F462830

General Info

Members Datasets Scaffolds Average Seq Length
553 235 553 197

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100269588|Ga0070707_1002695882
Length 224
Sequence MSNLFMPKVENSKLGTTDNSYSTSLPGSSESISRRDVLKSLTMGVLAGSVLRVIPAQAAEYAHHLVQAEKASAGGAYAPKFFSPQQYKTLQALCQAIIPPDNHSGGAIEAAAPEFIDLLTSENSDYQLKLGGGLMWLDSTCNDRYGKNYLDCTPEQQKQILDLIAYRKNAKADPSISQGVEFFSFLRSLTADGFFTSAIGIKDLQYIGNKYMKDFPGCPAVPEA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
163 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
175 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 1.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.41
Rhizosphere 91.5
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10048788 3300003320 Bacteria 5610
2 rootH2_10150870 3300003320 Unclassified 3250
3 Ga0065715_10317810 3300005293 Unclassified 1002
4 Ga0065707_10314487 3300005295 Unclassified 969
5 Ga0070683_100009054 3300005329 Bacteria 8497
6 Ga0070683_100054795 3300005329 Unclassified 3698
7 Ga0070690_100040445 3300005330 Bacteria 2949
8 Ga0070670_100356855 3300005331 Unclassified 1285
9 Ga0070677_10065822 3300005333 Bacteria 1509
10 Ga0068869_100032775 3300005334 Bacteria 3663
11 Ga0070666_10002725 3300005335 Bacteria 10673
12 Ga0070682_100027590 3300005337 Unclassified 3408
13 Ga0070682_100049852 3300005337 Unclassified 2612
14 Ga0068868_100107040 3300005338 Unclassified 2269
15 Ga0068868_100221756 3300005338 Bacteria 1583
16 Ga0070660_100035237 3300005339 Bacteria 3787
17 Ga0070660_100627570 3300005339 Bacteria 899
18 Ga0070661_100005979 3300005344 Bacteria 8378
19 Ga0070692_10062447 3300005345 Unclassified 1966
20 Ga0070668_100006081 3300005347 Bacteria 8952
21 Ga0070669_100022835 3300005353 Bacteria 4475
22 Ga0070671_100053887 3300005355 Unclassified 3343
23 Ga0070674_100046373 3300005356 Bacteria 2973
24 Ga0070674_101025938 3300005356 Unclassified 725
25 Ga0070659_100011058 3300005366 Bacteria 6666
26 Ga0070667_100005223 3300005367 Bacteria 10853
27 Ga0070667_100584506 3300005367 Unclassified 1028
28 Ga0070703_10029972 3300005406 Bacteria 1636
29 Ga0070703_10170370 3300005406 Unclassified 833
30 Ga0070709_10031441 3300005434 Unclassified 3192
31 Ga0070709_10033696 3300005434 Bacteria 3100
32 Ga0070709_10074216 3300005434 Bacteria 2204
33 Ga0070709_10086646 3300005434 Bacteria 2056
34 Ga0070709_10106174 3300005434 Bacteria 1880
35 Ga0070714_100006555 3300005435 Bacteria 9004
36 Ga0070714_100051489 3300005435 Bacteria 3510
37 Ga0070714_100190006 3300005435 Unclassified 1873
38 Ga0070714_100513670 3300005435 Bacteria 1144
39 Ga0070714_100675222 3300005435 Bacteria 996
40 Ga0070714_100817417 3300005435 Unclassified 903
41 Ga0070714_100909272 3300005435 Unclassified 855
42 Ga0070713_100000134 3300005436 Bacteria 48639
43 Ga0070713_100041168 3300005436 Unclassified 3762
44 Ga0070713_100102065 3300005436 Unclassified 2486
45 Ga0070713_100613505 3300005436 Unclassified 1034
46 Ga0070710_10848745 3300005437 Bacteria 656
47 Ga0070711_100001063 3300005439 Bacteria 14659
48 Ga0070711_100189442 3300005439 Unclassified 1580
49 Ga0070711_100222082 3300005439 Bacteria 1469
50 Ga0070711_100300812 3300005439 Bacteria 1276
51 Ga0070705_100002589 3300005440 Bacteria 9064
52 Ga0070705_100250029 3300005440 Bacteria 1244
53 Ga0070694_100122448 3300005444 Bacteria 1868
54 Ga0070708_100000598 3300005445 Bacteria 27157
55 Ga0070708_100004228 3300005445 Bacteria 11275
56 Ga0070708_100013577 3300005445 Bacteria 6675
57 Ga0070708_100015179 3300005445 Bacteria 6351
58 Ga0070708_100015797 3300005445 Bacteria 6242
59 Ga0070708_100030590 3300005445 Bacteria 4654
60 Ga0070663_100003084 3300005455 Bacteria 9526
61 Ga0070663_101021088 3300005455 Unclassified 720
62 Ga0070678_100308182 3300005456 Unclassified 1348
63 Ga0070662_100001005 3300005457 Bacteria 17236
64 Ga0070662_100055474 3300005457 Bacteria 2874
65 Ga0070681_10344432 3300005458 Bacteria 1400
66 Ga0070681_11105105 3300005458 Unclassified 714
67 Ga0068867_100028245 3300005459 Bacteria 4038
68 Ga0070706_100000980 3300005467 Bacteria 31089
69 Ga0070706_100001398 3300005467 Bacteria 25511
70 Ga0070706_100033580 3300005467 Bacteria 4736
71 Ga0070706_100098351 3300005467 Bacteria 2719
72 Ga0070707_100000915 3300005468 Bacteria 29244
73 Ga0070707_100009766 3300005468 Bacteria 8921
74 Ga0070707_100092473 3300005468 Unclassified 2928
75 Ga0070707_100269588 3300005468 Unclassified 1655
76 Ga0070707_100664030 3300005468 Unclassified 1005
77 Ga0070698_100000140 3300005471 Bacteria 65074
78 Ga0070698_100000158 3300005471 Bacteria 61818
79 Ga0070698_100152939 3300005471 Bacteria 2254
80 Ga0070698_100543470 3300005471 Bacteria 1101
81 Ga0070699_100006667 3300005518 Bacteria 10040
82 Ga0070699_100006913 3300005518 Bacteria 9865
83 Ga0070699_100035282 3300005518 Unclassified 4323
84 Ga0070679_100022913 3300005530 Bacteria 6108
85 Ga0070679_100627846 3300005530 Bacteria 1017
86 Ga0070684_100011109 3300005535 Bacteria 7164
87 Ga0070697_100000518 3300005536 Bacteria 29110
88 Ga0070697_100001215 3300005536 Bacteria 19429
89 Ga0070697_100008196 3300005536 Bacteria 8157
90 Ga0070697_100009318 3300005536 Bacteria 7675
91 Ga0070697_100012341 3300005536 Bacteria 6693
92 Ga0070697_100110342 3300005536 Bacteria 2292
93 Ga0070697_100157742 3300005536 Bacteria 1916
94 Ga0070697_100414562 3300005536 Unclassified 1170
95 Ga0070697_100435552 3300005536 Bacteria 1140
96 Ga0068853_100043685 3300005539 Bacteria 3834
97 Ga0068853_100132519 3300005539 Bacteria 2232
98 Ga0070672_100167104 3300005543 Bacteria 1828
99 Ga0070686_100023364 3300005544 Bacteria 3694
100 Ga0070695_100000210 3300005545 Bacteria 28472
101 Ga0070695_100371555 3300005545 Bacteria 1077
102 Ga0070695_100558306 3300005545 Bacteria 893
103 Ga0070696_100002816 3300005546 Bacteria 11551
104 Ga0070696_100231835 3300005546 Bacteria 1389
105 Ga0070696_100303997 3300005546 Bacteria 1223
106 Ga0070693_100000105 3300005547 Bacteria 37510
107 Ga0070693_100891929 3300005547 Unclassified 666
108 Ga0070665_100003940 3300005548 Bacteria 15664
109 Ga0070665_100010236 3300005548 Bacteria 9487
110 Ga0070704_100570955 3300005549 Bacteria 991
111 Ga0068855_100506571 3300005563 Unclassified 1311
112 Ga0068855_100550895 3300005563 Unclassified 1248
113 Ga0068855_100602790 3300005563 Bacteria 1184
114 Ga0068855_100784803 3300005563 Bacteria 1013
115 Ga0070664_100010450 3300005564 Bacteria 7525
116 Ga0068857_100333903 3300005577 Unclassified 1401
117 Ga0068854_100033290 3300005578 Bacteria 3592
118 Ga0068856_100008986 3300005614 Bacteria 9721
119 Ga0068856_100279673 3300005614 Bacteria 1685
120 Ga0068852_100031868 3300005616 Bacteria 4358
121 Ga0068852_100449019 3300005616 Unclassified 1276
122 Ga0068859_100006285 3300005617 Bacteria 12052
123 Ga0068866_10022326 3300005718 Bacteria 2927
124 Ga0068851_10003049 3300005834 Bacteria 7409
125 Ga0068851_10042607 3300005834 Unclassified 2286
126 Ga0068863_100010773 3300005841 Bacteria 8870
127 Ga0068863_100089612 3300005841 Unclassified 2917
128 Ga0068863_100196853 3300005841 Unclassified 1937
129 Ga0068863_100224760 3300005841 Bacteria 1809
130 Ga0068863_100747970 3300005841 Unclassified 973
131 Ga0068858_100025578 3300005842 Bacteria 5492
132 Ga0068858_100316924 3300005842 Bacteria 1490
133 Ga0068860_100008766 3300005843 Bacteria 10076
134 Ga0068860_100039273 3300005843 Bacteria 4527
135 Ga0068860_100319318 3300005843 Bacteria 1524
136 Ga0068862_100036976 3300005844 Bacteria 4137
137 Ga0070717_10001280 3300006028 Bacteria 17207
138 Ga0070717_10004636 3300006028 Bacteria 9964
139 Ga0070717_10009698 3300006028 Bacteria 7246
140 Ga0070717_10381421 3300006028 Bacteria 1264
141 Ga0070715_10001337 3300006163 Bacteria 7105
142 Ga0070715_10017499 3300006163 Bacteria 2714
143 Ga0070716_100002507 3300006173 Bacteria 8497
144 Ga0070716_100002526 3300006173 Bacteria 8474
145 Ga0070716_100006521 3300006173 Bacteria 5705
146 Ga0070716_100006812 3300006173 Bacteria 5600
