Ga0068868_1001070402 | 193 |
| 172 | 3300005338 | Ga0068868_100221756 | Ga0068868_1002217562 | 193 |
| 173 | 3300005339 | Ga0070660_100035237 | Ga0070660_1000352372 | 193 |
| 174 | 3300005339 | Ga0070660_100627570 | Ga0070660_1006275701 | 193 |
| 175 | 3300005344 | Ga0070661_100005979 | Ga0070661_1000059796 | 193 |
| 176 | 3300005345 | Ga0070692_10062447 | Ga0070692_100624472 | 193 |
| 177 | 3300005347 | Ga0070668_100006081 | Ga0070668_1000060816 | 193 |
| 178 | 3300005353 | Ga0070669_100022835 | Ga0070669_1000228352 | 193 |
| 179 | 3300005356 | Ga0070674_100046373 | Ga0070674_1000463732 | 193 |
| 180 | 3300005366 | Ga0070659_100011058 | Ga0070659_1000110583 | 193 |
| 181 | 3300005367 | Ga0070667_100005223 | Ga0070667_1000052237 | 193 |
| 182 | 3300005406 | Ga0070703_10029972 | Ga0070703_100299722 | 193 |
| 183 | 3300005406 | Ga0070703_10170370 | Ga0070703_101703702 | 193 |
| 184 | 3300005434 | Ga0070709_10031441 | Ga0070709_100314413 | 193 |
| 185 | 3300005434 | Ga0070709_10033696 | Ga0070709_100336963 | 193 |
| 186 | 3300005434 | Ga0070709_10074216 | Ga0070709_100742162 | 193 |
| 187 | 3300005435 | Ga0070714_100006555 | Ga0070714_1000065558 | 193 |
| 188 | 3300005435 | Ga0070714_100051489 | Ga0070714_1000514894 | 193 |
| 189 | 3300005435 | Ga0070714_100190006 | Ga0070714_1001900062 | 193 |
| 190 | 3300005435 | Ga0070714_100513670 | Ga0070714_1005136702 | 193 |
| 191 | 3300005435 | Ga0070714_100675222 | Ga0070714_1006752222 | 193 |
| 192 | 3300005435 | Ga0070714_100817417 | Ga0070714_1008174171 | 193 |
| 193 | 3300005435 | Ga0070714_100909272 | Ga0070714_1009092722 | 193 |
| 194 | 3300005436 | Ga0070713_100000134 | Ga0070713_10000013445 | 193 |
| 195 | 3300005436 | Ga0070713_100102065 | Ga0070713_1001020651 | 193 |
| 196 | 3300005439 | Ga0070711_100001063 | Ga0070711_1000010636 | 193 |
| 197 | 3300005439 | Ga0070711_100189442 | Ga0070711_1001894422 | 193 |
| 198 | 3300005439 | Ga0070711_100300812 | Ga0070711_1003008122 | 193 |
| 199 | 3300005440 | Ga0070705_100002589 | Ga0070705_1000025892 | 193 |
| 200 | 3300005440 | Ga0070705_100250029 | Ga0070705_1002500292 | 193 |
| 201 | 3300005444 | Ga0070694_100122448 | Ga0070694_1001224481 | 193 |
| 202 | 3300005445 | Ga0070708_100000598 | Ga0070708_10000059814 | 193 |
| 203 | 3300005445 | Ga0070708_100004228 | Ga0070708_1000042285 | 193 |
| 204 | 3300005445 | Ga0070708_100013577 | Ga0070708_1000135776 | 193 |
| 205 | 3300005445 | Ga0070708_100015797 | Ga0070708_1000157973 | 193 |
| 206 | 3300005455 | Ga0070663_100003084 | Ga0070663_1000030846 | 193 |
| 207 | 3300005455 | Ga0070663_101021088 | Ga0070663_1010210881 | 193 |
| 208 | 3300005456 | Ga0070678_100308182 | Ga0070678_1003081822 | 193 |
| 209 | 3300005457 | Ga0070662_100001005 | Ga0070662_10000100511 | 193 |
| 210 | 3300005458 | Ga0070681_11105105 | Ga0070681_111051051 | 193 |
| 211 | 3300005459 | Ga0068867_100028245 | Ga0068867_1000282452 | 193 |
| 212 | 3300005467 | Ga0070706_100000980 | Ga0070706_10000098026 | 193 |
| 213 | 3300005467 | Ga0070706_100001398 | Ga0070706_10000139824 | 193 |
| 214 | 3300005467 | Ga0070706_100033580 | Ga0070706_1000335802 | 193 |
| 215 | 3300005467 | Ga0070706_100098351 | Ga0070706_1000983512 | 193 |
| 216 | 3300005468 | Ga0070707_100000915 | Ga0070707_1000009152 | 193 |
| 217 | 3300005468 | Ga0070707_100269588 | Ga0070707_1002695882 | 193 |
| 218 | 3300005471 | Ga0070698_100000140 | Ga0070698_10000014044 | 193 |
| 219 | 3300005471 | Ga0070698_100000158 | Ga0070698_10000015820 | 193 |
| 220 | 3300005518 | Ga0070699_100006667 | Ga0070699_1000066677 | 193 |
| 221 | 3300005518 | Ga0070699_100006913 | Ga0070699_1000069135 | 193 |
| 222 | 3300005530 | Ga0070679_100022913 | Ga0070679_1000229132 | 193 |
