F462864

General Info

Members Datasets Scaffolds Average Seq Length
553 343 1106 283

Family's Representative Sequence

Representative Sequence 3300025242|Ga0209258_100977|Ga0209258_1009779
Length 320
Sequence LLRKTFAACTPPWGSPVRLGRNPRFPESDPMLEAFDNFWSIYSNLVLSLGTASLLALSIYLTLSCGMLAMANAAFMGIGAYTSSILTMNYGWPFPAAIAAGMAAPTVVAFLIGKPTLRLSGVYLAMATLAFGEVVRLCIIRAESLTGGALGLNGIPQLTQWWHVLLAVVAVLLVLARLRRSKIGRAFEAIKEDETAAGLMGIDVNGHKMLAFALGAAIAGLAGTLNAHLTFFIGPQEYGFDRGVEILTMTILGGINSLFGPVLGGIIVTLLPELLRSFKDYRAVANGLILVLIVLFLPKGLWNPAWMRRVLGLQRKGVTP

Samples

Sample ID Description Type Environment
1 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
165 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
166 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
223 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
301 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
302 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
303 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
304 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
305 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
306 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
307 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
310 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
311 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
312 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
313 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
314 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
315 2643221569 Achromobacter sp. Root565 Isolate Unclassified
316 2643221594 Achromobacter sp. Root170 Isolate Unclassified
317 2643221621 Achromobacter sp. Root83 Isolate Unclassified
318 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
319 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
320 2738541277 Variovorax sp. GV051 Isolate Unclassified
321 2738541307 Variovorax sp. GV008 Isolate Unclassified
322 2738543019 Variovorax sp. GV040 Isolate Unclassified
323 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
324 2818991446 Variovorax sp. 1180 Isolate Unclassified
325 2855730933 Achromobacter sp. HZ28 Isolate Nodule
326 2855767633 Achromobacter sp. HZ34 Isolate Nodule
327 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
328 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
329 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
330 2858950400 Achromobacter sp. K91 Isolate Unclassified
331 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
332 2885266251 Ralstonia sp. SET104 Isolate Nodule
333 2899924645 Variovorax sp. 369 Isolate Unclassified
334 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
335 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
336 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
337 2928037797 Variovorax sp. 1126 Isolate Unclassified
338 2928044640 Variovorax sp. 1128 Isolate Unclassified
339 2928051484 Variovorax sp. 1133 Isolate Unclassified
340 2928058823 Ralstonia sp. 1138 Isolate Unclassified
341 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
342 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
343 2941479691

Type Distribution

Type Percentage (%)
Metagenomes 93.67
Metatranscriptomes 0.18
Isolates 6.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.54
Nodule 0.54
Rhizoplane 2.17
Rhizosphere 63.29
Stem 0
Stem Tuber 0
Unclassified 2.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209258_100977 3300025242 Bacteria 13291
2 JGI24741J21665_1000196 3300001915 Bacteria 17817
3 JGI24740J21852_10001061 3300001979 Bacteria 12371
4 JGI24740J21852_10002700 3300001979 Bacteria 7967
5 JGI25156J39149_1000060 3300002705 Bacteria 84857
6 JGI25156J39149_1000175 3300002705 Bacteria 47051
7 JGI25156J39149_1001779 3300002705 Bacteria 8529
8 JGI25156J39149_1015016 3300002705 Bacteria 1570
9 JGI25154J39366_1000129 3300002738 Bacteria 59399
10 JGI25154J39366_1002385 3300002738 Bacteria 4930
11 JGI25157J39369_1000029 3300002741 Bacteria 146928
12 JGI25151J46595_10000137 3300003187 Bacteria 96370
13 JGI25151J46595_10017086 3300003187 Bacteria 3158
14 rootH1_10009484 3300003316 Bacteria 3739
15 rootH1_10017612 3300003316 Bacteria 3441
16 rootH1_10017613 3300003316 Bacteria 3065
17 rootL2_10012237 3300003322 Bacteria 1352
18 rootL2_10022997 3300003322 Bacteria 5485
19 rootH1_10002261 3300003323 Bacteria 7667
20 rootH1_10024154 3300003323 Bacteria 5841
21 rootH1_10036886 3300003323 Bacteria 1130
22 Ga0055538_1004414 3300003751 Bacteria 1601
23 Ga0055539_1000081 3300003752 Bacteria 122891
24 Ga0055539_1000118 3300003752 Bacteria 86566
25 Ga0055539_1000739 3300003752 Bacteria 8155
26 Ga0055533_1000010 3300003756 Bacteria 491196
27 Ga0055533_1000421 3300003756 Bacteria 16356
28 Ga0055532_1000048 3300003758 Bacteria 175560
29 Ga0055525_1000415 3300003759 Bacteria 25986
30 Ga0055525_1001267 3300003759 Bacteria 5329
31 Ga0055535_1000035 3300003761 Bacteria 175560
32 Ga0055535_1000076 3300003761 Bacteria 111203
33 Ga0055535_1000282 3300003761 Bacteria 53559
34 Ga0055542_1000009 3300003762 Bacteria 416550
35 Ga0055542_1000724 3300003762 Bacteria 25809
36 Ga0055529_1000101 3300003763 Bacteria 130709
37 Ga0055529_1000491 3300003763 Bacteria 36152
38 Ga0055529_1000810 3300003763 Bacteria 18955
39 Ga0055530_10038791 3300003791 Bacteria 1181
40 Ga0055541_1005019 3300003841 Bacteria 2351
41 Ga0065704_10180567 3300005289 Unclassified 1239
42 Ga0065712_10000421 3300005290 Bacteria 18901
43 Ga0065715_10089174 3300005293 Bacteria 13129