147 Ga0070716_100011190 3300006173 Bacteria 4516
148 Ga0070716_100025668 3300006173 Bacteria 3147
149 Ga0070716_100128742 3300006173 Unclassified 1597
150 Ga0070716_100198548 3300006173 Unclassified 1331
151 Ga0070716_100227149 3300006173 Unclassified 1258
152 Ga0070716_100229652 3300006173 Bacteria 1252
153 Ga0070712_100001951 3300006175 Bacteria 12648
154 Ga0070712_100036702 3300006175 Unclassified 3336
155 Ga0070712_100055043 3300006175 Unclassified 2784
156 Ga0070712_100056545 3300006175 Bacteria 2752
157 Ga0070712_100220237 3300006175 Bacteria 1502
158 Ga0070712_100296506 3300006175 Bacteria 1307
159 Ga0097621_100005597 3300006237 Bacteria 8858
160 Ga0097621_100007474 3300006237 Bacteria 7818
161 Ga0097621_100022905 3300006237 Bacteria 4854
162 Ga0068871_100049819 3300006358 Bacteria 3387
163 Ga0068871_100105067 3300006358 Bacteria 2369
164 Ga0075433_10000213 3300006852 Bacteria 32853
165 Ga0075433_10182058 3300006852 Bacteria 1870
166 Ga0075433_10612426 3300006852 Bacteria 956
167 Ga0075434_100000122 3300006871 Bacteria 45781
168 Ga0075434_100001669 3300006871 Bacteria 18928
169 Ga0075434_100009940 3300006871 Bacteria 8901
170 Ga0075434_100015193 3300006871 Bacteria 7376
171 Ga0075434_100371612 3300006871 Bacteria 1451
172 Ga0068865_100005168 3300006881 Bacteria 7897
173 Ga0068865_100087130 3300006881 Bacteria 2256
174 Ga0068865_100365961 3300006881 Bacteria 1172
175 Ga0075436_100002250 3300006914 Bacteria 13326
176 Ga0075436_100005656 3300006914 Bacteria 8581
177 Ga0075436_100014222 3300006914 Bacteria 5449
178 Ga0075436_100041204 3300006914 Bacteria 3186
179 Ga0075436_100109039 3300006914 Bacteria 1931
180 Ga0075436_100176807 3300006914 Bacteria 1508
181 Ga0075436_100486112 3300006914 Bacteria 902
182 Ga0097620_100006285 3300006931 Bacteria 12052
183 Ga0075435_100000038 3300007076 Bacteria 67821
184 Ga0075435_100029450 3300007076 Bacteria 4309
185 Ga0075435_100031021 3300007076 Bacteria 4208
186 Ga0075435_100225426 3300007076 Unclassified 1592
187 Ga0075435_100250449 3300007076 Bacteria 1508
188 Ga0075435_100322397 3300007076 Unclassified 1322
189 Ga0099794_10007517 3300007265 Bacteria 4482
190 Ga0099794_10071736 3300007265 Bacteria 1697
191 Ga0099794_10309659 3300007265 Unclassified 818
192 Ga0105240_10016695 3300009093 Bacteria 9929
193 Ga0105240_10022638 3300009093 Bacteria 8325
194 Ga0105240_10026434 3300009093 Bacteria 7615
195 Ga0105240_10062894 3300009093 Bacteria 4619
196 Ga0105240_10083446 3300009093 Bacteria 3921
197 Ga0105240_10116590 3300009093 Bacteria 3221
198 Ga0105240_10185604 3300009093 Bacteria 2450
199 Ga0105240_10303723 3300009093 Unclassified 1825
200 Ga0105245_10039439 3300009098 Bacteria 4203
201 Ga0105245_10064479 3300009098 Unclassified 3311
202 Ga0105247_10003343 3300009101 Bacteria 10499
203 Ga0105247_10052555 3300009101 Bacteria 2512
204 Ga0105247_10953716 3300009101 Bacteria 666
205 Ga0114129_10094507 3300009147 Bacteria 4141
206 Ga0114129_10494583 3300009147 Bacteria 1598
207 Ga0105243_10056060 3300009148 Bacteria 3132
208 Ga0105241_10018950 3300009174 Bacteria 5072
209 Ga0105241_10053903 3300009174 Unclassified 3077
210 Ga0105241_10412773 3300009174 Unclassified 1187
211 Ga0105241_10416357 3300009174 Unclassified 1182
212 Ga0105242_10056234 3300009176 Bacteria 3219
213 Ga0105242_10061499 3300009176 Unclassified 3089
214 Ga0105242_10090589 3300009176 Bacteria 2573
215 Ga0105248_10000003 3300009177 Bacteria 1019601
216 Ga0105248_10155332 3300009177 Bacteria 2582
217 Ga0105237_10076278 3300009545 Unclassified 3343
218 Ga0105237_10186374 3300009545 Bacteria 2075
219 Ga0105237_10662855 3300009545 Bacteria 1050
220 Ga0105237_10870809 3300009545 Unclassified 908
221 Ga0105237_11315919 3300009545 Unclassified 729
222 Ga0105238_10033715 3300009551 Bacteria 5210
223 Ga0105238_10614563 3300009551 Bacteria 1095
224 Ga0105238_11123849 3300009551 Bacteria 809
225 Ga0105249_10026101 3300009553 Bacteria 5262
226 Ga0105249_10161356 3300009553 Bacteria 2167
227 Ga0099796_10002143 3300010159 Bacteria 4252
228 Ga0105239_10472365 3300010375 Bacteria 1424
229 Ga0105239_10730824 3300010375 Bacteria 1133
230 Ga0105239_11722332 3300010375 Bacteria 726
231 Ga0105246_10065671 3300011119 Bacteria 2538
232 Ga0105246_10116297 3300011119 Unclassified 1974
233 Ga0157373_10015048 3300013100 Bacteria 5659
234 Ga0157373_10042013 3300013100 Unclassified 3269
235 Ga0157373_10432142 3300013100 Bacteria 946
236 Ga0157371_10031814 3300013102 Bacteria 3799
237 Ga0157370_10262990 3300013104 Bacteria 1594
238 Ga0157370_10600937 3300013104 Unclassified 1007
239 Ga0157369_10113928 3300013105 Bacteria 2872
240 Ga0157369_10286887 3300013105 Unclassified 1714
241 Ga0157374_10003917 3300013296 Bacteria 12506
242 Ga0157374_10015000 3300013296 Bacteria 6791
243 Ga0157374_10251360 3300013296 Unclassified 1740
244 Ga0157374_10391603 3300013296 Bacteria 1385
245 Ga0157374_10440978 3300013296 Unclassified 1303
246 Ga0157374_10521445 3300013296 Bacteria 1194
247 Ga0157378_10000114 3300013297 Bacteria 77298
248 Ga0157378_10004037 3300013297 Bacteria 12960
249 Ga0157378_10028879 3300013297 Bacteria 4896
250 Ga0157378_10029642 3300013297 Bacteria 4832
251 Ga0157378_10133895 3300013297 Bacteria 2296
252 Ga0157378_10230917 3300013297 Bacteria 1763
253 Ga0163162_10005493 3300013306 Bacteria 12250
254 Ga0163162_10030398 3300013306 Bacteria 5352
255 Ga0163162_10095694 3300013306 Bacteria 3057
256 Ga0163162_10375950 3300013306 Bacteria 1554
257 Ga0157372_10000504 3300013307 Bacteria 42933
258 Ga0157372_10143191 3300013307 Bacteria 2756
259 Ga0157372_10353343 3300013307 Bacteria 1712
260 Ga0157372_10358884 3300013307 Bacteria 1698
261 Ga0157375_10027686 3300013308 Bacteria 5302
262 Ga0157375_10064353 3300013308 Unclassified 3651
263 Ga0157375_11096674 3300013308 Bacteria 932
264 Ga0163163_10137364 3300014325 Bacteria 2486
265 Ga0163163_10163706 3300014325 Bacteria 2270
266 Ga0163163_10257438 3300014325 Unclassified 1796
267 Ga0163163_10922546 3300014325 Bacteria 937
268 Ga0182008_10004291 3300014497 Bacteria 8350
269 Ga0182008_10099269 3300014497 Bacteria 1438
270 Ga0157379_10021319 3300014968 Bacteria 5734
271 Ga0157379_10043840 3300014968 Unclassified 3994
272 Ga0157379_10292769 3300014968 Bacteria 1483
273 Ga0157379_10475549 3300014968 Unclassified 1156
274 Ga0157376_10000023 3300014969 Bacteria 223978
275 Ga0157376_10057382 3300014969 Bacteria 3256
276 Ga0157376_10135309 3300014969 Bacteria 2204
277 Ga0157376_10818833 3300014969 Unclassified 945
278 Ga0182006_1018515 3300015261 Unclassified 2941
279 Ga0182007_10005476 3300015262 Bacteria 5572
280 Ga0182005_1039684 3300015265 Bacteria 1280
281 Ga0213876_10111152 3300021384 Bacteria 1454
282 Ga0224569_102112 3300022732 Bacteria 1644
283 Ga0207653_10034523 3300025885 Bacteria 1643
284 Ga0207653_10140514 3300025885 Unclassified 883
285 Ga0207682_10266035 3300025893 Bacteria 800
286 Ga0207692_10235925 3300025898 Unclassified 1090
287 Ga0207642_10015333 3300025899 Bacteria 2852
288 Ga0207710_10135149 3300025900 Unclassified 1187
289 Ga0207680_10032847 3300025903 Bacteria 2954
290 Ga0207685_10001246 3300025905 Bacteria 5189
291 Ga0207699_10028244 3300025906 Bacteria 3116
292 Ga0207699_10029731 3300025906 Unclassified 3049
293 Ga0207699_10111952 3300025906 Unclassified 1751
294 Ga0207699_10317108 3300025906 Unclassified 1092
295 Ga0207699_10345746 3300025906 Unclassified 1049
296 Ga0207645_10003288 3300025907 Bacteria 12327
297 Ga0207705_10044818 3300025909 Unclassified 3179
298 Ga0207684_10001117 3300025910 Bacteria 29965
299 Ga0207684_10007311 3300025910 Bacteria 9962
300 Ga0207684_10007842 3300025910 Bacteria 9548
301 Ga0207684_10086066 3300025910 Unclassified 2677
302 Ga0207684_10098505 3300025910 Bacteria 2497
303 Ga0207654_10007623 3300025911 Bacteria 5457
304 Ga0207654_10037774 3300025911 Bacteria 2705
305 Ga0207654_10322744 3300025911 Unclassified 1056
306 Ga0207707_10045887 3300025912 Bacteria 3806