| 223 | 3300005530 | Ga0070679_100627846 | Ga0070679_1006278461 | 193 |
| 224 | 3300005535 | Ga0070684_100011109 | Ga0070684_1000111094 | 193 |
| 225 | 3300005536 | Ga0070697_100000518 | Ga0070697_1000005185 | 193 |
| 226 | 3300005536 | Ga0070697_100001215 | Ga0070697_1000012156 | 193 |
| 227 | 3300005536 | Ga0070697_100009318 | Ga0070697_1000093182 | 193 |
| 228 | 3300005536 | Ga0070697_100012341 | Ga0070697_1000123416 | 193 |
| 229 | 3300005536 | Ga0070697_100110342 | Ga0070697_1001103423 | 193 |
| 230 | 3300005536 | Ga0070697_100157742 | Ga0070697_1001577422 | 193 |
| 231 | 3300005539 | Ga0068853_100043685 | Ga0068853_1000436852 | 193 |
| 232 | 3300005539 | Ga0068853_100132519 | Ga0068853_1001325192 | 193 |
| 233 | 3300005543 | Ga0070672_100167104 | Ga0070672_1001671042 | 193 |
| 234 | 3300005544 | Ga0070686_100023364 | Ga0070686_1000233642 | 193 |
| 235 | 3300005545 | Ga0070695_100000210 | Ga0070695_1000002107 | 193 |
| 236 | 3300005545 | Ga0070695_100371555 | Ga0070695_1003715551 | 193 |
| 237 | 3300005545 | Ga0070695_100558306 | Ga0070695_1005583061 | 193 |
| 238 | 3300005546 | Ga0070696_100002816 | Ga0070696_1000028163 | 193 |
| 239 | 3300005546 | Ga0070696_100231835 | Ga0070696_1002318352 | 193 |
| 240 | 3300005546 | Ga0070696_100303997 | Ga0070696_1003039971 | 193 |
| 241 | 3300005547 | Ga0070693_100000105 | Ga0070693_10000010516 | 193 |
| 242 | 3300005547 | Ga0070693_100891929 | Ga0070693_1008919291 | 193 |
| 243 | 3300005548 | Ga0070665_100010236 | Ga0070665_1000102366 | 193 |
| 244 | 3300005563 | Ga0068855_100506571 | Ga0068855_1005065712 | 193 |
| 245 | 3300005563 | Ga0068855_100550895 | Ga0068855_1005508951 | 193 |
| 246 | 3300005563 | Ga0068855_100602790 | Ga0068855_1006027902 | 193 |
| 247 | 3300005563 | Ga0068855_100784803 | Ga0068855_1007848032 | 193 |
| 248 | 3300005564 | Ga0070664_100010450 | Ga0070664_1000104506 | 193 |
| 249 | 3300005577 | Ga0068857_100333903 | Ga0068857_1003339031 | 193 |
| 250 | 3300005578 | Ga0068854_100033290 | Ga0068854_1000332902 | 193 |
| 251 | 3300005614 | Ga0068856_100008986 | Ga0068856_1000089864 | 193 |
| 252 | 3300005614 | Ga0068856_100279673 | Ga0068856_1002796732 | 193 |
| 253 | 3300005616 | Ga0068852_100031868 | Ga0068852_1000318682 | 193 |
| 254 | 3300005616 | Ga0068852_100449019 | Ga0068852_1004490192 | 193 |
| 255 | 3300005617 | Ga0068859_100006285 | Ga0068859_1000062853 | 193 |
| 256 | 3300005718 | Ga0068866_10022326 | Ga0068866_100223262 | 193 |
| 257 | 3300005834 | Ga0068851_10003049 | Ga0068851_100030496 | 193 |
| 258 | 3300005834 | Ga0068851_10042607 | Ga0068851_100426072 | 193 |
| 259 | 3300005841 | Ga0068863_100089612 | Ga0068863_1000896122 | 193 |
| 260 | 3300005841 | Ga0068863_100196853 | Ga0068863_1001968532 | 193 |
| 261 | 3300005841 | Ga0068863_100224760 | Ga0068863_1002247602 | 193 |
| 262 | 3300005842 | Ga0068858_100025578 | Ga0068858_1000255784 | 193 |
| 263 | 3300005843 | Ga0068860_100008766 | Ga0068860_1000087665 | 193 |
| 264 | 3300005844 | Ga0068862_100036976 | Ga0068862_1000369761 | 193 |
| 265 | 3300006028 | Ga0070717_10001280 | Ga0070717_100012807 | 193 |
| 266 | 3300006028 | Ga0070717_10004636 | Ga0070717_100046363 | 193 |
| 267 | 3300006028 | Ga0070717_10009698 | Ga0070717_100096987 | 193 |
| 268 | 3300006028 | Ga0070717_10381421 | Ga0070717_103814212 | 193 |
| 269 | 3300006163 | Ga0070715_10001337 | Ga0070715_100013373 | 193 |
| 270 | 3300006173 | Ga0070716_100002526 | Ga0070716_1000025268 | 193 |
| 271 | 3300006173 | Ga0070716_100006521 | Ga0070716_1000065212 | 193 |
| 272 | 3300006173 | Ga0070716_100006812 | Ga0070716_1000068123 | 193 |
| 273 | 3300006173 | Ga0070716_100011190 | Ga0070716_1000111905 | 193 |