44 Ga0070658_10012827 3300005327 Bacteria 6725
45 Ga0070658_10015843 3300005327 Bacteria 6027
46 Ga0070658_10059809 3300005327 Bacteria 3102
47 Ga0070658_10265108 3300005327 Bacteria 1460
48 Ga0070690_100002935 3300005330 Bacteria 9216
49 Ga0070670_100000191 3300005331 Bacteria 56346
50 Ga0070670_100447113 3300005331 Bacteria 1145
51 Ga0068869_100129884 3300005334 Bacteria 1935
52 Ga0070680_100002615 3300005336 Bacteria 13332
53 Ga0070682_100011098 3300005337 Bacteria 5139
54 Ga0068868_100147211 3300005338 Bacteria 1937
55 Ga0070660_100097816 3300005339 Unclassified 2322
56 Ga0070660_100165026 3300005339 Bacteria 1786
57 Ga0070691_10014998 3300005341 Bacteria 3559
58 Ga0070661_100000370 3300005344 Bacteria 35389
59 Ga0070661_100003806 3300005344 Bacteria 10397
60 Ga0070675_100275892 3300005354 Bacteria 1476
61 Ga0070671_100069322 3300005355 Bacteria 2941
62 Ga0070673_100061586 3300005364 Unclassified 2977
63 Ga0070659_100014344 3300005366 Bacteria 5921
64 Ga0070659_100037086 3300005366 Bacteria 3800
65 Ga0070659_100081203 3300005366 Unclassified 2589
66 Ga0070667_100233470 3300005367 Bacteria 1641
67 Ga0070700_100006624 3300005441 Bacteria 6202
68 Ga0070700_100244083 3300005441 Bacteria 1285
69 Ga0070694_100429510 3300005444 Bacteria 1039
70 Ga0070663_100000024 3300005455 Bacteria 108544
71 Ga0070662_100026282 3300005457 Unclassified 4030
72 Ga0070681_10018223 3300005458 Bacteria 7018
73 Ga0070681_10250641 3300005458 Bacteria 1683
74 Ga0068867_100053336 3300005459 Bacteria 2986
75 Ga0070685_10059674 3300005466 Bacteria 2228
76 Ga0070679_100044982 3300005530 Bacteria 4398
77 Ga0068853_100103887 3300005539 Bacteria 2515
78 Ga0068853_100132157 3300005539 Bacteria 2235
79 Ga0068853_100154419 3300005539 Bacteria 2068
80 Ga0070686_100018817 3300005544 Bacteria 4061
81 Ga0070686_100258625 3300005544 Bacteria 1275
82 Ga0070695_100005789 3300005545 Bacteria 7283
83 Ga0070696_100014843 3300005546 Bacteria 5228
84 Ga0070665_100241768 3300005548 Bacteria 1806
85 Ga0068855_100011241 3300005563 Bacteria 10811
86 Ga0068855_100026695 3300005563 Bacteria 6910
87 Ga0068855_100129025 3300005563 Bacteria 2889
88 Ga0068855_100325121 3300005563 Bacteria 1699
89 Ga0068855_100448804 3300005563 Bacteria 1407
90 Ga0070664_100000022 3300005564 Bacteria 108544
91 Ga0070664_100016829 3300005564 Bacteria 6002
92 Ga0070664_100087322 3300005564 Bacteria 2696
93 Ga0068857_100013429 3300005577 Bacteria 7134
94 Ga0068857_100026215 3300005577 Bacteria 5136
95 Ga0068854_100000336 3300005578 Bacteria 30476
96 Ga0068854_100004203 3300005578 Bacteria 9067
97 Ga0068856_100000049 3300005614 Bacteria 108544
98 Ga0068856_100005146 3300005614 Bacteria 12913
99 Ga0068856_100043152 3300005614 Bacteria 4437
100 Ga0068852_100241544 3300005616 Bacteria 1726
101 Ga0068859_100190878 3300005617 Bacteria 2133
102 Ga0068864_100168402 3300005618 Bacteria 1996
103 Ga0068861_100088990 3300005719 Bacteria 2433
104 Ga0068851_10015896 3300005834 Bacteria 3593
105 Ga0068858_100376284 3300005842 Bacteria 1362
106 Ga0068860_100031835 3300005843 Bacteria 5071
107 Ga0068860_100186892 3300005843 Bacteria 2004
108 Ga0068860_100699781 3300005843 Bacteria 1023
109 Ga0075368_10008857 3300006042 Bacteria 3605
110 Ga0075363_100016697 3300006048 Bacteria 3630
111 Ga0075364_10017700 3300006051 Bacteria 4456
112 Ga0075362_10000766 3300006177 Bacteria 9569
113 Ga0075362_10087878 3300006177 Bacteria 1440
114 Ga0075367_10004452 3300006178 Bacteria 6843
115 Ga0075369_10011434 3300006186 Bacteria 3493
116 Ga0097621_100028288 3300006237 Bacteria 4418
117 Ga0097621_100110020 3300006237 Bacteria 2328
118 Ga0075370_10002838 3300006353 Bacteria 8130
119 Ga0075370_10030368 3300006353 Bacteria 3015
120 Ga0075370_10082268 3300006353 Bacteria 1851
121 Ga0075370_10083411 3300006353 Bacteria 1839
122 Ga0075431_100097251 3300006847 Bacteria 3040
123 Ga0075434_100083473 3300006871 Bacteria 3192
124 Ga0075429_100025185 3300006880 Bacteria 5165
125 Ga0075436_100145184 3300006914 Bacteria 1668
126 Ga0097620_100190880 3300006931 Bacteria 2133
127 Ga0075435_100048279 3300007076 Bacteria 3419
128 Ga0105244_10037149 3300009036 Bacteria 2548
129 Ga0105244_10094820 3300009036 Bacteria 1465
130 Ga0105240_10004619 3300009093 Bacteria 20879
131 Ga0111539_10779798 3300009094 Unclassified 1113
132 Ga0114129_10128608 3300009147 Bacteria 3481
133 Ga0105243_10088049 3300009148 Bacteria 2550
134 Ga0105243_10312764 3300009148 Bacteria 1428
135 Ga0105243_10586954 3300009148 Bacteria 1070
136 Ga0105241_10101372 3300009174 Bacteria 2289
137 Ga0105242_10038051 3300009176 Bacteria 3867
138 Ga0105242_10231446 3300009176 Bacteria 1656
139 Ga0105242_10448650 3300009176 Bacteria 1215
140 Ga0105237_10003650 3300009545 Bacteria 18149
141 Ga0105237_10168917 3300009545 Bacteria 2187
142 Ga0105238_10139183 3300009551 Bacteria 2404
143 Ga0105239_10009773 3300010375 Bacteria 10783
144 Ga0105239_10299098 3300010375 Bacteria 1812
145 Ga0105246_10398089 3300011119 Bacteria 1143
146 Ga0157373_10003934 3300013100 Bacteria 11217
147 Ga0157373_10008463 3300013100 Bacteria 7639
148 Ga0157373_10014407 3300013100 Bacteria 5796
149 Ga0157371_10000089 3300013102 Bacteria 145483
150 Ga0157371_10046793 3300013102 Bacteria 3076
151 Ga0157370_10000002 3300013104 Bacteria 431400
152 Ga0157370_10401717 3300013104 Bacteria 1261
153 Ga0157369_10118903 3300013105 Bacteria 2805
154 Ga0157378_10097698 3300013297 Bacteria 2677
155 Ga0157378_10161718 3300013297 Bacteria 2094