307 Ga0207707_10691626 3300025912 Unclassified 857
308 Ga0207695_10043213 3300025913 Bacteria 4804
309 Ga0207695_10044444 3300025913 Bacteria 4725
310 Ga0207695_10110645 3300025913 Bacteria 2727
311 Ga0207671_10010795 3300025914 Bacteria 7495
312 Ga0207671_10075610 3300025914 Bacteria 2519
313 Ga0207671_10181981 3300025914 Unclassified 1636
314 Ga0207693_10000275 3300025915 Bacteria 47590
315 Ga0207693_10011260 3300025915 Bacteria 7240
316 Ga0207693_10042748 3300025915 Bacteria 3567
317 Ga0207693_10047262 3300025915 Bacteria 3381
318 Ga0207693_10174310 3300025915 Bacteria 1693
319 Ga0207693_10240842 3300025915 Bacteria 1420
320 Ga0207693_10360997 3300025915 Bacteria 1137
321 Ga0207663_10002133 3300025916 Bacteria 9437
322 Ga0207663_10145788 3300025916 Unclassified 1655
323 Ga0207663_10243974 3300025916 Bacteria 1319
324 Ga0207663_10767584 3300025916 Bacteria 766
325 Ga0207660_10018437 3300025917 Bacteria 4652
326 Ga0207657_10000254 3300025919 Bacteria 56893
327 Ga0207657_10002735 3300025919 Bacteria 18996
328 Ga0207652_10357849 3300025921 Bacteria 1317
329 Ga0207646_10000471 3300025922 Bacteria 53728
330 Ga0207646_10001706 3300025922 Bacteria 26669
331 Ga0207646_10032934 3300025922 Unclassified 4687
332 Ga0207646_10158189 3300025922 Bacteria 2044
333 Ga0207646_10232725 3300025922 Unclassified 1665
334 Ga0207694_10247742 3300025924 Bacteria 1457
335 Ga0207694_10291873 3300025924 Bacteria 1341
336 Ga0207694_10776849 3300025924 Bacteria 809
337 Ga0207687_10004264 3300025927 Bacteria 9564
338 Ga0207687_10084379 3300025927 Bacteria 2302
339 Ga0207687_10208604 3300025927 Unclassified 1531
340 Ga0207700_10000111 3300025928 Bacteria 48784
341 Ga0207700_10038908 3300025928 Bacteria 3456
342 Ga0207700_10056938 3300025928 Unclassified 2945
343 Ga0207700_10824728 3300025928 Bacteria 830
344 Ga0207664_10025215 3300025929 Bacteria 4476
345 Ga0207664_10320793 3300025929 Bacteria 1367
346 Ga0207664_10498784 3300025929 Bacteria 1090
347 Ga0207664_10692927 3300025929 Unclassified 916
348 Ga0207664_10711309 3300025929 Unclassified 903
349 Ga0207690_10447803 3300025932 Bacteria 1037
350 Ga0207706_10003488 3300025933 Bacteria 15016
351 Ga0207706_10033194 3300025933 Bacteria 4594
352 Ga0207686_10264580 3300025934 Bacteria 1262
353 Ga0207709_10355731 3300025935 Bacteria 1107
354 Ga0207704_10006270 3300025938 Bacteria 5531
355 Ga0207665_10006116 3300025939 Bacteria 7992
356 Ga0207665_10009881 3300025939 Bacteria 6262
357 Ga0207665_10011970 3300025939 Bacteria 5698
358 Ga0207665_10019746 3300025939 Bacteria 4429
359 Ga0207665_10045237 3300025939 Bacteria 2947
360 Ga0207665_10148218 3300025939 Bacteria 1678
361 Ga0207665_10213410 3300025939 Bacteria 1411
362 Ga0207665_11070604 3300025939 Bacteria 642
363 Ga0207691_10299112 3300025940 Bacteria 1383
364 Ga0207711_10000013 3300025941 Bacteria 514850
365 Ga0207711_10000708 3300025941 Bacteria 32770
366 Ga0207689_10024883 3300025942 Bacteria 5019
367 Ga0207661_10083173 3300025944 Bacteria 2648
368 Ga0207679_10036880 3300025945 Bacteria 3471
369 Ga0207679_10215994 3300025945 Bacteria 1611
370 Ga0207667_10005768 3300025949 Bacteria 15107
371 Ga0207651_10380789 3300025960 Bacteria 1196
372 Ga0207712_10006914 3300025961 Bacteria 7158
373 Ga0207668_10003703 3300025972 Bacteria 8999
374 Ga0207640_10013067 3300025981 Bacteria 4748
375 Ga0207640_10060810 3300025981 Bacteria 2499
376 Ga0207658_10528222 3300025986 Unclassified 1054
377 Ga0207677_10018639 3300026023 Bacteria 4170
378 Ga0207703_10087614 3300026035 Bacteria 2611
379 Ga0207703_10171510 3300026035 Bacteria 1908
380 Ga0207639_10094322 3300026041 Unclassified 2402
381 Ga0207639_10485670 3300026041 Bacteria 1126
382 Ga0207639_10849573 3300026041 Unclassified 852
383 Ga0207678_10000256 3300026067 Bacteria 48140
384 Ga0207702_10034140 3300026078 Bacteria 4252
385 Ga0207702_10196777 3300026078 Bacteria 1866
386 Ga0207702_10462628 3300026078 Bacteria 1232
387 Ga0207641_10003212 3300026088 Bacteria 14628
388 Ga0207641_10066043 3300026088 Bacteria 3096
389 Ga0207641_10196325 3300026088 Bacteria 1858
390 Ga0207641_10718457 3300026088 Unclassified 985
391 Ga0207648_10006028 3300026089 Bacteria 12087
392 Ga0207676_10166021 3300026095 Bacteria 1918
393 Ga0207674_10049130 3300026116 Bacteria 4315
394 Ga0207674_10184025 3300026116 Bacteria 2040
395 Ga0207683_10006753 3300026121 Bacteria 9816
396 Ga0207698_10010630 3300026142 Bacteria 5931
397 Ga0209588_1004706 3300027671 Unclassified 3869
398 Ga0209588_1026778 3300027671 Bacteria 1832
399 Ga0209588_1027849 3300027671 Bacteria 1798
400 Ga0209588_1035042 3300027671 Bacteria 1613
401 Ga0265354_1005228 3300028016 Bacteria 1324
402 Ga0265356_1000027 3300028017 Bacteria 22799
403 Ga0268266_10000276 3300028379 Bacteria 84981
404 Ga0268266_10071304 3300028379 Bacteria 3011
405 Ga0268265_10084865 3300028380 Bacteria 2511
406 Ga0268264_10028085 3300028381 Bacteria 4602
407 Ga0268264_10035584 3300028381 Bacteria 4099
408 Ga0268264_10134396 3300028381 Bacteria 2197
409 Ga0268264_10546639 3300028381 Bacteria 1135
410 Ga0265338_10061131 3300028800 Unclassified 3303
411 Ga0265762_1000913 3300030760 Bacteria 5265
412 Ga0265762_1002989 3300030760 Bacteria 3022
413 Ga0265770_1004292 3300030878 Unclassified 1943
414 Ga0265765_1000737 3300030879 Unclassified 2770
415 Ga0265760_10001555 3300031090 Bacteria 6756
416 Ga0265760_10002675 3300031090 Bacteria 5213
417 Ga0265760_10088499 3300031090 Unclassified 967
418 Ga0265325_10025063 3300031241 Unclassified 3240
419 Ga0265316_10039227 3300031344 Bacteria 3805
420 Ga0373938_0098457 3300034957 Unclassified 732
421 Ga0373928_0042965 3300035084 Bacteria 1044
422 Ga0373940_0139147 3300035088 Unclassified 766
423 Ga0373932_0004078 3300035112 Bacteria 3471
424 Ga0373939_0045488 3300035114 Bacteria 1340
425 Ga0373941_0162558 3300035115 Bacteria 827
426 Ga0373954_0000112 3300035118 Bacteria 27502
427 Ga0373956_0027503 3300035119 Unclassified 2469
428 Ga0373943_0015940 3300035170 Unclassified 3421
429 Ga0373943_0219662 3300035170 Bacteria 1058
430 Ga0373943_0523520 3300035170 Archaea 694
431 Ga0373955_0009223 3300035172 Bacteria 4617
432 Ga0373931_0012563 3300035691 Bacteria 4105
433 Ga0373931_0092729 3300035691 Unclassified 1685
434 Ga0373931_0135623 3300035691 Bacteria 1421
435 Ga0373935_0299357 3300035692 Unclassified 1136
436 Ga0373927_0145595 3300035695 Bacteria 1551
437 Ga0373927_0171092 3300035695 Unclassified 1424
438 Ga0373933_0003817 3300035724 Bacteria 8331
439 Ga0373933_0030512 3300035724 Bacteria 3122
440 Ga0373933_0036014 3300035724 Bacteria 2894
441 Ga0373947_0051731 3300035725 Unclassified 2472
442 Ga0373947_0309529 3300035725 Unclassified 1055
443 Ga0373937_0001579 3300036401 Bacteria 19154
444 Ga0373937_0031660 3300036401 Unclassified 4794
445 Ga0373937_0061034 3300036401 Bacteria 3466
446 Ga0373937_0200327 3300036401 Bacteria 1877
447 Ga0373937_0505133 3300036401 Bacteria 1149
448 Ga0373925_0004053 3300037068 Bacteria 11132
449 Ga0373925_0012233 3300037068 Bacteria 6210
450 Ga0373925_0063691 3300037068 Bacteria 2775
451 Ga0373925_0165017 3300037068 Bacteria 1746
452 Ga0373925_0198267 3300037068 Archaea 1596
453 Ga0436364_1416704 3300037853 Bacteria 2085
454 Ga0436365_1656802 3300039437 Bacteria 9654
455 Ga0436361_0586051 3300039447 Bacteria 725
456 Ga0466961_0236673 3300044693 Bacteria 1123
457 Ga0451576_0441814 3300045051 Bacteria 1365
458 Ga0466967_0026613 3300045976 Bacteria 4793
459 Ga0466967_0086910 3300045976 Bacteria 2834
460 Ga0466967_0261194 3300045976 Bacteria 1657
461 Ga0495603_0118668 3300046455 Bacteria 1542
462 Ga0495641_0028581 3300046461 Bacteria 2697
463 Ga0495653_0051892 3300046463 Unclassified 3146
464 Ga0495580_0004417 3300046472 Bacteria 11814
465 Ga0495580_0085113 3300046472 Bacteria 2202
466 Ga0495582_0000277 3300046473 Bacteria 28667
467 Ga0495582_0004858 3300046473 Bacteria 7538
468 Ga0495582_0362423 3300046473 Unclassified 835
469 Ga0495628_0664505 3300046516 Bacteria 739