| 274 | 3300006173 | Ga0070716_100025668 | Ga0070716_1000256683 | 193 |
| 275 | 3300006173 | Ga0070716_100198548 | Ga0070716_1001985482 | 193 |
| 276 | 3300006175 | Ga0070712_100001951 | Ga0070712_1000019516 | 193 |
| 277 | 3300006175 | Ga0070712_100036702 | Ga0070712_1000367022 | 193 |
| 278 | 3300006175 | Ga0070712_100220237 | Ga0070712_1002202372 | 193 |
| 279 | 3300006175 | Ga0070712_100296506 | Ga0070712_1002965062 | 193 |
| 280 | 3300006237 | Ga0097621_100007474 | Ga0097621_1000074746 | 193 |
| 281 | 3300006237 | Ga0097621_100022905 | Ga0097621_1000229052 | 193 |
| 282 | 3300006358 | Ga0068871_100105067 | Ga0068871_1001050672 | 193 |
| 283 | 3300006852 | Ga0075433_10000213 | Ga0075433_1000021327 | 193 |
| 284 | 3300006871 | Ga0075434_100000122 | Ga0075434_10000012219 | 193 |
| 285 | 3300006881 | Ga0068865_100005168 | Ga0068865_1000051685 | 193 |
| 286 | 3300006881 | Ga0068865_100087130 | Ga0068865_1000871302 | 193 |
| 287 | 3300006914 | Ga0075436_100002250 | Ga0075436_1000022505 | 193 |
| 288 | 3300006914 | Ga0075436_100014222 | Ga0075436_1000142223 | 193 |
| 289 | 3300006914 | Ga0075436_100041204 | Ga0075436_1000412045 | 193 |
| 290 | 3300006914 | Ga0075436_100176807 | Ga0075436_1001768072 | 193 |
| 291 | 3300006931 | Ga0097620_100006285 | Ga0097620_1000062858 | 193 |
| 292 | 3300007076 | Ga0075435_100000038 | Ga0075435_10000003818 | 193 |
| 293 | 3300007076 | Ga0075435_100322397 | Ga0075435_1003223972 | 193 |
| 294 | 3300007265 | Ga0099794_10071736 | Ga0099794_100717362 | 193 |
| 295 | 3300009093 | Ga0105240_10016695 | Ga0105240_100166956 | 193 |
| 296 | 3300009093 | Ga0105240_10022638 | Ga0105240_100226385 | 193 |
| 297 | 3300009093 | Ga0105240_10062894 | Ga0105240_100628943 | 193 |
| 298 | 3300009093 | Ga0105240_10083446 | Ga0105240_100834466 | 193 |
| 299 | 3300009093 | Ga0105240_10116590 | Ga0105240_101165902 | 193 |
| 300 | 3300009098 | Ga0105245_10064479 | Ga0105245_100644792 | 193 |
| 301 | 3300009101 | Ga0105247_10003343 | Ga0105247_100033435 | 193 |
| 302 | 3300009101 | Ga0105247_10953716 | Ga0105247_109537161 | 193 |
| 303 | 3300009147 | Ga0114129_10494583 | Ga0114129_104945832 | 193 |
| 304 | 3300009148 | Ga0105243_10056060 | Ga0105243_100560602 | 193 |
| 305 | 3300009174 | Ga0105241_10018950 | Ga0105241_100189504 | 193 |
| 306 | 3300009174 | Ga0105241_10412773 | Ga0105241_104127731 | 193 |
| 307 | 3300009174 | Ga0105241_10416357 | Ga0105241_104163571 | 193 |
| 308 | 3300009176 | Ga0105242_10056234 | Ga0105242_100562343 | 193 |
| 309 | 3300009176 | Ga0105242_10090589 | Ga0105242_100905892 | 193 |
| 310 | 3300009177 | Ga0105248_10000003 | Ga0105248_10000003672 | 193 |
| 311 | 3300009177 | Ga0105248_10155332 | Ga0105248_101553321 | 193 |
| 312 | 3300009545 | Ga0105237_10076278 | Ga0105237_100762781 | 193 |
| 313 | 3300009551 | Ga0105238_10614563 | Ga0105238_106145632 | 193 |
| 314 | 3300009551 | Ga0105238_11123849 | Ga0105238_111238491 | 193 |
| 315 | 3300009553 | Ga0105249_10026101 | Ga0105249_100261013 | 193 |
| 316 | 3300009553 | Ga0105249_10161356 | Ga0105249_101613562 | 193 |
| 317 | 3300010375 | Ga0105239_10472365 | Ga0105239_104723652 | 193 |
| 318 | 3300010375 | Ga0105239_10730824 | Ga0105239_107308241 | 193 |
| 319 | 3300010375 | Ga0105239_11722332 | Ga0105239_117223321 | 193 |
| 320 | 3300011119 | Ga0105246_10065671 | Ga0105246_100656712 | 193 |
| 321 | 3300011119 | Ga0105246_10116297 | Ga0105246_101162972 | 193 |
| 322 | 3300013100 | Ga0157373_10015048 | Ga0157373_100150481 | 193 |
| 323 | 3300013100 | Ga0157373_10042013 | Ga0157373_100420131 | 193 |
| 324 | 3300013100 | Ga0157373_10432142 | Ga0157373_104321422 | 193 |
| 325 | 3300013102 | Ga0157371_10031814 | Ga0157371_100318142 | 193 |