156 Ga0163162_10028713 3300013306 Bacteria 5506
157 Ga0163162_10071540 3300013306 Bacteria 3522
158 Ga0163162_10324365 3300013306 Bacteria 1672
159 Ga0157372_10000149 3300013307 Bacteria 76796
160 Ga0157372_10049517 3300013307 Bacteria 4671
161 Ga0182008_10003693 3300014497 Bacteria 9130
162 Ga0182008_10007653 3300014497 Bacteria 5953
163 Ga0157379_10679621 3300014968 Bacteria 965
164 Ga0157376_10122106 3300014969 Bacteria 2310
165 Ga0157376_10215195 3300014969 Bacteria 1776
166 Ga0182006_1000377 3300015261 Bacteria 37032
167 Ga0182006_1075038 3300015261 Bacteria 1245
168 Ga0182007_10000908 3300015262 Bacteria 16394
169 Ga0182007_10022146 3300015262 Bacteria 2248
170 Ga0182005_1014683 3300015265 Bacteria 2190
171 Ga0182005_1063363 3300015265 Bacteria 1011
172 Ga0183362_10003 3300015683 Bacteria 977584
173 Ga0163161_10015879 3300017792 Bacteria 5253
174 Ga0154015_1172573 3300020610 Bacteria 1366
175 Ga0213872_10000453 3300021361 Bacteria 33422
176 Ga0213872_10011834 3300021361 Bacteria 4122
177 Ga0209784_100024 3300025224 Bacteria 394613
178 Ga0209784_100435 3300025224 Bacteria 18206
179 Ga0209784_100569 3300025224 Bacteria 12778
180 Ga0209566_100018 3300025225 Bacteria 448638
181 Ga0209566_100251 3300025225 Bacteria 51274
182 Ga0209674_100003 3300025226 Bacteria 2196646
183 Ga0209674_100046 3300025226 Bacteria 357920
184 Ga0209674_100135 3300025226 Bacteria 113826
185 Ga0209672_100240 3300025228 Bacteria 41226
186 Ga0209672_100758 3300025228 Bacteria 15615
187 Ga0209672_108688 3300025228 Bacteria 1485
188 Ga0209147_100008 3300025229 Bacteria 777096
189 Ga0209563_100039 3300025230 Bacteria 409717
190 Ga0209563_100049 3300025230 Bacteria 358472
191 Ga0207427_100158 3300025231 Bacteria 76687
192 Ga0209258_100009 3300025242 Bacteria 996276
193 Ga0209258_100013 3300025242 Bacteria 777096
194 Ga0209258_100258 3300025242 Bacteria 92469
195 Ga0209258_106522 3300025242 Bacteria 1820
196 Ga0207425_1017760 3300025245 Bacteria 1556
197 Ga0209646_1000027 3300025246 Bacteria 395141
198 Ga0209646_1000111 3300025246 Bacteria 155786
199 Ga0209026_1000054 3300025250 Bacteria 242508
200 Ga0209026_1001871 3300025250 Bacteria 8583
201 Ga0209677_100024 3300025253 Bacteria 406035
202 Ga0209677_100050 3300025253 Bacteria 176828
203 Ga0209677_100105 3300025253 Bacteria 89277
204 Ga0209677_103608 3300025253 Bacteria 4903
205 Ga0209677_113063 3300025253 Bacteria 1199
206 Ga0209148_1000007 3300025254 Bacteria 1592273
207 Ga0209148_1000019 3300025254 Bacteria 748518
208 Ga0209148_1005859 3300025254 Bacteria 2739
209 Ga0209148_1005868 3300025254 Bacteria 2737
210 Ga0209759_1000043 3300025256 Bacteria 242513
211 Ga0209759_1000332 3300025256 Bacteria 62148
212 Ga0209759_1001539 3300025256 Bacteria 12648
213 Ga0209759_1002064 3300025256 Bacteria 9414
214 Ga0209759_1002811 3300025256 Bacteria 7346
215 Ga0209759_1010060 3300025256 Bacteria 2804
216 Ga0209759_1011351 3300025256 Bacteria 2539
217 Ga0209455_1000042 3300025272 Bacteria 419638
218 Ga0209455_1000092 3300025272 Bacteria 220516
219 Ga0209455_1000633 3300025272 Bacteria 21704
220 Ga0209675_1010854 3300025291 Bacteria 3071
221 Ga0209676_1003758 3300025292 Bacteria 8999
222 Ga0209025_1000071 3300025294 Bacteria 287297
223 Ga0209025_1000103 3300025294 Bacteria 228054
224 Ga0209050_1001375 3300025298 Bacteria 26556
225 Ga0209050_1005800 3300025298 Bacteria 7592
226 Ga0209051_1003989 3300025303 Bacteria 9370
227 Ga0209051_1010722 3300025303 Bacteria 4590
228 Ga0209051_1019840 3300025303 Bacteria 2920
229 Ga0207697_10015389 3300025315 Bacteria 3162
230 Ga0207688_10057786 3300025901 Bacteria 2182
231 Ga0207680_10028941 3300025903 Bacteria 3106
232 Ga0207645_10001291 3300025907 Bacteria 20581
233 Ga0207645_10010246 3300025907 Bacteria 6442
234 Ga0207645_10165844 3300025907 Bacteria 1446
235 Ga0207705_10153277 3300025909 Bacteria 1727
236 Ga0207705_10280311 3300025909 Bacteria 1276
237 Ga0207705_10338454 3300025909 Bacteria 1158
238 Ga0207707_10007506 3300025912 Bacteria 9502
239 Ga0207707_10012673 3300025912 Bacteria 7327
240 Ga0207707_10247021 3300025912 Bacteria 1550
241 Ga0207695_10004317 3300025913 Bacteria 19473
242 Ga0207695_10105882 3300025913 Bacteria 2799
243 Ga0207671_10005337 3300025914 Bacteria 11894
244 Ga0207671_10029727 3300025914 Bacteria 4078
245 Ga0207660_10013064 3300025917 Bacteria 5437
246 Ga0207657_10015456 3300025919 Bacteria 7394
247 Ga0207649_10000075 3300025920 Bacteria 83915
248 Ga0207649_10012065 3300025920 Bacteria 4781
249 Ga0207652_10020384 3300025921 Bacteria 5459
250 Ga0207694_10143364 3300025924 Bacteria 1922
251 Ga0207650_10000481 3300025925 Bacteria 33253
252 Ga0207650_10374097 3300025925 Bacteria 1176
253 Ga0207690_10014714 3300025932 Bacteria 4731
254 Ga0207690_10015398 3300025932 Bacteria 4634
255 Ga0207690_10024118 3300025932 Bacteria 3806
256 Ga0207706_10003089 3300025933 Bacteria 16000
257 Ga0207706_10213386 3300025933 Bacteria 1691
258 Ga0207686_10301970 3300025934 Bacteria 1189
259 Ga0207709_10029741 3300025935 Bacteria 3172
260 Ga0207704_10101586 3300025938 Bacteria 1919
261 Ga0207689_10065574 3300025942 Bacteria 2986
262 Ga0207679_10000004 3300025945 Bacteria 589021
263 Ga0207679_10003108 3300025945 Bacteria 10278
264 Ga0207679_10026687 3300025945 Bacteria 3986
265 Ga0207667_10009547 3300025949 Bacteria 11417
266 Ga0207667_10112449 3300025949 Bacteria 2808
267 Ga0207667_10633030 3300025949 Bacteria 1076
268 Ga0207651_10287938 3300025960 Bacteria 1361
269 Ga0207640_10000084 3300025981 Bacteria 74504