470 Ga0495630_0163073 3300046517 Unclassified 1697
471 Ga0495665_0004469 3300046531 Bacteria 7546
472 Ga0495586_0396522 3300046535 Unclassified 794
473 Ga0495587_0005720 3300046536 Bacteria 8102
474 Ga0495587_0031004 3300046536 Bacteria 3240
475 Ga0495657_0231173 3300046675 Unclassified 1118
476 Ga0495599_0308250 3300046678 Unclassified 955
477 Ga0495623_0351808 3300046679 Unclassified 802
478 Ga0495604_0001581 3300047317 Bacteria 18770
479 Ga0495674_0039876 3300047319 Bacteria 4205
480 Ga0495684_0042822 3300047471 Unclassified 3467
481 Ga0495684_0363073 3300047471 Bacteria 1025
482 Ga0495602_0008520 3300048088 Bacteria 10705
483 Ga0495602_0139247 3300048088 Bacteria 1923
484 Ga0495602_0279633 3300048088 Unclassified 1230
485 Ga0496100_0000958 3300048903 Bacteria 13809
486 Ga0496100_0205140 3300048903 Unclassified 1439
487 Ga0496101_0019396 3300048904 Bacteria 4642
488 Ga0496102_0001575 3300048905 Bacteria 20118
489 Ga0496102_0008044 3300048905 Bacteria 9018
490 Ga0496102_0911696 3300048905 Bacteria 800
491 Ga0496103_0013534 3300048906 Bacteria 4838
492 Ga0496103_0289758 3300048906 Bacteria 1053
493 Ga0496104_0028148 3300048907 Bacteria 5208
494 Ga0496104_0137945 3300048907 Bacteria 2343
495 Ga0496104_0191070 3300048907 Bacteria 1959
496 Ga0496104_0285601 3300048907 Unclassified 1563
497 Ga0496104_0390545 3300048907 Bacteria 1304
498 Ga0496104_0793498 3300048907 Bacteria 853
499 Ga0496105_0086821 3300048908 Bacteria 2585
500 Ga0496105_0124502 3300048908 Bacteria 2125
501 Ga0496105_0172691 3300048908 Bacteria 1771
502 Ga0496105_0253670 3300048908 Unclassified 1425
503 Ga0496105_0460297 3300048908 Bacteria 1003
504 Ga0496106_0200292 3300048909 Bacteria 1589
505 Ga0496106_0496848 3300048909 Bacteria 980
506 Ga0496106_0599842 3300048909 Unclassified 882
507 Ga0496107_0102798 3300048910 Bacteria 2096
508 Ga0496107_0116934 3300048910 Unclassified 1963
509 Ga0496107_0218741 3300048910 Bacteria 1417
510 Ga0496109_0208589 3300048912 Unclassified 1837
511 Ga0496109_0394154 3300048912 Bacteria 1308
512 Ga0496109_0453263 3300048912 Unclassified 1211
513 Ga0496110_0029670 3300048913 Bacteria 4710
514 Ga0496110_0401078 3300048913 Bacteria 1250
515 Ga0496110_0975342 3300048913 Unclassified 755
516 Ga0496112_0065438 3300048915 Bacteria 3587
517 Ga0496112_0179675 3300048915 Unclassified 2080
518 Ga0496112_0247922 3300048915 Bacteria 1733
519 Ga0496113_0016718 3300048916 Bacteria 5073
520 Ga0496113_0073999 3300048916 Bacteria 2597
521 Ga0496114_0015725 3300048917 Bacteria 6089
522 Ga0496114_0036562 3300048917 Bacteria 4059
523 Ga0496115_0003600 3300048918 Bacteria 11135
524 Ga0496115_0006608 3300048918 Bacteria 8500
525 Ga0496115_0390324 3300048918 Unclassified 1130
526 Ga0496126_0043586 3300048929 Bacteria 4138
527 nmdc:mga05p37_402554_c1 3300050507 Bacteria 1598
528 nmdc:mga0n895_102_c1 3300050512 Bacteria 50003
529 nmdc:mga0n895_11535_c1 3300050512 Bacteria 7891
530 nmdc:mga0n895_30546_c1 3300050512 Bacteria 5151
531 nmdc:mga0n895_44202_c1 3300050512 Bacteria 4344
532 nmdc:mga0n895_841193_c1 3300050512 Bacteria 906
533 nmdc:mga0rr50_106242_c1 3300050513 Unclassified 2215
534 nmdc:mga0rr50_110_c1 3300050513 Bacteria 20297
535 nmdc:mga0rr50_163115_c1 3300050513 Unclassified 1810
536 nmdc:mga0rr50_188806_c1 3300050513 Bacteria 1688
537 nmdc:mga0rr50_20743_c1 3300050513 Bacteria 4469
538 nmdc:mga0rr50_352389_c1 3300050513 Bacteria 1238
539 nmdc:mga0rr50_95721_c1 3300050513 Bacteria 2321
540 nmdc:mga0rr50_982319_c1 3300050513 Unclassified 719
541 nmdc:mga08x19_127573_c1 3300050514 Bacteria 1709
542 nmdc:mga08x19_3025_c1 3300050514 Bacteria 10111
543 nmdc:mga08x19_313549_c1 3300050514 Bacteria 1091
544 nmdc:mga08x19_36409_c1 3300050514 Bacteria 3117
545 nmdc:mga08x19_411276_c1 3300050514 Bacteria 950
546 nmdc:mga08x19_449922_c1 3300050514 Bacteria 906
547 nmdc:mga08x19_64868_c1 3300050514 Unclassified 2371
548 nmdc:mga08x19_9881_c1 3300050514 Bacteria 5721
549 nmdc:mga0a205_131_c1 3300050515 Bacteria 46472
550 nmdc:mga0a205_158782_c1 3300050515 Unclassified 2159
551 nmdc:mga0a205_550428_c1 3300050515 Unclassified 1009
552 Ga0495601_0012746 3300053077 Bacteria 5046
553 Ga0587066_067953 3300059490 Unclassified 743

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100152939 Ga0070698_1001529392 177
2 3300006175 Ga0070712_100056545 Ga0070712_1000565453 177
3 3300025915 Ga0207693_10042748 Ga0207693_100427483 177
4 3300005434 Ga0070709_10106174 Ga0070709_101061742 178
5 3300005436 Ga0070713_100041168 Ga0070713_1000411683 178
6 3300005437 Ga0070710_10848745 Ga0070710_108487451 178
7 3300006914 Ga0075436_100005656 Ga0075436_1000056569 178
8 3300006163 Ga0070715_10017499 Ga0070715_100174994 179
9 3300048908 Ga0496105_0460297 Ga0496105_0460297_216_764 179
10 3300050512 nmdc:mga0n895_841193_c1 nmdc:mga0n895_841193_c1_38_586 179
11 3300005293 Ga0065715_10317810 Ga0065715_103178101 180
12 3300005329 Ga0070683_100054795 Ga0070683_1000547953 180
13 3300005331 Ga0070670_100356855 Ga0070670_1003568552 180
14 3300005337 Ga0070682_100049852 Ga0070682_1000498522 180
15 3300005355 Ga0070671_100053887 Ga0070671_1000538873 180
16 3300005367 Ga0070667_100584506 Ga0070667_1005845062 180
17 3300005457 Ga0070662_100055474 Ga0070662_1000554742 180
18 3300005458 Ga0070681_10344432 Ga0070681_103444322 180
19 3300005549 Ga0070704_100570955 Ga0070704_1005709551 180
20 3300007265 Ga0099794_10007517 Ga0099794_100075173 180
21 3300009093 Ga0105240_10185604 Ga0105240_101856044 180
22 3300009093 Ga0105240_10303723 Ga0105240_103037232 180
23 3300009098 Ga0105245_10039439 Ga0105245_100394392 180
24 3300009101 Ga0105247_10052555 Ga0105247_100525552 180
25 3300009174 Ga0105241_10053903 Ga0105241_100539032 180
26 3300009545 Ga0105237_10870809 Ga0105237_108708092 180
27 3300009551 Ga0105238_10033715 Ga0105238_100337152 180
28 3300013105 Ga0157369_10113928 Ga0157369_101139283 180
29 3300013296 Ga0157374_10521445 Ga0157374_105214452 180
30 3300013297 Ga0157378_10133895 Ga0157378_101338953 180
31 3300013306 Ga0163162_10375950 Ga0163162_103759502 180
32 3300013307 Ga0157372_10358884 Ga0157372_103588842 180
33 3300014325 Ga0163163_10257438 Ga0163163_102574382 180
34 3300014497 Ga0182008_10099269 Ga0182008_100992692 180
35 3300014968 Ga0157379_10043840 Ga0157379_100438405 180
36 3300015261 Ga0182006_1018515 Ga0182006_10185153 180
37 3300015262 Ga0182007_10005476 Ga0182007_100054765 180
38 3300015265 Ga0182005_1039684 Ga0182005_10396842 180
39 3300025960 Ga0207651_10380789 Ga0207651_103807892 180
40 3300025986 Ga0207658_10528222 Ga0207658_105282222 180
41 3300035170 Ga0373943_0523520 Ga0373943_0523520_139_684 180
42 3300035691 Ga0373931_0092729 Ga0373931_0092729_11_562 180
43 3300039447 Ga0436361_0586051 Ga0436361_0586051_159_710 180
44 3300048905 Ga0496102_0911696 Ga0496102_0911696_153_704 180
45 3300048906 Ga0496103_0013534 Ga0496103_0013534_3927_4478 180
46 3300048907 Ga0496104_0390545 Ga0496104_0390545_630_1190 180
47 3300048908 Ga0496105_0253670 Ga0496105_0253670_327_878 180
48 3300048909 Ga0496106_0599842 Ga0496106_0599842_179_730 180
49 3300048910 Ga0496107_0116934 Ga0496107_0116934_42_593 180
50 3300048910 Ga0496107_0218741 Ga0496107_0218741_37_588 180
51 3300048912 Ga0496109_0453263 Ga0496109_0453263_624_1175 180
52 3300048913 Ga0496110_0029670 Ga0496110_0029670_3979_4530 180
53 3300048916 Ga0496113_0016718 Ga0496113_0016718_3578_4129 180
54 3300048929 Ga0496126_0043586 Ga0496126_0043586_1529_2080 180
55 3300005468 Ga0070707_100092473 Ga0070707_1000924732 185
56 3300005471 Ga0070698_100543470 Ga0070698_1005434702 185
57 3300025922 Ga0207646_10032934 Ga0207646_100329342 185
58 3300028379 Ga0268266_10071304 Ga0268266_100713043 185
59 3300005445 Ga0070708_100015179 Ga0070708_1000151796 186
60 3300025927 Ga0207687_10208604 Ga0207687_102086042 186
61 3300025916 Ga0207663_10767584 Ga0207663_107675841 187
62 3300022732 Ga0224569_102112 Ga0224569_1021121 190