| 326 | 3300013104 | Ga0157370_10262990 | Ga0157370_102629902 | 193 |
| 327 | 3300013104 | Ga0157370_10600937 | Ga0157370_106009371 | 193 |
| 328 | 3300013105 | Ga0157369_10286887 | Ga0157369_102868872 | 193 |
| 329 | 3300013296 | Ga0157374_10003917 | Ga0157374_100039178 | 193 |
| 330 | 3300013296 | Ga0157374_10015000 | Ga0157374_100150006 | 193 |
| 331 | 3300013296 | Ga0157374_10251360 | Ga0157374_102513602 | 193 |
| 332 | 3300013296 | Ga0157374_10440978 | Ga0157374_104409781 | 193 |
| 333 | 3300013297 | Ga0157378_10000114 | Ga0157378_1000011454 | 193 |
| 334 | 3300013297 | Ga0157378_10028879 | Ga0157378_100288792 | 193 |
| 335 | 3300013297 | Ga0157378_10230917 | Ga0157378_102309172 | 193 |
| 336 | 3300013306 | Ga0163162_10005493 | Ga0163162_100054936 | 193 |
| 337 | 3300013306 | Ga0163162_10030398 | Ga0163162_100303982 | 193 |
| 338 | 3300013306 | Ga0163162_10095694 | Ga0163162_100956942 | 193 |
| 339 | 3300013307 | Ga0157372_10000504 | Ga0157372_1000050421 | 193 |
| 340 | 3300013307 | Ga0157372_10143191 | Ga0157372_101431913 | 193 |
| 341 | 3300013308 | Ga0157375_11096674 | Ga0157375_110966741 | 193 |
| 342 | 3300014325 | Ga0163163_10137364 | Ga0163163_101373643 | 193 |
| 343 | 3300014325 | Ga0163163_10163706 | Ga0163163_101637062 | 193 |
| 344 | 3300014325 | Ga0163163_10922546 | Ga0163163_109225462 | 193 |
| 345 | 3300014497 | Ga0182008_10004291 | Ga0182008_100042914 | 193 |
| 346 | 3300014968 | Ga0157379_10292769 | Ga0157379_102927692 | 193 |
| 347 | 3300014968 | Ga0157379_10475549 | Ga0157379_104755492 | 193 |
| 348 | 3300014969 | Ga0157376_10057382 | Ga0157376_100573821 | 193 |
| 349 | 3300014969 | Ga0157376_10135309 | Ga0157376_101353092 | 193 |
| 350 | 3300014969 | Ga0157376_10818833 | Ga0157376_108188332 | 193 |
| 351 | 3300025885 | Ga0207653_10034523 | Ga0207653_100345233 | 193 |
| 352 | 3300025885 | Ga0207653_10140514 | Ga0207653_101405141 | 193 |
| 353 | 3300025893 | Ga0207682_10266035 | Ga0207682_102660351 | 193 |
| 354 | 3300025898 | Ga0207692_10235925 | Ga0207692_102359252 | 193 |
| 355 | 3300025899 | Ga0207642_10015333 | Ga0207642_100153332 | 193 |
| 356 | 3300025900 | Ga0207710_10135149 | Ga0207710_101351491 | 193 |
| 357 | 3300025903 | Ga0207680_10032847 | Ga0207680_100328472 | 193 |
| 358 | 3300025905 | Ga0207685_10001246 | Ga0207685_100012464 | 193 |
| 359 | 3300025906 | Ga0207699_10028244 | Ga0207699_100282441 | 193 |
| 360 | 3300025906 | Ga0207699_10029731 | Ga0207699_100297314 | 193 |
| 361 | 3300025906 | Ga0207699_10111952 | Ga0207699_101119522 | 193 |
| 362 | 3300025906 | Ga0207699_10317108 | Ga0207699_103171082 | 193 |
| 363 | 3300025906 | Ga0207699_10345746 | Ga0207699_103457461 | 193 |
| 364 | 3300025907 | Ga0207645_10003288 | Ga0207645_100032884 | 193 |
| 365 | 3300025909 | Ga0207705_10044818 | Ga0207705_100448183 | 193 |
| 366 | 3300025910 | Ga0207684_10001117 | Ga0207684_1000111716 | 193 |
| 367 | 3300025910 | Ga0207684_10007311 | Ga0207684_100073118 | 193 |
| 368 | 3300025910 | Ga0207684_10007842 | Ga0207684_100078422 | 193 |
| 369 | 3300025910 | Ga0207684_10086066 | Ga0207684_100860662 | 193 |
| 370 | 3300025911 | Ga0207654_10007623 | Ga0207654_100076232 | 193 |
| 371 | 3300025911 | Ga0207654_10037774 | Ga0207654_100377742 | 193 |
| 372 | 3300025911 | Ga0207654_10322744 | Ga0207654_103227442 | 193 |
| 373 | 3300025912 | Ga0207707_10045887 | Ga0207707_100458873 | 193 |
| 374 | 3300025912 | Ga0207707_10691626 | Ga0207707_106916262 | 193 |
| 375 | 3300025913 | Ga0207695_10043213 | Ga0207695_100432133 | 193 |
| 376 | 3300025913 | Ga0207695_10044444 | Ga0207695_100444446 | 193 |
| 377 | 3300025913 | Ga0207695_10110645 | Ga0207695_101106453 | 193 |
| 378 | 3300025914 | Ga0207671_10010795 | Ga0207671_100107952 | 193 |