270 Ga0207640_10000813 3300025981 Bacteria 17745
271 Ga0207658_10069918 3300025986 Bacteria 2654
272 Ga0207639_10073483 3300026041 Bacteria 2681
273 Ga0207639_10183328 3300026041 Bacteria 1782
274 Ga0207678_10000012 3300026067 Bacteria 145324
275 Ga0207678_10113555 3300026067 Bacteria 2311
276 Ga0207702_10000020 3300026078 Bacteria 203299
277 Ga0207702_10000376 3300026078 Bacteria 50989
278 Ga0207702_10073956 3300026078 Bacteria 2940
279 Ga0207648_10073696 3300026089 Bacteria 2975
280 Ga0207676_10146287 3300026095 Bacteria 2030
281 Ga0207674_10020737 3300026116 Bacteria 7092
282 Ga0207674_10159803 3300026116 Bacteria 2208
283 Ga0207675_100041680 3300026118 Bacteria 4287
284 Ga0207675_100115734 3300026118 Bacteria 2533
285 Ga0207683_10056649 3300026121 Bacteria 3439
286 Ga0207698_10289346 3300026142 Bacteria 1520
287 Ga0207698_10419538 3300026142 Bacteria 1284
288 Ga0209371_1009365 3300027312 Bacteria 3121
289 Ga0209813_10002599 3300027866 Bacteria 4148
290 Ga0207428_10022387 3300027907 Bacteria 5334
291 Ga0265336_10000006 3300028666 Bacteria 348453
292 Ga0307515_10038038 3300028794 Bacteria 7713
293 Ga0307515_10038364 3300028794 Bacteria 7666
294 Ga0307515_10054315 3300028794 Bacteria 5884
295 Ga0265324_10000948 3300029957 Bacteria 18150
296 Ga0265324_10049089 3300029957 Bacteria 1451
297 Ga0268256_1021889 3300030500 Bacteria 1690
298 Ga0307512_10129262 3300030522 Bacteria 1591
299 Ga0265327_10000748 3300031251 Bacteria 50556
300 Ga0265327_10005915 3300031251 Bacteria 9990
301 Ga0307513_10071884 3300031456 Bacteria 3608
302 Ga0307513_10075651 3300031456 Bacteria 3495
303 Ga0307509_10011687 3300031507 Bacteria 10603
304 Ga0307509_10039549 3300031507 Bacteria 5137
305 Ga0307509_10235110 3300031507 Bacteria 1631
306 Ga0307508_10022566 3300031616 Bacteria 5719
307 Ga0307508_10373639 3300031616 Bacteria 1016
308 Ga0265314_10007298 3300031711 Bacteria 9601
309 Ga0265342_10000556 3300031712 Bacteria 39445
310 Ga0307516_10001684 3300031730 Bacteria 30439
311 Ga0307516_10015404 3300031730 Bacteria 8047
312 Ga0307405_10008752 3300031731 Bacteria 5149
313 Ga0307410_10355463 3300031852 Bacteria 1172
314 Ga0307412_10000137 3300031911 Bacteria 53231
315 Ga0307409_100294099 3300031995 Unclassified 1507
316 Ga0307414_10074888 3300032004 Bacteria 2455
317 Ga0307411_10205503 3300032005 Unclassified 1516
318 Ga0307510_10051446 3300033180 Bacteria 4356
319 Ga0307510_10117817 3300033180 Bacteria 2371
320 Ga0373926_0065629 3300035083 Bacteria 1328
321 Ga0373944_0071823 3300035089 Bacteria 1129
322 Ga0373956_0082462 3300035119 Bacteria 1477
323 Ga0373943_0076309 3300035170 Bacteria 1709
324 Ga0373931_0004078 3300035691 Bacteria 6625
325 Ga0373931_0068160 3300035691 Bacteria 1936
326 Ga0373931_0115098 3300035691 Bacteria 1530
327 Ga0373935_0084354 3300035692 Bacteria 2069
328 Ga0373925_0174032 3300037068 Bacteria 1700
329 Ga0395899_0139509 3300037312 Bacteria 1726
330 Ga0395900_0028049 3300037418 Bacteria 5764
331 Ga0395900_0074412 3300037418 Bacteria 3492
332 Ga0395900_0306437 3300037418 Bacteria 1573
333 Ga0395898_0051972 3300037466 Bacteria 4005
334 Ga0395898_0343898 3300037466 Bacteria 1422
335 Ga0395905_0016422 3300037471 Bacteria 7035
336 Ga0395905_0095557 3300037471 Bacteria 2789
337 Ga0395905_0269758 3300037471 Bacteria 1588
338 Ga0395901_0034836 3300038443 Bacteria 5200
339 Ga0436361_0837231 3300039447 Bacteria 44100
340 Ga0436361_1222882 3300039447 Bacteria 1193
341 Ga0439436_0055451 3300041404 Bacteria 1114
342 Ga0439435_0060506 3300042436 Bacteria 1103
343 Ga0466969_0003711 3300044656 Bacteria 8117
344 Ga0466972_0102408 3300044658 Bacteria 1354
345 Ga0466977_0050561 3300044666 Bacteria 2717
346 Ga0466965_0021920 3300044683 Bacteria 3078
347 Ga0466961_0038597 3300044693 Bacteria 3063
348 Ga0466961_0130117 3300044693 Bacteria 1577
349 Ga0466963_0065627 3300044694 Bacteria 2434
350 Ga0466963_0141087 3300044694 Bacteria 1669
351 Ga0466964_0018742 3300044706 Bacteria 2658
352 Ga0453684_0173631 3300044712 Unclassified 2537
353 Ga0466971_0029308 3300044719 Bacteria 2461
354 Ga0466968_0008464 3300044735 Bacteria 3940
355 Ga0466970_0034865 3300044765 Bacteria 2665
356 Ga0466957_0022105 3300044842 Bacteria 3750
357 Ga0466959_0004841 3300045049 Bacteria 9099
358 Ga0451576_0592097 3300045051 Unclassified 1165
359 Ga0466967_0136051 3300045976 Bacteria 2285
360 Ga0466967_0153394 3300045976 Bacteria 2155
361 Ga0495627_017751 3300046453 Bacteria 2411
362 Ga0495651_0205669 3300046462 Bacteria 1374
363 Ga0495580_0117849 3300046472 Bacteria 1844
364 Ga0495607_0000009 3300046501 Bacteria 216674
365 Ga0495583_0000717 3300046506 Bacteria 42460
366 Ga0495606_0137613 3300046507 Bacteria 1445
367 Ga0495606_0181263 3300046507 Bacteria 1214
368 Ga0495606_0258880 3300046507 Bacteria 961
369 Ga0495610_0056417 3300046512 Bacteria 1888
370 Ga0495618_0179740 3300046514 Bacteria 1345
371 Ga0495630_0156064 3300046517 Bacteria 1737
372 Ga0495643_0050212 3300046522 Bacteria 2247
373 Ga0495648_0145897 3300046524 Bacteria 1240
374 Ga0495666_0052310 3300046526 Bacteria 1961
375 Ga0495622_0144649 3300046557 Bacteria 1078
376 Ga0495625_0021280 3300046660 Bacteria 4996
377 Ga0495659_0030541 3300046664 Bacteria 1876
378 Ga0495588_0036000 3300046674 Bacteria 2510
379 Ga0495658_0202746 3300046683 Bacteria 1237
380 Ga0495669_0053347 3300046684 Bacteria 1818
381 Ga0495624_0063408 3300046690 Bacteria 2310
382 Ga0495649_0000314 3300046694 Bacteria 42490
383 Ga0495589_0011344 3300046794 Bacteria 4627