63 3300028017 Ga0265356_1000027 Ga0265356_100002717 190
64 3300030760 Ga0265762_1000913 Ga0265762_10009134 190
65 3300030760 Ga0265762_1002989 Ga0265762_10029892 190
66 3300031090 Ga0265760_10001555 Ga0265760_100015552 190
67 3300005295 Ga0065707_10314487 Ga0065707_103144871 191
68 3300005356 Ga0070674_101025938 Ga0070674_1010259381 191
69 3300005434 Ga0070709_10086646 Ga0070709_100866462 191
70 3300005536 Ga0070697_100414562 Ga0070697_1004145622 191
71 3300006173 Ga0070716_100227149 Ga0070716_1002271492 191
72 3300006871 Ga0075434_100015193 Ga0075434_1000151935 191
73 3300009147 Ga0114129_10094507 Ga0114129_100945074 191
74 3300009176 Ga0105242_10061499 Ga0105242_100614994 191
75 3300009545 Ga0105237_10186374 Ga0105237_101863742 191
76 3300013297 Ga0157378_10004037 Ga0157378_100040373 191
77 3300013307 Ga0157372_10353343 Ga0157372_103533432 191
78 3300013308 Ga0157375_10064353 Ga0157375_100643532 191
79 3300025914 Ga0207671_10181981 Ga0207671_101819812 191
80 3300036401 Ga0373937_0505133 Ga0373937_0505133_487_1071 191
81 3300050512 nmdc:mga0n895_30546_c1 nmdc:mga0n895_30546_c1_2216_2809 191
82 3300050513 nmdc:mga0rr50_982319_c1 nmdc:mga0rr50_982319_c1_66_659 191
83 3300050515 nmdc:mga0a205_158782_c1 nmdc:mga0a205_158782_c1_366_959 191
84 3300005436 Ga0070713_100613505 Ga0070713_1006135051 192
85 3300005439 Ga0070711_100222082 Ga0070711_1002220822 192
86 3300005445 Ga0070708_100030590 Ga0070708_1000305904 192
87 3300005468 Ga0070707_100009766 Ga0070707_1000097663 192
88 3300005468 Ga0070707_100664030 Ga0070707_1006640302 192
89 3300005518 Ga0070699_100035282 Ga0070699_1000352823 192
90 3300005536 Ga0070697_100008196 Ga0070697_1000081965 192
91 3300005536 Ga0070697_100435552 Ga0070697_1004355522 192
92 3300005548 Ga0070665_100003940 Ga0070665_1000039402 192
93 3300005841 Ga0068863_100010773 Ga0068863_1000107733 192
94 3300005841 Ga0068863_100747970 Ga0068863_1007479702 192
95 3300005842 Ga0068858_100316924 Ga0068858_1003169242 192
96 3300005843 Ga0068860_100039273 Ga0068860_1000392732 192
97 3300005843 Ga0068860_100319318 Ga0068860_1003193181 192
98 3300006173 Ga0070716_100002507 Ga0070716_1000025072 192
99 3300006173 Ga0070716_100128742 Ga0070716_1001287422 192
100 3300006173 Ga0070716_100229652 Ga0070716_1002296522 192
101 3300006175 Ga0070712_100055043 Ga0070712_1000550432 192
102 3300006237 Ga0097621_100005597 Ga0097621_1000055976 192
103 3300006358 Ga0068871_100049819 Ga0068871_1000498192 192
104 3300006852 Ga0075433_10182058 Ga0075433_101820582 192
105 3300006852 Ga0075433_10612426 Ga0075433_106124262 192
106 3300006871 Ga0075434_100001669 Ga0075434_1000016694 192
107 3300006871 Ga0075434_100009940 Ga0075434_1000099404 192
108 3300006871 Ga0075434_100371612 Ga0075434_1003716122 192
109 3300006881 Ga0068865_100365961 Ga0068865_1003659612 192
110 3300006914 Ga0075436_100109039 Ga0075436_1001090392 192
111 3300006914 Ga0075436_100486112 Ga0075436_1004861121 192
112 3300007076 Ga0075435_100029450 Ga0075435_1000294504 192
113 3300007076 Ga0075435_100031021 Ga0075435_1000310212 192
114 3300007076 Ga0075435_100225426 Ga0075435_1002254262 192
115 3300007076 Ga0075435_100250449 Ga0075435_1002504492 192
116 3300007265 Ga0099794_10309659 Ga0099794_103096592 192
117 3300009093 Ga0105240_10026434 Ga0105240_100264348 192
118 3300009545 Ga0105237_10662855 Ga0105237_106628552 192
119 3300009545 Ga0105237_11315919 Ga0105237_113159192 192
120 3300010159 Ga0099796_10002143 Ga0099796_100021432 192
121 3300013296 Ga0157374_10391603 Ga0157374_103916032 192
122 3300013297 Ga0157378_10029642 Ga0157378_100296422 192
123 3300013308 Ga0157375_10027686 Ga0157375_100276862 192
124 3300014968 Ga0157379_10021319 Ga0157379_100213193 192
125 3300014969 Ga0157376_10000023 Ga0157376_10000023103 192
126 3300021384 Ga0213876_10111152 Ga0213876_101111522 192
127 3300025910 Ga0207684_10098505 Ga0207684_100985052 192
128 3300025915 Ga0207693_10174310 Ga0207693_101743102 192
129 3300025915 Ga0207693_10240842 Ga0207693_102408422 192
130 3300025916 Ga0207663_10243974 Ga0207663_102439742 192
131 3300025922 Ga0207646_10001706 Ga0207646_100017062 192
132 3300025922 Ga0207646_10158189 Ga0207646_101581892 192
133 3300025939 Ga0207665_10148218 Ga0207665_101482181 192
134 3300025939 Ga0207665_10213410 Ga0207665_102134102 192
135 3300026035 Ga0207703_10171510 Ga0207703_101715102 192
136 3300026088 Ga0207641_10003212 Ga0207641_100032127 192
137 3300026088 Ga0207641_10718457 Ga0207641_107184572 192
138 3300028379 Ga0268266_10000276 Ga0268266_1000027660 192
139 3300028381 Ga0268264_10028085 Ga0268264_100280854 192
140 3300028381 Ga0268264_10546639 Ga0268264_105466391 192
141 3300035088 Ga0373940_0139147 Ga0373940_0139147_67_663 192
142 3300035691 Ga0373931_0135623 Ga0373931_0135623_317_913 192
143 3300035695 Ga0373927_0145595 Ga0373927_0145595_465_1061 192
144 3300039437 Ga0436365_1656802 Ga0436365_1656802_5383_5985 192
145 3300044693 Ga0466961_0236673 Ga0466961_0236673_68_658 192
146 3300046455 Ga0495603_0118668 Ga0495603_0118668_413_1009 192
147 3300046461 Ga0495641_0028581 Ga0495641_0028581_45_641 192
148 3300046472 Ga0495580_0085113 Ga0495580_0085113_1500_2096 192
149 3300046473 Ga0495582_0000277 Ga0495582_0000277_11806_12402 192
150 3300048913 Ga0496110_0975342 Ga0496110_0975342_13_609 192
151 3300048917 Ga0496114_0036562 Ga0496114_0036562_3293_3889 192
152 3300048918 Ga0496115_0006608 Ga0496115_0006608_162_758 192
153 3300050512 nmdc:mga0n895_11535_c1 nmdc:mga0n895_11535_c1_6186_6782 192
154 3300050512 nmdc:mga0n895_44202_c1 nmdc:mga0n895_44202_c1_1823_2419 192
155 3300050513 nmdc:mga0rr50_163115_c1 nmdc:mga0rr50_163115_c1_613_1209 192
156 3300050513 nmdc:mga0rr50_188806_c1 nmdc:mga0rr50_188806_c1_885_1481 192
157 3300050513 nmdc:mga0rr50_20743_c1 nmdc:mga0rr50_20743_c1_3038_3634 192
158 3300050513 nmdc:mga0rr50_352389_c1 nmdc:mga0rr50_352389_c1_241_837 192
159 3300050514 nmdc:mga08x19_411276_c1 nmdc:mga08x19_411276_c1_255_851 192
160 3300050514 nmdc:mga08x19_449922_c1 nmdc:mga08x19_449922_c1_269_865 192
161 3300050514 nmdc:mga08x19_64868_c1 nmdc:mga08x19_64868_c1_791_1387 192
162 3300050515 nmdc:mga0a205_550428_c1 nmdc:mga0a205_550428_c1_400_996 192
163 3300003320 rootH2_10048788 rootH2_100487884 193
164 3300003320 rootH2_10150870 rootH2_101508704 193
165 3300005329 Ga0070683_100009054 Ga0070683_1000090546 193
166 3300005330 Ga0070690_100040445 Ga0070690_1000404452 193
167 3300005333 Ga0070677_10065822 Ga0070677_100658222 193
168 3300005334 Ga0068869_100032775 Ga0068869_1000327752 193
169 3300005335 Ga0070666_10002725 Ga0070666_100027256 193
170 3300005337 Ga0070682_100027590 Ga0070682_1000275905 193
171 3300005338 Ga0068868_100107040 Ga0068868_1001070402 193
172 3300005338 Ga0068868_100221756 Ga0068868_1002217562 193
173 3300005339 Ga0070660_100035237 Ga0070660_1000352372 193
174 3300005339 Ga0070660_100627570 Ga0070660_1006275701 193
175 3300005344 Ga0070661_100005979 Ga0070661_1000059796 193
176 3300005345 Ga0070692_10062447 Ga0070692_100624472 193
177 3300005347 Ga0070668_100006081 Ga0070668_1000060816 193
178 3300005353 Ga0070669_100022835 Ga0070669_1000228352 193
179 3300005356 Ga0070674_100046373 Ga0070674_1000463732 193
180 3300005366 Ga0070659_100011058 Ga0070659_1000110583 193
181 3300005367 Ga0070667_100005223 Ga0070667_1000052237 193
182 3300005406 Ga0070703_10029972 Ga0070703_100299722 193
183 3300005406 Ga0070703_10170370 Ga0070703_101703702 193
184 3300005434 Ga0070709_10031441 Ga0070709_100314413 193
185 3300005434 Ga0070709_10033696 Ga0070709_100336963 193
186 3300005434 Ga0070709_10074216 Ga0070709_100742162 193
187 3300005435 Ga0070714_100006555 Ga0070714_1000065558 193
188 3300005435 Ga0070714_100051489 Ga0070714_1000514894 193
189 3300005435 Ga0070714_100190006 Ga0070714_1001900062 193
190 3300005435 Ga0070714_100513670 Ga0070714_1005136702 193
191 3300005435 Ga0070714_100675222 Ga0070714_1006752222 193
192 3300005435 Ga0070714_100817417 Ga0070714_1008174171 193