| 379 | 3300025914 | Ga0207671_10075610 | Ga0207671_100756102 | 193 |
| 380 | 3300025915 | Ga0207693_10000275 | Ga0207693_100002759 | 193 |
| 381 | 3300025915 | Ga0207693_10011260 | Ga0207693_100112606 | 193 |
| 382 | 3300025915 | Ga0207693_10047262 | Ga0207693_100472623 | 193 |
| 383 | 3300025915 | Ga0207693_10360997 | Ga0207693_103609971 | 193 |
| 384 | 3300025916 | Ga0207663_10002133 | Ga0207663_100021332 | 193 |
| 385 | 3300025916 | Ga0207663_10145788 | Ga0207663_101457882 | 193 |
| 386 | 3300025917 | Ga0207660_10018437 | Ga0207660_100184374 | 193 |
| 387 | 3300025919 | Ga0207657_10000254 | Ga0207657_100002544 | 193 |
| 388 | 3300025919 | Ga0207657_10002735 | Ga0207657_1000273514 | 193 |
| 389 | 3300025921 | Ga0207652_10357849 | Ga0207652_103578492 | 193 |
| 390 | 3300025922 | Ga0207646_10000471 | Ga0207646_1000047116 | 193 |
| 391 | 3300025922 | Ga0207646_10232725 | Ga0207646_102327252 | 193 |
| 392 | 3300025924 | Ga0207694_10247742 | Ga0207694_102477422 | 193 |
| 393 | 3300025924 | Ga0207694_10291873 | Ga0207694_102918732 | 193 |
| 394 | 3300025924 | Ga0207694_10776849 | Ga0207694_107768491 | 193 |
| 395 | 3300025927 | Ga0207687_10004264 | Ga0207687_100042645 | 193 |
| 396 | 3300025927 | Ga0207687_10084379 | Ga0207687_100843792 | 193 |
| 397 | 3300025928 | Ga0207700_10000111 | Ga0207700_1000011124 | 193 |
| 398 | 3300025928 | Ga0207700_10038908 | Ga0207700_100389082 | 193 |
| 399 | 3300025928 | Ga0207700_10056938 | Ga0207700_100569382 | 193 |
| 400 | 3300025928 | Ga0207700_10824728 | Ga0207700_108247281 | 193 |
| 401 | 3300025929 | Ga0207664_10025215 | Ga0207664_100252154 | 193 |
| 402 | 3300025929 | Ga0207664_10320793 | Ga0207664_103207932 | 193 |
| 403 | 3300025929 | Ga0207664_10498784 | Ga0207664_104987841 | 193 |
| 404 | 3300025929 | Ga0207664_10692927 | Ga0207664_106929272 | 193 |
| 405 | 3300025929 | Ga0207664_10711309 | Ga0207664_107113091 | 193 |
| 406 | 3300025932 | Ga0207690_10447803 | Ga0207690_104478032 | 193 |
| 407 | 3300025933 | Ga0207706_10003488 | Ga0207706_100034887 | 193 |
| 408 | 3300025933 | Ga0207706_10033194 | Ga0207706_100331944 | 193 |
| 409 | 3300025934 | Ga0207686_10264580 | Ga0207686_102645801 | 193 |
| 410 | 3300025935 | Ga0207709_10355731 | Ga0207709_103557312 | 193 |
| 411 | 3300025938 | Ga0207704_10006270 | Ga0207704_100062705 | 193 |
| 412 | 3300025939 | Ga0207665_10006116 | Ga0207665_100061166 | 193 |
| 413 | 3300025939 | Ga0207665_10009881 | Ga0207665_100098813 | 193 |
| 414 | 3300025939 | Ga0207665_10011970 | Ga0207665_100119706 | 193 |
| 415 | 3300025939 | Ga0207665_10019746 | Ga0207665_100197461 | 193 |
| 416 | 3300025939 | Ga0207665_10045237 | Ga0207665_100452372 | 193 |
| 417 | 3300025939 | Ga0207665_11070604 | Ga0207665_110706041 | 193 |
| 418 | 3300025940 | Ga0207691_10299112 | Ga0207691_102991122 | 193 |
| 419 | 3300025941 | Ga0207711_10000013 | Ga0207711_10000013248 | 193 |
| 420 | 3300025941 | Ga0207711_10000708 | Ga0207711_100007083 | 193 |
| 421 | 3300025942 | Ga0207689_10024883 | Ga0207689_100248834 | 193 |
| 422 | 3300025944 | Ga0207661_10083173 | Ga0207661_100831732 | 193 |
| 423 | 3300025945 | Ga0207679_10036880 | Ga0207679_100368804 | 193 |
| 424 | 3300025945 | Ga0207679_10215994 | Ga0207679_102159942 | 193 |
| 425 | 3300025949 | Ga0207667_10005768 | Ga0207667_100057686 | 193 |
| 426 | 3300025961 | Ga0207712_10006914 | Ga0207712_100069141 | 193 |
| 427 | 3300025972 | Ga0207668_10003703 | Ga0207668_100037033 | 193 |
| 428 | 3300025981 | Ga0207640_10013067 | Ga0207640_100130673 | 193 |
| 429 | 3300025981 | Ga0207640_10060810 | Ga0207640_100608103 | 193 |
| 430 | 3300026023 | Ga0207677_10018639 | Ga0207677_100186394 | 193 |
| 431 | 3300026035 | Ga0207703_10087614 | Ga0207703_100876142 | 193 |