384 Ga0495676_0112825 3300047321 Bacteria 1991
385 Ga0495673_0065011 3300047469 Bacteria 1550
386 Ga0495686_0011776 3300047472 Bacteria 6154
387 Ga0495686_0023514 3300047472 Bacteria 4063
388 Ga0495686_0078543 3300047472 Bacteria 2020
389 Ga0495686_0182829 3300047472 Bacteria 1214
390 Ga0495614_0139618 3300048089 Bacteria 1076
391 Ga0496100_0234856 3300048903 Bacteria 1350
392 Ga0496101_0058312 3300048904 Bacteria 2795
393 Ga0496102_0012252 3300048905 Bacteria 7415
394 Ga0496102_0012763 3300048905 Bacteria 7274
395 Ga0496104_0155348 3300048907 Bacteria 2196
396 Ga0496105_0000790 3300048908 Bacteria 21423
397 Ga0496106_0066630 3300048909 Bacteria 2743
398 Ga0496109_0122326 3300048912 Bacteria 2425
399 Ga0496112_0019288 3300048915 Bacteria 6434
400 Ga0496112_0031926 3300048915 Bacteria 5111
401 Ga0496116_0233773 3300048919 Bacteria 929
402 Ga0496117_0012798 3300048920 Bacteria 7359
403 Ga0496117_0036162 3300048920 Bacteria 3699
404 Ga0496118_0040344 3300048921 Bacteria 3713
405 Ga0496118_0144780 3300048921 Bacteria 1499
406 Ga0496119_0024134 3300048922 Bacteria 4287
407 Ga0496120_0022917 3300048923 Bacteria 3918
408 Ga0496121_0000411 3300048924 Bacteria 85089
409 Ga0496121_0055087 3300048924 Bacteria 3316
410 Ga0496121_0073406 3300048924 Bacteria 2742
411 Ga0496122_0001568 3300048925 Bacteria 36083
412 Ga0496122_0246894 3300048925 Bacteria 1002
413 Ga0496123_0047565 3300048926 Bacteria 2896
414 Ga0496123_0050655 3300048926 Bacteria 2772
415 Ga0496123_0057246 3300048926 Bacteria 2539
416 Ga0496123_0094178 3300048926 Bacteria 1766
417 Ga0496124_0000103 3300048927 Bacteria 179162
418 Ga0496124_0073935 3300048927 Bacteria 2818
419 Ga0496124_0260769 3300048927 Bacteria 1275
420 Ga0496125_0000096 3300048928 Bacteria 205618
421 Ga0496125_0007183 3300048928 Bacteria 11877
422 Ga0496125_0065871 3300048928 Bacteria 2866
423 Ga0496125_0165897 3300048928 Bacteria 1492
424 Ga0496126_0037790 3300048929 Bacteria 4499
425 Ga0496126_0128917 3300048929 Bacteria 2187
426 Ga0496126_0280201 3300048929 Bacteria 1381
427 Ga0501292_021878 3300049515 Bacteria 1038
428 Ga0501031_0014987 3300049568 Bacteria 5035
429 Ga0501033_0004879 3300049570 Bacteria 10682
430 Ga0501033_0058405 3300049570 Bacteria 2849
431 Ga0501036_0180281 3300049572 Bacteria 1778
432 Ga0501036_0248306 3300049572 Bacteria 1491
433 Ga0501037_0020544 3300049573 Bacteria 4876
434 Ga0501038_0110435 3300049574 Bacteria 2278
435 Ga0501038_0143544 3300049574 Bacteria 1951
436 Ga0501039_0093863 3300049575 Bacteria 2338
437 Ga0501040_0248122 3300049576 Bacteria 1269
438 Ga0501041_0023036 3300049577 Bacteria 3732
439 Ga0501041_0226566 3300049577 Unclassified 1173
440 Ga0501042_0014603 3300049578 Bacteria 5363
441 Ga0501043_0000010 3300049579 Bacteria 206374
442 Ga0501043_0018580 3300049579 Bacteria 5454
443 Ga0501046_0000132 3300049580 Bacteria 79506
444 Ga0501046_0018894 3300049580 Bacteria 5723
445 Ga0501046_0196255 3300049580 Bacteria 1503
446 Ga0501047_0000026 3300049581 Bacteria 225296
447 Ga0501047_0014502 3300049581 Bacteria 7495
448 Ga0501047_0240048 3300049581 Bacteria 1663
449 Ga0501048_0004378 3300049582 Bacteria 10754
450 Ga0501069_0021855 3300049585 Bacteria 3475
451 Ga0501070_0014719 3300049586 Bacteria 6582
452 Ga0501071_0020424 3300049587 Bacteria 4603
453 Ga0501072_0112212 3300049588 Bacteria 2170
454 Ga0501073_0024666 3300049589 Bacteria 4318
455 Ga0501074_0012356 3300049590 Bacteria 6206
456 Ga0501075_0006802 3300049591 Bacteria 7895
457 Ga0501075_0178689 3300049591 Bacteria 1619
458 Ga0501076_0026517 3300049592 Bacteria 4489
459 Ga0501077_0006311 3300049593 Bacteria 7258
460 Ga0501079_0190267 3300049741 Bacteria 1601
461 Ga0501080_0033943 3300049742 Bacteria 4763
462 Ga0501080_0083357 3300049742 Bacteria 2970
463 Ga0501081_0006019 3300049743 Bacteria 7852
464 Ga0501083_0025828 3300049744 Bacteria 4065
465 Ga0501083_0044964 3300049744 Bacteria 2989
466 Ga0501035_0005340 3300049822 Bacteria 12155
467 Ga0501035_0009676 3300049822 Bacteria 8965
468 Ga0501035_0020261 3300049822 Bacteria 6107
469 Ga0501035_0081875 3300049822 Bacteria 2848
470 Ga0501035_0097279 3300049822 Bacteria 2585
471 Ga0501035_0351181 3300049822 Bacteria 1234
472 Ga0501044_0000045 3300049823 Bacteria 148353
473 Ga0501044_0002588 3300049823 Bacteria 20571
474 Ga0501044_0006513 3300049823 Bacteria 12897
475 Ga0501044_0047658 3300049823 Bacteria 4432
476 Ga0501045_0031359 3300049824 Bacteria 3850
477 nmdc:mga03683_47662_c1 3300050489 Bacteria 1779
478 nmdc:mga00v17_4655_c1 3300050491 Bacteria 7162
479 nmdc:mga00v17_79237_c1 3300050491 Bacteria 2048
480 nmdc:mga0k408_72145_c1 3300050493 Bacteria 2016
481 nmdc:mga0k408_72849_c1 3300050493 Bacteria 2006
482 nmdc:mga0k408_732_c1 3300050493 Bacteria 18001
483 nmdc:mga06z11_6883_c1 3300050494 Bacteria 4651
484 nmdc:mga04h51_9874_c1 3300050495 Bacteria 2604
485 nmdc:mga07m45_115432_c1 3300050496 Bacteria 1548
486 nmdc:mga07m45_41566_c2 3300050496 Bacteria 1962
487 nmdc:mga07m45_434_c1 3300050496 Bacteria 17366
488 nmdc:mga07m45_58899_c1 3300050496 Bacteria 2173
489 nmdc:mga07m45_7666_c2 3300050496 Bacteria 4409
490 nmdc:mga07m45_85874_c1 3300050496 Bacteria 1800
491 nmdc:mga05p37_257551_c1 3300050507 Bacteria 2090
492 nmdc:mga05p37_544779_c1 3300050507 Bacteria 1322
493 nmdc:mga09592_243045_c1 3300050508 Bacteria 1560
494 nmdc:mga0qj67_213992_c1 3300050509 Unclassified 1565
495 nmdc:mga06r32_200802_c1 3300050510 Bacteria 1982
496 nmdc:mga08y16_133626_c1 3300050511 Bacteria 2579