193 3300005435 Ga0070714_100909272 Ga0070714_1009092722 193
194 3300005436 Ga0070713_100000134 Ga0070713_10000013445 193
195 3300005436 Ga0070713_100102065 Ga0070713_1001020651 193
196 3300005439 Ga0070711_100001063 Ga0070711_1000010636 193
197 3300005439 Ga0070711_100189442 Ga0070711_1001894422 193
198 3300005439 Ga0070711_100300812 Ga0070711_1003008122 193
199 3300005440 Ga0070705_100002589 Ga0070705_1000025892 193
200 3300005440 Ga0070705_100250029 Ga0070705_1002500292 193
201 3300005444 Ga0070694_100122448 Ga0070694_1001224481 193
202 3300005445 Ga0070708_100000598 Ga0070708_10000059814 193
203 3300005445 Ga0070708_100004228 Ga0070708_1000042285 193
204 3300005445 Ga0070708_100013577 Ga0070708_1000135776 193
205 3300005445 Ga0070708_100015797 Ga0070708_1000157973 193
206 3300005455 Ga0070663_100003084 Ga0070663_1000030846 193
207 3300005455 Ga0070663_101021088 Ga0070663_1010210881 193
208 3300005456 Ga0070678_100308182 Ga0070678_1003081822 193
209 3300005457 Ga0070662_100001005 Ga0070662_10000100511 193
210 3300005458 Ga0070681_11105105 Ga0070681_111051051 193
211 3300005459 Ga0068867_100028245 Ga0068867_1000282452 193
212 3300005467 Ga0070706_100000980 Ga0070706_10000098026 193
213 3300005467 Ga0070706_100001398 Ga0070706_10000139824 193
214 3300005467 Ga0070706_100033580 Ga0070706_1000335802 193
215 3300005467 Ga0070706_100098351 Ga0070706_1000983512 193
216 3300005468 Ga0070707_100000915 Ga0070707_1000009152 193
217 3300005468 Ga0070707_100269588 Ga0070707_1002695882 193
218 3300005471 Ga0070698_100000140 Ga0070698_10000014044 193
219 3300005471 Ga0070698_100000158 Ga0070698_10000015820 193
220 3300005518 Ga0070699_100006667 Ga0070699_1000066677 193
221 3300005518 Ga0070699_100006913 Ga0070699_1000069135 193
222 3300005530 Ga0070679_100022913 Ga0070679_1000229132 193
223 3300005530 Ga0070679_100627846 Ga0070679_1006278461 193
224 3300005535 Ga0070684_100011109 Ga0070684_1000111094 193
225 3300005536 Ga0070697_100000518 Ga0070697_1000005185 193
226 3300005536 Ga0070697_100001215 Ga0070697_1000012156 193
227 3300005536 Ga0070697_100009318 Ga0070697_1000093182 193
228 3300005536 Ga0070697_100012341 Ga0070697_1000123416 193
229 3300005536 Ga0070697_100110342 Ga0070697_1001103423 193
230 3300005536 Ga0070697_100157742 Ga0070697_1001577422 193
231 3300005539 Ga0068853_100043685 Ga0068853_1000436852 193
232 3300005539 Ga0068853_100132519 Ga0068853_1001325192 193
233 3300005543 Ga0070672_100167104 Ga0070672_1001671042 193
234 3300005544 Ga0070686_100023364 Ga0070686_1000233642 193
235 3300005545 Ga0070695_100000210 Ga0070695_1000002107 193
236 3300005545 Ga0070695_100371555 Ga0070695_1003715551 193
237 3300005545 Ga0070695_100558306 Ga0070695_1005583061 193
238 3300005546 Ga0070696_100002816 Ga0070696_1000028163 193
239 3300005546 Ga0070696_100231835 Ga0070696_1002318352 193
240 3300005546 Ga0070696_100303997 Ga0070696_1003039971 193
241 3300005547 Ga0070693_100000105 Ga0070693_10000010516 193
242 3300005547 Ga0070693_100891929 Ga0070693_1008919291 193
243 3300005548 Ga0070665_100010236 Ga0070665_1000102366 193
244 3300005563 Ga0068855_100506571 Ga0068855_1005065712 193
245 3300005563 Ga0068855_100550895 Ga0068855_1005508951 193
246 3300005563 Ga0068855_100602790 Ga0068855_1006027902 193
247 3300005563 Ga0068855_100784803 Ga0068855_1007848032 193
248 3300005564 Ga0070664_100010450 Ga0070664_1000104506 193
249 3300005577 Ga0068857_100333903 Ga0068857_1003339031 193
250 3300005578 Ga0068854_100033290 Ga0068854_1000332902 193
251 3300005614 Ga0068856_100008986 Ga0068856_1000089864 193
252 3300005614 Ga0068856_100279673 Ga0068856_1002796732 193
253 3300005616 Ga0068852_100031868 Ga0068852_1000318682 193
254 3300005616 Ga0068852_100449019 Ga0068852_1004490192 193
255 3300005617 Ga0068859_100006285 Ga0068859_1000062853 193
256 3300005718 Ga0068866_10022326 Ga0068866_100223262 193
257 3300005834 Ga0068851_10003049 Ga0068851_100030496 193
258 3300005834 Ga0068851_10042607 Ga0068851_100426072 193
259 3300005841 Ga0068863_100089612 Ga0068863_1000896122 193
260 3300005841 Ga0068863_100196853 Ga0068863_1001968532 193
261 3300005841 Ga0068863_100224760 Ga0068863_1002247602 193
262 3300005842 Ga0068858_100025578 Ga0068858_1000255784 193
263 3300005843 Ga0068860_100008766 Ga0068860_1000087665 193
264 3300005844 Ga0068862_100036976 Ga0068862_1000369761 193
265 3300006028 Ga0070717_10001280 Ga0070717_100012807 193
266 3300006028 Ga0070717_10004636 Ga0070717_100046363 193
267 3300006028 Ga0070717_10009698 Ga0070717_100096987 193
268 3300006028 Ga0070717_10381421 Ga0070717_103814212 193
269 3300006163 Ga0070715_10001337 Ga0070715_100013373 193
270 3300006173 Ga0070716_100002526 Ga0070716_1000025268 193
271 3300006173 Ga0070716_100006521 Ga0070716_1000065212 193
272 3300006173 Ga0070716_100006812 Ga0070716_1000068123 193
273 3300006173 Ga0070716_100011190 Ga0070716_1000111905 193
274 3300006173 Ga0070716_100025668 Ga0070716_1000256683 193
275 3300006173 Ga0070716_100198548 Ga0070716_1001985482 193
276 3300006175 Ga0070712_100001951 Ga0070712_1000019516 193
277 3300006175 Ga0070712_100036702 Ga0070712_1000367022 193
278 3300006175 Ga0070712_100220237 Ga0070712_1002202372 193
279 3300006175 Ga0070712_100296506 Ga0070712_1002965062 193
280 3300006237 Ga0097621_100007474 Ga0097621_1000074746 193
281 3300006237 Ga0097621_100022905 Ga0097621_1000229052 193
282 3300006358 Ga0068871_100105067 Ga0068871_1001050672 193
283 3300006852 Ga0075433_10000213 Ga0075433_1000021327 193
284 3300006871 Ga0075434_100000122 Ga0075434_10000012219 193
285 3300006881 Ga0068865_100005168 Ga0068865_1000051685 193
286 3300006881 Ga0068865_100087130 Ga0068865_1000871302 193
287 3300006914 Ga0075436_100002250 Ga0075436_1000022505 193
288 3300006914 Ga0075436_100014222 Ga0075436_1000142223 193
289 3300006914 Ga0075436_100041204 Ga0075436_1000412045 193
290 3300006914 Ga0075436_100176807 Ga0075436_1001768072 193
291 3300006931 Ga0097620_100006285 Ga0097620_1000062858 193
292 3300007076 Ga0075435_100000038 Ga0075435_10000003818 193
293 3300007076 Ga0075435_100322397 Ga0075435_1003223972 193
294 3300007265 Ga0099794_10071736 Ga0099794_100717362 193
295 3300009093 Ga0105240_10016695 Ga0105240_100166956 193
296 3300009093 Ga0105240_10022638 Ga0105240_100226385 193
297 3300009093 Ga0105240_10062894 Ga0105240_100628943 193
298 3300009093 Ga0105240_10083446 Ga0105240_100834466 193
299 3300009093 Ga0105240_10116590 Ga0105240_101165902 193
300 3300009098 Ga0105245_10064479 Ga0105245_100644792 193
301 3300009101 Ga0105247_10003343 Ga0105247_100033435 193
302 3300009101 Ga0105247_10953716 Ga0105247_109537161 193
303 3300009147 Ga0114129_10494583 Ga0114129_104945832 193
304 3300009148 Ga0105243_10056060 Ga0105243_100560602 193
305 3300009174 Ga0105241_10018950 Ga0105241_100189504 193
306 3300009174 Ga0105241_10412773 Ga0105241_104127731 193
307 3300009174 Ga0105241_10416357 Ga0105241_104163571 193
308 3300009176 Ga0105242_10056234 Ga0105242_100562343 193
309 3300009176 Ga0105242_10090589 Ga0105242_100905892 193
310 3300009177 Ga0105248_10000003 Ga0105248_10000003672 193
311 3300009177 Ga0105248_10155332 Ga0105248_101553321 193
312 3300009545 Ga0105237_10076278 Ga0105237_100762781 193
313 3300009551 Ga0105238_10614563 Ga0105238_106145632 193
314 3300009551 Ga0105238_11123849 Ga0105238_111238491 193
315 3300009553 Ga0105249_10026101 Ga0105249_100261013 193
316 3300009553 Ga0105249_10161356 Ga0105249_101613562 193
317 3300010375 Ga0105239_10472365 Ga0105239_104723652 193
318 3300010375 Ga0105239_10730824 Ga0105239_107308241 193
319 3300010375 Ga0105239_11722332 Ga0105239_117223321 193
320 3300011119 Ga0105246_10065671 Ga0105246_100656712 193
321 3300011119 Ga0105246_10116297 Ga0105246_101162972 193
322 3300013100 Ga0157373_10015048 Ga0157373_100150481 193
323 3300013100 Ga0157373_10042013 Ga0157373_100420131 193
324 3300013100 Ga0157373_10432142 Ga0157373_104321422 193