| 432 | 3300026041 | Ga0207639_10094322 | Ga0207639_100943221 | 193 |
| 433 | 3300026041 | Ga0207639_10485670 | Ga0207639_104856702 | 193 |
| 434 | 3300026041 | Ga0207639_10849573 | Ga0207639_108495732 | 193 |
| 435 | 3300026067 | Ga0207678_10000256 | Ga0207678_100002569 | 193 |
| 436 | 3300026078 | Ga0207702_10034140 | Ga0207702_100341406 | 193 |
| 437 | 3300026078 | Ga0207702_10196777 | Ga0207702_101967772 | 193 |
| 438 | 3300026078 | Ga0207702_10462628 | Ga0207702_104626282 | 193 |
| 439 | 3300026088 | Ga0207641_10066043 | Ga0207641_100660433 | 193 |
| 440 | 3300026088 | Ga0207641_10196325 | Ga0207641_101963251 | 193 |
| 441 | 3300026089 | Ga0207648_10006028 | Ga0207648_100060288 | 193 |
| 442 | 3300026095 | Ga0207676_10166021 | Ga0207676_101660212 | 193 |
| 443 | 3300026116 | Ga0207674_10049130 | Ga0207674_100491304 | 193 |
| 444 | 3300026116 | Ga0207674_10184025 | Ga0207674_101840252 | 193 |
| 445 | 3300026121 | Ga0207683_10006753 | Ga0207683_100067538 | 193 |
| 446 | 3300026142 | Ga0207698_10010630 | Ga0207698_100106305 | 193 |
| 447 | 3300027671 | Ga0209588_1004706 | Ga0209588_10047063 | 193 |
| 448 | 3300027671 | Ga0209588_1026778 | Ga0209588_10267782 | 193 |
| 449 | 3300027671 | Ga0209588_1027849 | Ga0209588_10278492 | 193 |
| 450 | 3300027671 | Ga0209588_1035042 | Ga0209588_10350421 | 193 |
| 451 | 3300028016 | Ga0265354_1005228 | Ga0265354_10052282 | 193 |
| 452 | 3300028380 | Ga0268265_10084865 | Ga0268265_100848652 | 193 |
| 453 | 3300028381 | Ga0268264_10035584 | Ga0268264_100355842 | 193 |
| 454 | 3300028381 | Ga0268264_10134396 | Ga0268264_101343962 | 193 |
| 455 | 3300028800 | Ga0265338_10061131 | Ga0265338_100611313 | 193 |
| 456 | 3300030878 | Ga0265770_1004292 | Ga0265770_10042922 | 193 |
| 457 | 3300030879 | Ga0265765_1000737 | Ga0265765_10007373 | 193 |
| 458 | 3300031090 | Ga0265760_10002675 | Ga0265760_100026755 | 193 |
| 459 | 3300031090 | Ga0265760_10088499 | Ga0265760_100884992 | 193 |
| 460 | 3300031241 | Ga0265325_10025063 | Ga0265325_100250632 | 193 |
| 461 | 3300031344 | Ga0265316_10039227 | Ga0265316_100392272 | 193 |
| 462 | 3300034957 | Ga0373938_0098457 | Ga0373938_0098457_67_666 | 193 |
| 463 | 3300035084 | Ga0373928_0042965 | Ga0373928_0042965_81_680 | 193 |
| 464 | 3300035112 | Ga0373932_0004078 | Ga0373932_0004078_207_806 | 193 |
| 465 | 3300035114 | Ga0373939_0045488 | Ga0373939_0045488_271_870 | 193 |
| 466 | 3300035115 | Ga0373941_0162558 | Ga0373941_0162558_132_731 | 193 |
| 467 | 3300035118 | Ga0373954_0000112 | Ga0373954_0000112_1129_1737 | 193 |
| 468 | 3300035119 | Ga0373956_0027503 | Ga0373956_0027503_1120_1728 | 193 |
| 469 | 3300035170 | Ga0373943_0015940 | Ga0373943_0015940_1478_2068 | 193 |
| 470 | 3300035170 | Ga0373943_0219662 | Ga0373943_0219662_444_1034 | 193 |
| 471 | 3300035172 | Ga0373955_0009223 | Ga0373955_0009223_3831_4439 | 193 |
| 472 | 3300035691 | Ga0373931_0012563 | Ga0373931_0012563_103_702 | 193 |
| 473 | 3300035692 | Ga0373935_0299357 | Ga0373935_0299357_340_939 | 193 |
| 474 | 3300035695 | Ga0373927_0171092 | Ga0373927_0171092_544_1134 | 193 |
| 475 | 3300035724 | Ga0373933_0003817 | Ga0373933_0003817_6589_7197 | 193 |
| 476 | 3300035724 | Ga0373933_0030512 | Ga0373933_0030512_1155_1745 | 193 |
| 477 | 3300035724 | Ga0373933_0036014 | Ga0373933_0036014_2298_2882 | 193 |
| 478 | 3300035725 | Ga0373947_0051731 | Ga0373947_0051731_609_1199 | 193 |
| 479 | 3300035725 | Ga0373947_0309529 | Ga0373947_0309529_333_932 | 193 |
| 480 | 3300036401 | Ga0373937_0001579 | Ga0373937_0001579_14843_15451 | 193 |
| 481 | 3300036401 | Ga0373937_0031660 | Ga0373937_0031660_433_1032 | 193 |
| 482 | 3300036401 | Ga0373937_0061034 | Ga0373937_0061034_1709_2305 | 193 |