497 nmdc:mga08y16_327220_c1 3300050511 Bacteria 1577
498 nmdc:mga08y16_99332_c1 3300050511 Bacteria 3030
499 nmdc:mga0n895_212075_c1 3300050512 Bacteria 1967
500 nmdc:mga0n895_42366_c1 3300050512 Unclassified 4429
501 nmdc:mga0rr50_43187_c1 3300050513 Bacteria 3297
502 nmdc:mga0rr50_9819_c1 3300050513 Bacteria 6043
503 nmdc:mga08x19_48994_c1 3300050514 Bacteria 2708
504 nmdc:mga0a205_295290_c1 3300050515 Bacteria 1494
505 nmdc:mga0a205_90499_c1 3300050515 Bacteria 2957
506 Ga0500635_0000007 3300053080 Bacteria 169379
507 Ga0500578_0070276 3300053086 Bacteria 2232
508 Ga0500608_003695 3300053122 Bacteria 5793
509 Ga0500652_014906 3300053131 Bacteria 2793
510 Ga0500590_008941 3300053148 Bacteria 5018
511 Ga0500634_0003843 3300053161 Bacteria 6800
512 Ga0500645_008026 3300053730 Bacteria 3636
513 Ga0500587_001147 3300053739 Bacteria 3654
514 Ga0501084_0052194 3300054114 Bacteria 3422
515 Ga0501084_0126630 3300054114 Bacteria 2149
516 Ga0501082_0012399 3300060353 Bacteria 7325
517 Ga0501082_0041812 3300060353 Bacteria 3952
518 Ga0466962_0006170 3300061719 Bacteria 5758
519 Ga0466962_0014661 3300061719 Bacteria 3777
520 2587755846 2585428062 Bacteria 6842168
521 2597027977 2596583598 Bacteria 5251611
522 2599444650 2599185178 Bacteria 5365746
523 2599904616 2599185292 Bacteria 6290804
524 2643861163 2643221569 Bacteria 6064337
525 2643983375 2643221594 Bacteria 5811388
526 2644124511 2643221621 Bacteria 6212786
527 2644301853 2643221654 Bacteria 5273570
528 2644303081 2643221654 Bacteria 5273570
529 2723876961 2721755763 Bacteria 4464185
530 2738719626 2738541277 Bacteria 7458140
531 2738879939 2738541307 Bacteria 8606193
532 2739278825 2738543019 Bacteria 7459457
533 2809032707 2808606395 Bacteria 6020352
534 2819599379 2818991446 Bacteria 7757362
535 2855735068 2855730933 Bacteria 7047938
536 2855770852 2855767633 Bacteria 7049357
537 2857540527 2857537821 Bacteria 5248181
538 2857543445 2857542790 Bacteria 5326616
539 2857578061 2857576091 Bacteria 5465855
540 2858951313 2858950400 Bacteria 6783797
541 2881418242 2881412998 Bacteria 6492157
542 2885266427 2885266251 Bacteria 4796748
543 2899925881 2899924645 Bacteria 7487985
544 2900580032 2900577576 Bacteria 5438534
545 2904481506 2904479285 Bacteria 5073931
546 2904544300 2904541872 Bacteria 8915136
547 2928041731 2928037797 Bacteria 7273642
548 2928049295 2928044640 Bacteria 7271509
549 2928052097 2928051484 Bacteria 7773759
550 2928059788 2928058823 Bacteria 5520022
551 2928065223 2928064002 Bacteria 7419480
552 2929162128 2929160207 Bacteria 9075316
553 2941485357
554 Ga0209258_100977
555 JGI24741J21665_1000196
556 JGI24740J21852_10001061
557 JGI24740J21852_10002700
558 JGI25156J39149_1000060
559 JGI25156J39149_1000175
560 JGI25156J39149_1001779
561 JGI25156J39149_1015016
562 JGI25154J39366_1000129
563 JGI25154J39366_1002385
564 JGI25157J39369_1000029
565 JGI25151J46595_10000137
566 JGI25151J46595_10017086
567 rootH1_10009484
568 rootH1_10017612
569 rootH1_10017613
570 rootL2_10012237
571 rootL2_10022997
572 rootH1_10002261
573 rootH1_10024154
574 rootH1_10036886
575 Ga0055538_1004414
576 Ga0055539_1000081
577 Ga0055539_1000118
578 Ga0055539_1000739
579 Ga0055533_1000010
580 Ga0055533_1000421
581 Ga0055532_1000048
582 Ga0055525_1000415
583 Ga0055525_1001267
584 Ga0055535_1000035
585 Ga0055535_1000076
586 Ga0055535_1000282
587 Ga0055542_1000009
588 Ga0055542_1000724
589 Ga0055529_1000101
590 Ga0055529_1000491
591 Ga0055529_1000810
592 Ga0055530_10038791
593 Ga0055541_1005019
594 Ga0065704_10180567
595 Ga0065712_10000421
596 Ga0065715_10089174
597 Ga0070658_10012827
598 Ga0070658_10015843
599 Ga0070658_10059809
600 Ga0070658_10265108
601 Ga0070690_100002935
602 Ga0070670_100000191
603 Ga0070670_100447113
604 Ga0068869_100129884
605 Ga0070680_100002615
606 Ga0070682_100011098
607 Ga0068868_100147211
608 Ga0070660_100097816
609 Ga0070660_100165026
610 Ga0070691_10014998
611 Ga0070661_100000370
612 Ga0070661_100003806
613 Ga0070675_100275892
614 Ga0070671_100069322
615 Ga0070673_100061586
616 Ga0070659_100014344
617 Ga0070659_100037086
618 Ga0070659_100081203
619 Ga0070667_100233470
620 Ga0070700_100006624
621 Ga0070700_100244083
622 Ga0070694_100429510
623 Ga0070663_100000024
624 Ga0070662_100026282
625 Ga0070681_10018223
626 Ga0070681_10250641
627 Ga0068867_100053336
628 Ga0070685_10059674
629 Ga0070679_100044982
630 Ga0068853_100103887
631 Ga0068853_100132157
632 Ga0068853_100154419
633 Ga0070686_100018817
634 Ga0070686_100258625
635 Ga0070695_100005789
636 Ga0070696_100014843
637 Ga0070665_100241768
638 Ga0068855_100011241
639 Ga0068855_100026695
640 Ga0068855_100129025
641 Ga0068855_100325121
642 Ga0068855_100448804
643 Ga0070664_100000022
644 Ga0070664_100016829
645 Ga0070664_100087322
646 Ga0068857_100013429
647 Ga0068857_100026215
648 Ga0068854_100000336
649 Ga0068854_100004203
650 Ga0068856_100000049
651 Ga0068856_100005146
652 Ga0068856_100043152
653 Ga0068852_100241544
654 Ga0068859_100190878
655 Ga0068864_100168402
656 Ga0068861_100088990
657 Ga0068851_10015896
658 Ga0068858_100376284
659 Ga0068860_100031835
660 Ga0068860_100186892
661 Ga0068860_100699781
662 Ga0075368_10008857
663 Ga0075363_100016697
664 Ga0075364_10017700
665 Ga0075362_10000766
666 Ga0075362_10087878
667 Ga0075367_10004452
668 Ga0075369_10011434
669 Ga0097621_100028288
670 Ga0097621_100110020
671 Ga0075370_10002838
672 Ga0075370_10030368
673 Ga0075370_10082268
674 Ga0075370_10083411
675 Ga0075431_100097251