325 3300013102 Ga0157371_10031814 Ga0157371_100318142 193
326 3300013104 Ga0157370_10262990 Ga0157370_102629902 193
327 3300013104 Ga0157370_10600937 Ga0157370_106009371 193
328 3300013105 Ga0157369_10286887 Ga0157369_102868872 193
329 3300013296 Ga0157374_10003917 Ga0157374_100039178 193
330 3300013296 Ga0157374_10015000 Ga0157374_100150006 193
331 3300013296 Ga0157374_10251360 Ga0157374_102513602 193
332 3300013296 Ga0157374_10440978 Ga0157374_104409781 193
333 3300013297 Ga0157378_10000114 Ga0157378_1000011454 193
334 3300013297 Ga0157378_10028879 Ga0157378_100288792 193
335 3300013297 Ga0157378_10230917 Ga0157378_102309172 193
336 3300013306 Ga0163162_10005493 Ga0163162_100054936 193
337 3300013306 Ga0163162_10030398 Ga0163162_100303982 193
338 3300013306 Ga0163162_10095694 Ga0163162_100956942 193
339 3300013307 Ga0157372_10000504 Ga0157372_1000050421 193
340 3300013307 Ga0157372_10143191 Ga0157372_101431913 193
341 3300013308 Ga0157375_11096674 Ga0157375_110966741 193
342 3300014325 Ga0163163_10137364 Ga0163163_101373643 193
343 3300014325 Ga0163163_10163706 Ga0163163_101637062 193
344 3300014325 Ga0163163_10922546 Ga0163163_109225462 193
345 3300014497 Ga0182008_10004291 Ga0182008_100042914 193
346 3300014968 Ga0157379_10292769 Ga0157379_102927692 193
347 3300014968 Ga0157379_10475549 Ga0157379_104755492 193
348 3300014969 Ga0157376_10057382 Ga0157376_100573821 193
349 3300014969 Ga0157376_10135309 Ga0157376_101353092 193
350 3300014969 Ga0157376_10818833 Ga0157376_108188332 193
351 3300025885 Ga0207653_10034523 Ga0207653_100345233 193
352 3300025885 Ga0207653_10140514 Ga0207653_101405141 193
353 3300025893 Ga0207682_10266035 Ga0207682_102660351 193
354 3300025898 Ga0207692_10235925 Ga0207692_102359252 193
355 3300025899 Ga0207642_10015333 Ga0207642_100153332 193
356 3300025900 Ga0207710_10135149 Ga0207710_101351491 193
357 3300025903 Ga0207680_10032847 Ga0207680_100328472 193
358 3300025905 Ga0207685_10001246 Ga0207685_100012464 193
359 3300025906 Ga0207699_10028244 Ga0207699_100282441 193
360 3300025906 Ga0207699_10029731 Ga0207699_100297314 193
361 3300025906 Ga0207699_10111952 Ga0207699_101119522 193
362 3300025906 Ga0207699_10317108 Ga0207699_103171082 193
363 3300025906 Ga0207699_10345746 Ga0207699_103457461 193
364 3300025907 Ga0207645_10003288 Ga0207645_100032884 193
365 3300025909 Ga0207705_10044818 Ga0207705_100448183 193
366 3300025910 Ga0207684_10001117 Ga0207684_1000111716 193
367 3300025910 Ga0207684_10007311 Ga0207684_100073118 193
368 3300025910 Ga0207684_10007842 Ga0207684_100078422 193
369 3300025910 Ga0207684_10086066 Ga0207684_100860662 193
370 3300025911 Ga0207654_10007623 Ga0207654_100076232 193
371 3300025911 Ga0207654_10037774 Ga0207654_100377742 193
372 3300025911 Ga0207654_10322744 Ga0207654_103227442 193
373 3300025912 Ga0207707_10045887 Ga0207707_100458873 193
374 3300025912 Ga0207707_10691626 Ga0207707_106916262 193
375 3300025913 Ga0207695_10043213 Ga0207695_100432133 193
376 3300025913 Ga0207695_10044444 Ga0207695_100444446 193
377 3300025913 Ga0207695_10110645 Ga0207695_101106453 193
378 3300025914 Ga0207671_10010795 Ga0207671_100107952 193
379 3300025914 Ga0207671_10075610 Ga0207671_100756102 193
380 3300025915 Ga0207693_10000275 Ga0207693_100002759 193
381 3300025915 Ga0207693_10011260 Ga0207693_100112606 193
382 3300025915 Ga0207693_10047262 Ga0207693_100472623 193
383 3300025915 Ga0207693_10360997 Ga0207693_103609971 193
384 3300025916 Ga0207663_10002133 Ga0207663_100021332 193
385 3300025916 Ga0207663_10145788 Ga0207663_101457882 193
386 3300025917 Ga0207660_10018437 Ga0207660_100184374 193
387 3300025919 Ga0207657_10000254 Ga0207657_100002544 193
388 3300025919 Ga0207657_10002735 Ga0207657_1000273514 193
389 3300025921 Ga0207652_10357849 Ga0207652_103578492 193
390 3300025922 Ga0207646_10000471 Ga0207646_1000047116 193
391 3300025922 Ga0207646_10232725 Ga0207646_102327252 193
392 3300025924 Ga0207694_10247742 Ga0207694_102477422 193
393 3300025924 Ga0207694_10291873 Ga0207694_102918732 193
394 3300025924 Ga0207694_10776849 Ga0207694_107768491 193
395 3300025927 Ga0207687_10004264 Ga0207687_100042645 193
396 3300025927 Ga0207687_10084379 Ga0207687_100843792 193
397 3300025928 Ga0207700_10000111 Ga0207700_1000011124 193
398 3300025928 Ga0207700_10038908 Ga0207700_100389082 193
399 3300025928 Ga0207700_10056938 Ga0207700_100569382 193
400 3300025928 Ga0207700_10824728 Ga0207700_108247281 193
401 3300025929 Ga0207664_10025215 Ga0207664_100252154 193
402 3300025929 Ga0207664_10320793 Ga0207664_103207932 193
403 3300025929 Ga0207664_10498784 Ga0207664_104987841 193
404 3300025929 Ga0207664_10692927 Ga0207664_106929272 193
405 3300025929 Ga0207664_10711309 Ga0207664_107113091 193
406 3300025932 Ga0207690_10447803 Ga0207690_104478032 193
407 3300025933 Ga0207706_10003488 Ga0207706_100034887 193
408 3300025933 Ga0207706_10033194 Ga0207706_100331944 193
409 3300025934 Ga0207686_10264580 Ga0207686_102645801 193
410 3300025935 Ga0207709_10355731 Ga0207709_103557312 193
411 3300025938 Ga0207704_10006270 Ga0207704_100062705 193
412 3300025939 Ga0207665_10006116 Ga0207665_100061166 193
413 3300025939 Ga0207665_10009881 Ga0207665_100098813 193
414 3300025939 Ga0207665_10011970 Ga0207665_100119706 193
415 3300025939 Ga0207665_10019746 Ga0207665_100197461 193
416 3300025939 Ga0207665_10045237 Ga0207665_100452372 193
417 3300025939 Ga0207665_11070604 Ga0207665_110706041 193
418 3300025940 Ga0207691_10299112 Ga0207691_102991122 193
419 3300025941 Ga0207711_10000013 Ga0207711_10000013248 193
420 3300025941 Ga0207711_10000708 Ga0207711_100007083 193
421 3300025942 Ga0207689_10024883 Ga0207689_100248834 193
422 3300025944 Ga0207661_10083173 Ga0207661_100831732 193
423 3300025945 Ga0207679_10036880 Ga0207679_100368804 193
424 3300025945 Ga0207679_10215994 Ga0207679_102159942 193
425 3300025949 Ga0207667_10005768 Ga0207667_100057686 193
426 3300025961 Ga0207712_10006914 Ga0207712_100069141 193
427 3300025972 Ga0207668_10003703 Ga0207668_100037033 193
428 3300025981 Ga0207640_10013067 Ga0207640_100130673 193
429 3300025981 Ga0207640_10060810 Ga0207640_100608103 193
430 3300026023 Ga0207677_10018639 Ga0207677_100186394 193
431 3300026035 Ga0207703_10087614 Ga0207703_100876142 193
432 3300026041 Ga0207639_10094322 Ga0207639_100943221 193
433 3300026041 Ga0207639_10485670 Ga0207639_104856702 193
434 3300026041 Ga0207639_10849573 Ga0207639_108495732 193
435 3300026067 Ga0207678_10000256 Ga0207678_100002569 193
436 3300026078 Ga0207702_10034140 Ga0207702_100341406 193
437 3300026078 Ga0207702_10196777 Ga0207702_101967772 193
438 3300026078 Ga0207702_10462628 Ga0207702_104626282 193
439 3300026088 Ga0207641_10066043 Ga0207641_100660433 193
440 3300026088 Ga0207641_10196325 Ga0207641_101963251 193
441 3300026089 Ga0207648_10006028 Ga0207648_100060288 193
442 3300026095 Ga0207676_10166021 Ga0207676_101660212 193
443 3300026116 Ga0207674_10049130 Ga0207674_100491304 193
444 3300026116 Ga0207674_10184025 Ga0207674_101840252 193
445 3300026121 Ga0207683_10006753 Ga0207683_100067538 193
446 3300026142 Ga0207698_10010630 Ga0207698_100106305 193
447 3300027671 Ga0209588_1004706 Ga0209588_10047063 193
448 3300027671 Ga0209588_1026778 Ga0209588_10267782 193
449 3300027671 Ga0209588_1027849 Ga0209588_10278492 193
450 3300027671 Ga0209588_1035042 Ga0209588_10350421 193
451 3300028016 Ga0265354_1005228 Ga0265354_10052282 193
452 3300028380 Ga0268265_10084865 Ga0268265_100848652 193
453 3300028381 Ga0268264_10035584 Ga0268264_100355842 193
454 3300028381 Ga0268264_10134396 Ga0268264_101343962 193
455 3300028800 Ga0265338_10061131 Ga0265338_100611313 193
456 3300030878 Ga0265770_1004292 Ga0265770_10042922 193
457 3300030879 Ga0265765_1000737 Ga0265765_10007373 193
458 3300031090 Ga0265760_10002675 Ga0265760_100026755 193
459 3300031090 Ga0265760_10088499 Ga0265760_100884992 193
460 3300031241 Ga0265325_10025063 Ga0265325_100250632 193