| 483 | 3300036401 | Ga0373937_0200327 | Ga0373937_0200327_298_897 | 193 |
| 484 | 3300037068 | Ga0373925_0004053 | Ga0373925_0004053_2121_2711 | 193 |
| 485 | 3300037068 | Ga0373925_0012233 | Ga0373925_0012233_1470_2060 | 193 |
| 486 | 3300037068 | Ga0373925_0063691 | Ga0373925_0063691_76_675 | 193 |
| 487 | 3300037068 | Ga0373925_0165017 | Ga0373925_0165017_971_1561 | 193 |
| 488 | 3300037068 | Ga0373925_0198267 | Ga0373925_0198267_819_1403 | 193 |
| 489 | 3300037853 | Ga0436364_1416704 | Ga0436364_1416704_954_1544 | 193 |
| 490 | 3300045051 | Ga0451576_0441814 | Ga0451576_0441814_57_653 | 193 |
| 491 | 3300045976 | Ga0466967_0026613 | Ga0466967_0026613_133_723 | 193 |
| 492 | 3300045976 | Ga0466967_0086910 | Ga0466967_0086910_1799_2383 | 193 |
| 493 | 3300045976 | Ga0466967_0261194 | Ga0466967_0261194_774_1364 | 193 |
| 494 | 3300046463 | Ga0495653_0051892 | Ga0495653_0051892_1575_2183 | 193 |
| 495 | 3300046472 | Ga0495580_0004417 | Ga0495580_0004417_5301_5891 | 193 |
| 496 | 3300046473 | Ga0495582_0004858 | Ga0495582_0004858_1152_1742 | 193 |
| 497 | 3300046473 | Ga0495582_0362423 | Ga0495582_0362423_165_764 | 193 |
| 498 | 3300046516 | Ga0495628_0664505 | Ga0495628_0664505_89_688 | 193 |
| 499 | 3300046517 | Ga0495630_0163073 | Ga0495630_0163073_323_913 | 193 |
| 500 | 3300046531 | Ga0495665_0004469 | Ga0495665_0004469_4322_4912 | 193 |
| 501 | 3300046535 | Ga0495586_0396522 | Ga0495586_0396522_134_724 | 193 |
| 502 | 3300046536 | Ga0495587_0005720 | Ga0495587_0005720_6230_6838 | 193 |
| 503 | 3300046536 | Ga0495587_0031004 | Ga0495587_0031004_964_1563 | 193 |
| 504 | 3300046675 | Ga0495657_0231173 | Ga0495657_0231173_252_851 | 193 |
| 505 | 3300046678 | Ga0495599_0308250 | Ga0495599_0308250_261_866 | 193 |
| 506 | 3300046679 | Ga0495623_0351808 | Ga0495623_0351808_170_778 | 193 |
| 507 | 3300047317 | Ga0495604_0001581 | Ga0495604_0001581_15319_15927 | 193 |
| 508 | 3300047319 | Ga0495674_0039876 | Ga0495674_0039876_3368_3973 | 193 |
| 509 | 3300047471 | Ga0495684_0042822 | Ga0495684_0042822_1565_2173 | 193 |
| 510 | 3300047471 | Ga0495684_0363073 | Ga0495684_0363073_146_742 | 193 |
| 511 | 3300048088 | Ga0495602_0008520 | Ga0495602_0008520_3466_4074 | 193 |
| 512 | 3300048088 | Ga0495602_0139247 | Ga0495602_0139247_627_1211 | 193 |
| 513 | 3300048088 | Ga0495602_0279633 | Ga0495602_0279633_583_1173 | 193 |
| 514 | 3300048903 | Ga0496100_0000958 | Ga0496100_0000958_6725_7324 | 193 |
| 515 | 3300048903 | Ga0496100_0205140 | Ga0496100_0205140_746_1354 | 193 |
| 516 | 3300048904 | Ga0496101_0019396 | Ga0496101_0019396_3515_4114 | 193 |
| 517 | 3300048905 | Ga0496102_0001575 | Ga0496102_0001575_7796_8395 | 193 |
| 518 | 3300048905 | Ga0496102_0008044 | Ga0496102_0008044_2279_2875 | 193 |
| 519 | 3300048906 | Ga0496103_0289758 | Ga0496103_0289758_304_903 | 193 |
| 520 | 3300048907 | Ga0496104_0028148 | Ga0496104_0028148_3623_4222 | 193 |
| 521 | 3300048907 | Ga0496104_0137945 | Ga0496104_0137945_497_1096 | 193 |
| 522 | 3300048907 | Ga0496104_0191070 | Ga0496104_0191070_1337_1933 | 193 |
| 523 | 3300048907 | Ga0496104_0285601 | Ga0496104_0285601_601_1191 | 193 |
| 524 | 3300048907 | Ga0496104_0793498 | Ga0496104_0793498_120_719 | 193 |
| 525 | 3300048908 | Ga0496105_0086821 | Ga0496105_0086821_1756_2355 | 193 |
| 526 | 3300048908 | Ga0496105_0124502 | Ga0496105_0124502_1258_1857 | 193 |
| 527 | 3300048908 | Ga0496105_0172691 | Ga0496105_0172691_1077_1676 | 193 |
| 528 | 3300048909 | Ga0496106_0200292 | Ga0496106_0200292_93_692 | 193 |
| 529 | 3300048909 | Ga0496106_0496848 | Ga0496106_0496848_293_892 | 193 |
| 530 | 3300048910 | Ga0496107_0102798 | Ga0496107_0102798_431_1030 | 193 |