676 Ga0075434_100083473
677 Ga0075429_100025185
678 Ga0075436_100145184
679 Ga0097620_100190880
680 Ga0075435_100048279
681 Ga0105244_10037149
682 Ga0105244_10094820
683 Ga0105240_10004619
684 Ga0111539_10779798
685 Ga0114129_10128608
686 Ga0105243_10088049
687 Ga0105243_10312764
688 Ga0105243_10586954
689 Ga0105241_10101372
690 Ga0105242_10038051
691 Ga0105242_10231446
692 Ga0105242_10448650
693 Ga0105237_10003650
694 Ga0105237_10168917
695 Ga0105238_10139183
696 Ga0105239_10009773
697 Ga0105239_10299098
698 Ga0105246_10398089
699 Ga0157373_10003934
700 Ga0157373_10008463
701 Ga0157373_10014407
702 Ga0157371_10000089
703 Ga0157371_10046793
704 Ga0157370_10000002
705 Ga0157370_10401717
706 Ga0157369_10118903
707 Ga0157378_10097698
708 Ga0157378_10161718
709 Ga0163162_10028713
710 Ga0163162_10071540
711 Ga0163162_10324365
712 Ga0157372_10000149
713 Ga0157372_10049517
714 Ga0182008_10003693
715 Ga0182008_10007653
716 Ga0157379_10679621
717 Ga0157376_10122106
718 Ga0157376_10215195
719 Ga0182006_1000377
720 Ga0182006_1075038
721 Ga0182007_10000908
722 Ga0182007_10022146
723 Ga0182005_1014683
724 Ga0182005_1063363
725 Ga0183362_10003
726 Ga0163161_10015879
727 Ga0154015_1172573
728 Ga0213872_10000453
729 Ga0213872_10011834
730 Ga0209784_100024
731 Ga0209784_100435
732 Ga0209784_100569
733 Ga0209566_100018
734 Ga0209566_100251
735 Ga0209674_100003
736 Ga0209674_100046
737 Ga0209674_100135
738 Ga0209672_100240
739 Ga0209672_100758
740 Ga0209672_108688
741 Ga0209147_100008
742 Ga0209563_100039
743 Ga0209563_100049
744 Ga0207427_100158
745 Ga0209258_100009
746 Ga0209258_100013
747 Ga0209258_100258
748 Ga0209258_106522
749 Ga0207425_1017760
750 Ga0209646_1000027
751 Ga0209646_1000111
752 Ga0209026_1000054
753 Ga0209026_1001871
754 Ga0209677_100024
755 Ga0209677_100050
756 Ga0209677_100105
757 Ga0209677_103608
758 Ga0209677_113063
759 Ga0209148_1000007
760 Ga0209148_1000019
761 Ga0209148_1005859
762 Ga0209148_1005868
763 Ga0209759_1000043
764 Ga0209759_1000332
765 Ga0209759_1001539
766 Ga0209759_1002064
767 Ga0209759_1002811
768 Ga0209759_1010060
769 Ga0209759_1011351
770 Ga0209455_1000042
771 Ga0209455_1000092
772 Ga0209455_1000633
773 Ga0209675_1010854
774 Ga0209676_1003758
775 Ga0209025_1000071
776 Ga0209025_1000103
777 Ga0209050_1001375
778 Ga0209050_1005800
779 Ga0209051_1003989
780 Ga0209051_1010722
781 Ga0209051_1019840
782 Ga0207697_10015389
783 Ga0207688_10057786
784 Ga0207680_10028941
785 Ga0207645_10001291
786 Ga0207645_10010246
787 Ga0207645_10165844
788 Ga0207705_10153277
789 Ga0207705_10280311
790 Ga0207705_10338454
791 Ga0207707_10007506
792 Ga0207707_10012673
793 Ga0207707_10247021
794 Ga0207695_10004317
795 Ga0207695_10105882
796 Ga0207671_10005337
797 Ga0207671_10029727
798 Ga0207660_10013064
799 Ga0207657_10015456
800 Ga0207649_10000075
801 Ga0207649_10012065
802 Ga0207652_10020384
803 Ga0207694_10143364
804 Ga0207650_10000481
805 Ga0207650_10374097
806 Ga0207690_10014714
807 Ga0207690_10015398
808 Ga0207690_10024118
809 Ga0207706_10003089
810 Ga0207706_10213386
811 Ga0207686_10301970
812 Ga0207709_10029741
813 Ga0207704_10101586
814 Ga0207689_10065574
815 Ga0207679_10000004
816 Ga0207679_10003108
817 Ga0207679_10026687
818 Ga0207667_10009547
819 Ga0207667_10112449
820 Ga0207667_10633030
821 Ga0207651_10287938
822 Ga0207640_10000084
823 Ga0207640_10000813
824 Ga0207658_10069918
825 Ga0207639_10073483
826 Ga0207639_10183328
827 Ga0207678_10000012
828 Ga0207678_10113555
829 Ga0207702_10000020
830 Ga0207702_10000376
831 Ga0207702_10073956
832 Ga0207648_10073696
833 Ga0207676_10146287
834 Ga0207674_10020737
835 Ga0207674_10159803
836 Ga0207675_100041680
837 Ga0207675_100115734
838 Ga0207683_10056649
839 Ga0207698_10289346
840 Ga0207698_10419538
841 Ga0209371_1009365
842 Ga0209813_10002599
843 Ga0207428_10022387
844 Ga0265336_10000006
845 Ga0307515_10038038
846 Ga0307515_10038364
847 Ga0307515_10054315
848 Ga0265324_10000948
849 Ga0265324_10049089
850 Ga0268256_1021889
851 Ga0307512_10129262
852 Ga0265327_10000748
853 Ga0265327_10005915
854 Ga0307513_10071884
855 Ga0307513_10075651
856 Ga0307509_10011687
857 Ga0307509_10039549
858 Ga0307509_10235110
859 Ga0307508_10022566
860 Ga0307508_10373639
861 Ga0265314_10007298
862 Ga0265342_10000556
863 Ga0307516_10001684
864 Ga0307516_10015404
865 Ga0307405_10008752
866 Ga0307410_10355463
867 Ga0307412_10000137
868 Ga0307409_100294099
869 Ga0307414_10074888
870 Ga0307411_10205503
871 Ga0307510_10051446
872 Ga0307510_10117817
873 Ga0373926_0065629
874 Ga0373944_0071823
875 Ga0373956_0082462
876 Ga0373943_0076309
877 Ga0373931_0004078
878 Ga0373931_0068160
879 Ga0373931_0115098
880 Ga0373935_0084354
881 Ga0373925_0174032
882 Ga0395899_0139509
883 Ga0395900_0028049
884 Ga0395900_0074412
885 Ga0395900_0306437
886 Ga0395898_0051972
887 Ga0395898_0343898
888 Ga0395905_0016422
889 Ga0395905_0095557
890 Ga0395905_0269758
891 Ga0395901_0034836
892 Ga0436361_0837231
893 Ga0436361_1222882
894 Ga0439436_0055451
895 Ga0439435_0060506
896 Ga0466969_0003711
897 Ga0466972_0102408
898 Ga0466977_0050561
899 Ga0466965_0021920
900 Ga0466961_0038597
901 Ga0466961_0130117
902 Ga0466963_0065627
903 Ga0466963_0141087
904 Ga0466964_0018742
905 Ga0453684_0173631
906 Ga0466971_0029308
907 Ga0466968_0008464
908 Ga0466970_0034865
909 Ga0466957_0022105
910 Ga0466959_0004841
911 Ga0451576_0592097
912 Ga0466967_0136051
913 Ga0466967_0153394
914 Ga0495627_017751
915 Ga0495651_0205669
916 Ga0495580_0117849
917 Ga0495607_0000009
918 Ga0495583_0000717
919 Ga0495606_0137613
920 Ga0495606_0181263
921 Ga0495606_0258880
922 Ga0495610_0056417
923 Ga0495618_0179740
924 Ga0495630_0156064
925 Ga0495643_0050212
926 Ga0495648_0145897
927 Ga0495666_0052310
928 Ga0495622_0144649
929 Ga0495625_0021280
930 Ga0495659_0030541
931 Ga0495588_0036000
932 Ga0495658_0202746
933 Ga0495669_0053347
934 Ga0495624_0063408
935 Ga0495649_0000314
936 Ga0495589_0011344
937 Ga0495676_0112825
938 Ga0495673_0065011
939 Ga0495686_0011776
940 Ga0495686_0023514
941 Ga0495686_0078543
942 Ga0495686_0182829
943 Ga0495614_0139618
944 Ga0496100_0234856
945 Ga0496101_0058312
946 Ga0496102_0012252
947 Ga0496102_0012763
948 Ga0496104_0155348
949 Ga0496105_0000790
950 Ga0496106_0066630
951 Ga0496109_0122326
952 Ga0496112_0019288
953 Ga0496112_0031926
954 Ga0496116_0233773
955 Ga0496117_0012798
956 Ga0496117_0036162
957 Ga0496118_0040344
958 Ga0496118_0144780
959 Ga0496119_0024134
960 Ga0496120_0022917
961 Ga0496121_0000411
962 Ga0496121_0055087
963 Ga0496121_0073406
964 Ga0496122_0001568
965 Ga0496122_0246894
966 Ga0496123_0047565
967 Ga0496123_0050655
968 Ga0496123_0057246
969 Ga0496123_0094178
970 Ga0496124_0000103
971 Ga0496124_0073935
972 Ga0496124_0260769
973 Ga0496125_0000096
974 Ga0496125_0007183
975 Ga0496125_0065871
976 Ga0496125_0165897
977 Ga0496126_0037790
978 Ga0496126_0128917
979 Ga0496126_0280201
980 Ga0501292_021878
981 Ga0501031_0014987
982 Ga0501033_0004879
983 Ga0501033_0058405
984 Ga0501036_0180281
985 Ga0501036_0248306
986 Ga0501037_0020544
987 Ga0501038_0110435
988 Ga0501038_0143544
989 Ga0501039_0093863
990 Ga0501040_0248122
991 Ga0501041_0023036
992 Ga0501041_0226566
993 Ga0501042_0014603
994 Ga0501043_0000010
995 Ga0501043_0018580
996 Ga0501046_0000132
997 Ga0501046_0018894
998 Ga0501046_0196255
999 Ga0501047_0000026
1000 Ga0501047_0014502
1001 Ga0501047_0240048
1002 Ga0501048_0004378
1003 Ga0501069_0021855
1004 Ga0501070_0014719
1005 Ga0501071_0020424
1006 Ga0501072_0112212
1007 Ga0501073_0024666
1008 Ga0501074_0012356
1009 Ga0501075_0006802
1010 Ga0501075_0178689
1011 Ga0501076_0026517
1012 Ga0501077_0006311
1013 Ga0501079_0190267
1014 Ga0501080_0033943
1015 Ga0501080_0083357
1016 Ga0501081_0006019
1017 Ga0501083_0025828
1018 Ga0501083_0044964
1019 Ga0501035_0005340
1020 Ga0501035_0009676
1021 Ga0501035_0020261
1022 Ga0501035_0081875
1023 Ga0501035_0097279
1024 Ga0501035_0351181
1025 Ga0501044_0000045
1026 Ga0501044_0002588
1027 Ga0501044_0006513
1028 Ga0501044_0047658
1029 Ga0501045_0031359
1030 nmdc:mga03683_47662_c1
1031 nmdc:mga00v17_4655_c1
1032 nmdc:mga00v17_79237_c1
1033 nmdc:mga0k408_72145_c1
1034 nmdc:mga0k408_72849_c1
1035 nmdc:mga0k408_732_c1
1036 nmdc:mga06z11_6883_c1
1037 nmdc:mga04h51_9874_c1
1038 nmdc:mga07m45_115432_c1
1039 nmdc:mga07m45_41566_c2
1040 nmdc:mga07m45_434_c1
1041 nmdc:mga07m45_58899_c1
1042 nmdc:mga07m45_7666_c2
1043 nmdc:mga07m45_85874_c1
1044 nmdc:mga05p37_257551_c1
1045 nmdc:mga05p37_544779_c1
1046 nmdc:mga09592_243045_c1
1047 nmdc:mga0qj67_213992_c1
1048 nmdc:mga06r32_200802_c1
1049 nmdc:mga08y16_133626_c1
1050 nmdc:mga08y16_327220_c1
1051 nmdc:mga08y16_99332_c1
1052 nmdc:mga0n895_212075_c1
1053 nmdc:mga0n895_42366_c1
1054 nmdc:mga0rr50_43187_c1
1055 nmdc:mga0rr50_9819_c1
1056 nmdc:mga08x19_48994_c1
1057 nmdc:mga0a205_295290_c1
1058 nmdc:mga0a205_90499_c1
1059 Ga0500635_0000007
1060 Ga0500578_0070276
1061 Ga0500608_003695
1062 Ga0500652_014906
1063 Ga0500590_008941
1064 Ga0500634_0003843
1065 Ga0500645_008026
1066 Ga0500587_001147
1067 Ga0501084_0052194
1068 Ga0501084_0126630
1069 Ga0501082_0012399
1070 Ga0501082_0041812
1071 Ga0466962_0006170
1072 Ga0466962_0014661
1073 2587755846
1074 2597027977
1075 2599444650
1076 2599904616
1077 2643861163
1078 2643983375
1079 2644124511
1080 2644301853
1081 2644303081
1082 2723876961
1083 2738719626
1084 2738879939
1085 2739278825
1086 2809032707
1087 2819599379
1088 2855735068
1089 2855770852
1090 2857540527
1091 2857543445
1092 2857578061
1093 2858951313
1094 2881418242
1095 2885266427
1096 2899925881
1097 2900580032
1098 2904481506
1099 2904544300
1100 2928041731
1101 2928049295
1102 2928052097
1103 2928059788
1104 2928065223
1105 2929162128
1106 2941485357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

41

297

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5625 13 248
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.5366 11 238
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5334 11 248
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.5248 6 239
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.503 11 266
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7929 14 265 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7886 11 261 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7859 13 262 1.10.3470.10
af_P0AFS1_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7848 13 262 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7764 11 261 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A658JGY6-F1-model_v4 deleted 0.9827 10 212
AF-A0A7C3K2Y9-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9756 10 230 GO:0005886
GO:0015658
AF-A0A4Q4WGE8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9747 40 200 GO:0005886
GO:0015658
AF-A0A7V3LIA4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9746 15 209 GO:0005886
GO:0015658
AF-A0A2R8C120-F1-model_v4 High-affinity branched-chain amino acid transport system permease protein LivH 0.9721 5 196 GO:0005886
GO:0015658

Map