461 3300031344 Ga0265316_10039227 Ga0265316_100392272 193
462 3300034957 Ga0373938_0098457 Ga0373938_0098457_67_666 193
463 3300035084 Ga0373928_0042965 Ga0373928_0042965_81_680 193
464 3300035112 Ga0373932_0004078 Ga0373932_0004078_207_806 193
465 3300035114 Ga0373939_0045488 Ga0373939_0045488_271_870 193
466 3300035115 Ga0373941_0162558 Ga0373941_0162558_132_731 193
467 3300035118 Ga0373954_0000112 Ga0373954_0000112_1129_1737 193
468 3300035119 Ga0373956_0027503 Ga0373956_0027503_1120_1728 193
469 3300035170 Ga0373943_0015940 Ga0373943_0015940_1478_2068 193
470 3300035170 Ga0373943_0219662 Ga0373943_0219662_444_1034 193
471 3300035172 Ga0373955_0009223 Ga0373955_0009223_3831_4439 193
472 3300035691 Ga0373931_0012563 Ga0373931_0012563_103_702 193
473 3300035692 Ga0373935_0299357 Ga0373935_0299357_340_939 193
474 3300035695 Ga0373927_0171092 Ga0373927_0171092_544_1134 193
475 3300035724 Ga0373933_0003817 Ga0373933_0003817_6589_7197 193
476 3300035724 Ga0373933_0030512 Ga0373933_0030512_1155_1745 193
477 3300035724 Ga0373933_0036014 Ga0373933_0036014_2298_2882 193
478 3300035725 Ga0373947_0051731 Ga0373947_0051731_609_1199 193
479 3300035725 Ga0373947_0309529 Ga0373947_0309529_333_932 193
480 3300036401 Ga0373937_0001579 Ga0373937_0001579_14843_15451 193
481 3300036401 Ga0373937_0031660 Ga0373937_0031660_433_1032 193
482 3300036401 Ga0373937_0061034 Ga0373937_0061034_1709_2305 193
483 3300036401 Ga0373937_0200327 Ga0373937_0200327_298_897 193
484 3300037068 Ga0373925_0004053 Ga0373925_0004053_2121_2711 193
485 3300037068 Ga0373925_0012233 Ga0373925_0012233_1470_2060 193
486 3300037068 Ga0373925_0063691 Ga0373925_0063691_76_675 193
487 3300037068 Ga0373925_0165017 Ga0373925_0165017_971_1561 193
488 3300037068 Ga0373925_0198267 Ga0373925_0198267_819_1403 193
489 3300037853 Ga0436364_1416704 Ga0436364_1416704_954_1544 193
490 3300045051 Ga0451576_0441814 Ga0451576_0441814_57_653 193
491 3300045976 Ga0466967_0026613 Ga0466967_0026613_133_723 193
492 3300045976 Ga0466967_0086910 Ga0466967_0086910_1799_2383 193
493 3300045976 Ga0466967_0261194 Ga0466967_0261194_774_1364 193
494 3300046463 Ga0495653_0051892 Ga0495653_0051892_1575_2183 193
495 3300046472 Ga0495580_0004417 Ga0495580_0004417_5301_5891 193
496 3300046473 Ga0495582_0004858 Ga0495582_0004858_1152_1742 193
497 3300046473 Ga0495582_0362423 Ga0495582_0362423_165_764 193
498 3300046516 Ga0495628_0664505 Ga0495628_0664505_89_688 193
499 3300046517 Ga0495630_0163073 Ga0495630_0163073_323_913 193
500 3300046531 Ga0495665_0004469 Ga0495665_0004469_4322_4912 193
501 3300046535 Ga0495586_0396522 Ga0495586_0396522_134_724 193
502 3300046536 Ga0495587_0005720 Ga0495587_0005720_6230_6838 193
503 3300046536 Ga0495587_0031004 Ga0495587_0031004_964_1563 193
504 3300046675 Ga0495657_0231173 Ga0495657_0231173_252_851 193
505 3300046678 Ga0495599_0308250 Ga0495599_0308250_261_866 193
506 3300046679 Ga0495623_0351808 Ga0495623_0351808_170_778 193
507 3300047317 Ga0495604_0001581 Ga0495604_0001581_15319_15927 193
508 3300047319 Ga0495674_0039876 Ga0495674_0039876_3368_3973 193
509 3300047471 Ga0495684_0042822 Ga0495684_0042822_1565_2173 193
510 3300047471 Ga0495684_0363073 Ga0495684_0363073_146_742 193
511 3300048088 Ga0495602_0008520 Ga0495602_0008520_3466_4074 193
512 3300048088 Ga0495602_0139247 Ga0495602_0139247_627_1211 193
513 3300048088 Ga0495602_0279633 Ga0495602_0279633_583_1173 193
514 3300048903 Ga0496100_0000958 Ga0496100_0000958_6725_7324 193
515 3300048903 Ga0496100_0205140 Ga0496100_0205140_746_1354 193
516 3300048904 Ga0496101_0019396 Ga0496101_0019396_3515_4114 193
517 3300048905 Ga0496102_0001575 Ga0496102_0001575_7796_8395 193
518 3300048905 Ga0496102_0008044 Ga0496102_0008044_2279_2875 193
519 3300048906 Ga0496103_0289758 Ga0496103_0289758_304_903 193
520 3300048907 Ga0496104_0028148 Ga0496104_0028148_3623_4222 193
521 3300048907 Ga0496104_0137945 Ga0496104_0137945_497_1096 193
522 3300048907 Ga0496104_0191070 Ga0496104_0191070_1337_1933 193
523 3300048907 Ga0496104_0285601 Ga0496104_0285601_601_1191 193
524 3300048907 Ga0496104_0793498 Ga0496104_0793498_120_719 193
525 3300048908 Ga0496105_0086821 Ga0496105_0086821_1756_2355 193
526 3300048908 Ga0496105_0124502 Ga0496105_0124502_1258_1857 193
527 3300048908 Ga0496105_0172691 Ga0496105_0172691_1077_1676 193
528 3300048909 Ga0496106_0200292 Ga0496106_0200292_93_692 193
529 3300048909 Ga0496106_0496848 Ga0496106_0496848_293_892 193
530 3300048910 Ga0496107_0102798 Ga0496107_0102798_431_1030 193
531 3300048912 Ga0496109_0208589 Ga0496109_0208589_343_942 193
532 3300048912 Ga0496109_0394154 Ga0496109_0394154_568_1167 193
533 3300048913 Ga0496110_0401078 Ga0496110_0401078_177_776 193
534 3300048915 Ga0496112_0065438 Ga0496112_0065438_1570_2169 193
535 3300048915 Ga0496112_0179675 Ga0496112_0179675_1245_1844 193
536 3300048915 Ga0496112_0247922 Ga0496112_0247922_815_1411 193
537 3300048916 Ga0496113_0073999 Ga0496113_0073999_1394_1993 193
538 3300048917 Ga0496114_0015725 Ga0496114_0015725_2053_2652 193
539 3300048918 Ga0496115_0003600 Ga0496115_0003600_6657_7256 193
540 3300048918 Ga0496115_0390324 Ga0496115_0390324_178_777 193
541 3300050507 nmdc:mga05p37_402554_c1 nmdc:mga05p37_402554_c1_873_1469 193
542 3300050512 nmdc:mga0n895_102_c1 nmdc:mga0n895_102_c1_34847_35443 193
543 3300050513 nmdc:mga0rr50_106242_c1 nmdc:mga0rr50_106242_c1_419_1009 193
544 3300050513 nmdc:mga0rr50_110_c1 nmdc:mga0rr50_110_c1_2693_3289 193
545 3300050513 nmdc:mga0rr50_95721_c1 nmdc:mga0rr50_95721_c1_56_646 193
546 3300050514 nmdc:mga08x19_127573_c1 nmdc:mga08x19_127573_c1_88_672 193
547 3300050514 nmdc:mga08x19_3025_c1 nmdc:mga08x19_3025_c1_5924_6514 193
548 3300050514 nmdc:mga08x19_313549_c1 nmdc:mga08x19_313549_c1_358_948 193
549 3300050514 nmdc:mga08x19_36409_c1 nmdc:mga08x19_36409_c1_462_1052 193
550 3300050514 nmdc:mga08x19_9881_c1 nmdc:mga08x19_9881_c1_1761_2351 193
551 3300050515 nmdc:mga0a205_131_c1 nmdc:mga0a205_131_c1_43399_43995 193
552 3300053077 Ga0495601_0012746 Ga0495601_0012746_3135_3740 193
553 3300059490 Ga0587066_067953 Ga0587066_067953_28_627 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13618

Gluconate_2-dh3

Gluconate 2-dehydrogenase subunit 3

84

217

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gy8-assembly1.cif.gz_A crystal structure of xaxa from xenorhabdus nematophila 0.3081 56 174
7sh3-assembly1.cif.gz_A crystal structure of a virb8-like protein of type iv secretion system from rickettsia typhi in complex with a synthetic virb8 miniprotein binder 0.3036 92 162
4h6i-assembly1.cif.gz_A crystal structure of staphylococcal complement inhibitor scin-b 0.2997 92 162
7sh3-assembly1.cif.gz_A crystal structure of a virb8-like protein of type iv secretion system from rickettsia typhi in complex with a synthetic virb8 miniprotein binder 0.2976 92 162
7f66-assembly1.cif.gz_D eif2b-sfsv nss-1-eif2 0.2935 28 146
ID Description Score Start End Superfamily
af_P57796_115_204_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.3634 51 139 1.10.238.10
af_P57796_115_204_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.3191 51 139 1.10.238.10
3t49C00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.3012 92 162 1.20.1270.10
af_E0AHB5_1_108_1.20.120.340 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS 0.301 82 172 1.20.120.340
4h6iA00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.2997 92 162 1.20.1270.10
ID Description Score Start End GO Terms
AF-A0A848VP04-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9509 45 187
AF-A0A2V9QQB0-F1-model_v4 Transcriptional initiation protein Tat 0.9492 50 193
AF-A0A6M1SUL6-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9448 50 188
AF-A0A2V9QQB0-F1-model_v4 Transcriptional initiation protein Tat 0.9427 50 193
AF-A0A2V9KPZ7-F1-model_v4 Tat pathway signal protein 0.9354 44 187

Feature Viewer

pLDDT pTM Quality
82.71 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map