| 531 | 3300048912 | Ga0496109_0208589 | Ga0496109_0208589_343_942 | 193 |
| 532 | 3300048912 | Ga0496109_0394154 | Ga0496109_0394154_568_1167 | 193 |
| 533 | 3300048913 | Ga0496110_0401078 | Ga0496110_0401078_177_776 | 193 |
| 534 | 3300048915 | Ga0496112_0065438 | Ga0496112_0065438_1570_2169 | 193 |
| 535 | 3300048915 | Ga0496112_0179675 | Ga0496112_0179675_1245_1844 | 193 |
| 536 | 3300048915 | Ga0496112_0247922 | Ga0496112_0247922_815_1411 | 193 |
| 537 | 3300048916 | Ga0496113_0073999 | Ga0496113_0073999_1394_1993 | 193 |
| 538 | 3300048917 | Ga0496114_0015725 | Ga0496114_0015725_2053_2652 | 193 |
| 539 | 3300048918 | Ga0496115_0003600 | Ga0496115_0003600_6657_7256 | 193 |
| 540 | 3300048918 | Ga0496115_0390324 | Ga0496115_0390324_178_777 | 193 |
| 541 | 3300050507 | nmdc:mga05p37_402554_c1 | nmdc:mga05p37_402554_c1_873_1469 | 193 |
| 542 | 3300050512 | nmdc:mga0n895_102_c1 | nmdc:mga0n895_102_c1_34847_35443 | 193 |
| 543 | 3300050513 | nmdc:mga0rr50_106242_c1 | nmdc:mga0rr50_106242_c1_419_1009 | 193 |
| 544 | 3300050513 | nmdc:mga0rr50_110_c1 | nmdc:mga0rr50_110_c1_2693_3289 | 193 |
| 545 | 3300050513 | nmdc:mga0rr50_95721_c1 | nmdc:mga0rr50_95721_c1_56_646 | 193 |
| 546 | 3300050514 | nmdc:mga08x19_127573_c1 | nmdc:mga08x19_127573_c1_88_672 | 193 |
| 547 | 3300050514 | nmdc:mga08x19_3025_c1 | nmdc:mga08x19_3025_c1_5924_6514 | 193 |
| 548 | 3300050514 | nmdc:mga08x19_313549_c1 | nmdc:mga08x19_313549_c1_358_948 | 193 |
| 549 | 3300050514 | nmdc:mga08x19_36409_c1 | nmdc:mga08x19_36409_c1_462_1052 | 193 |
| 550 | 3300050514 | nmdc:mga08x19_9881_c1 | nmdc:mga08x19_9881_c1_1761_2351 | 193 |
| 551 | 3300050515 | nmdc:mga0a205_131_c1 | nmdc:mga0a205_131_c1_43399_43995 | 193 |
| 552 | 3300053077 | Ga0495601_0012746 | Ga0495601_0012746_3135_3740 | 193 |
| 553 | 3300059490 | Ga0587066_067953 | Ga0587066_067953_28_627 | 193 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gy8-assembly1.cif.gz_A | crystal structure of xaxa from xenorhabdus nematophila | 0.3081 | 56 | 174 |
| 7sh3-assembly1.cif.gz_A | crystal structure of a virb8-like protein of type iv secretion system from rickettsia typhi in complex with a synthetic virb8 miniprotein binder | 0.3036 | 92 | 162 |
| 4h6i-assembly1.cif.gz_A | crystal structure of staphylococcal complement inhibitor scin-b | 0.2997 | 92 | 162 |
| 7sh3-assembly1.cif.gz_A | crystal structure of a virb8-like protein of type iv secretion system from rickettsia typhi in complex with a synthetic virb8 miniprotein binder | 0.2976 | 92 | 162 |
| 7f66-assembly1.cif.gz_D | eif2b-sfsv nss-1-eif2 | 0.2935 | 28 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P57796_115_204_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.3634 | 51 | 139 | 1.10.238.10 |
| af_P57796_115_204_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.3191 | 51 | 139 | 1.10.238.10 |
| 3t49C00 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.3012 | 92 | 162 | 1.20.1270.10 |
| af_E0AHB5_1_108_1.20.120.340 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS | 0.301 | 82 | 172 | 1.20.120.340 |
| 4h6iA00 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.2997 | 92 | 162 | 1.20.1270.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A848VP04-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.9509 | 45 | 187 |
|
| AF-A0A2V9QQB0-F1-model_v4 | Transcriptional initiation protein Tat | 0.9492 | 50 | 193 |
|
| AF-A0A6M1SUL6-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.9448 | 50 | 188 |
|
| AF-A0A2V9QQB0-F1-model_v4 | Transcriptional initiation protein Tat | 0.9427 | 50 | 193 |
|
| AF-A0A2V9KPZ7-F1-model_v4 | Tat pathway signal protein | 0.9354 | 44 | 187 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar