F462871

General Info

Members Datasets Scaffolds Average Seq Length
553 213 553 324

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10087878|Ga0207648_100878783
Length 371
Sequence MCGIGVVSRQLAIVSSRPRPPQYCELISGSAVADVWMQKRWSMLGWLKAPFDSVLVISFGGPQGLDDIRPFLANVLRGRRVSPERVEEVAHHYELFGGVSPITSITRRQAEGLRLRLEAAGHSLPVYVGMRNWHPLLPDTLRNMHAAGLRHAIGFITAAQHSYSSCQQYRENVTAARVELRNNGEDVDVTFVGSWFEHPLFIAANAAHVMGALARLPEGARAAARLVCTAHSIPIQMAQASRYEAQLKESARLVAEEVGMHDWALVYQSRSGRPGDPWLEPDVCDYLRRERAAGLQAAVLCPIGFVSDHIEVLYDLDREAADVSREIGLLLARAESVNDDPRFLDMMADVVLRTIKRHEQGRPLPLTAAAR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
157 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
158 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 0
Rhizoplane 0.54
Rhizosphere 96.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3115889 2162886007 Unclassified 1950
2 JGI24751J29686_10018045 3300002459 Bacteria 1459
3 JGI25406J46586_10000419 3300003203 Bacteria 19512
4 Ga0065704_10004376 3300005289 Bacteria 5688
5 Ga0065712_10001274 3300005290 Bacteria 8076
6 Ga0065715_10013853 3300005293 Bacteria 2202
7 Ga0065715_10015399 3300005293 Unclassified 2765
8 Ga0065715_10103262 3300005293 Unclassified 3046
9 Ga0065715_10165631 3300005293 Bacteria 1589
10 Ga0065707_10001808 3300005295 Bacteria 6679
11 Ga0065707_10114722 3300005295 Unclassified 2289
12 Ga0070676_10009842 3300005328 Bacteria 5171
13 Ga0070676_10097243 3300005328 Bacteria 1813
14 Ga0070676_10174796 3300005328 Unclassified 1392
15 Ga0070683_100006888 3300005329 Bacteria 9548
16 Ga0070683_100012012 3300005329 Bacteria 7512
17 Ga0070690_100002535 3300005330 Bacteria 9830
18 Ga0070670_100011516 3300005331 Bacteria 7566
19 Ga0070670_100034960 3300005331 Unclassified 4325
20 Ga0070670_100176958 3300005331 Unclassified 1852
21 Ga0070677_10013120 3300005333 Bacteria 2891
22 Ga0070677_10017079 3300005333 Bacteria 2592
23 Ga0068869_100004047 3300005334 Bacteria 9069
24 Ga0068869_100008308 3300005334 Bacteria 6688
25 Ga0068869_100028707 3300005334 Bacteria 3891
26 Ga0068869_100088545 3300005334 Bacteria 2324
27 Ga0068869_100147466 3300005334 Bacteria 1822
28 Ga0068869_100163743 3300005334 Bacteria 1733
29 Ga0068869_100172445 3300005334 Bacteria 1691
30 Ga0068869_100198419 3300005334 Bacteria 1581
31 Ga0070680_100108341 3300005336 Bacteria 2311
32 Ga0070680_100203484 3300005336 Bacteria 1670
33 Ga0070680_100251269 3300005336 Bacteria 1495
34 Ga0070680_100369689 3300005336 Bacteria 1220
35 Ga0068868_100317641 3300005338 Bacteria 1326
36 Ga0070689_100004481 3300005340 Bacteria 9446
37 Ga0070689_100009330 3300005340 Bacteria 6956
38 Ga0070689_100012629 3300005340 Bacteria 6090
39 Ga0070691_10029367 3300005341 Bacteria 2571
40 Ga0070687_100073024 3300005343 Bacteria 1848
41 Ga0070687_100177566 3300005343 Unclassified 1273
42 Ga0070668_100212667 3300005347 Bacteria 1591
43 Ga0070668_100313630 3300005347 Unclassified 1318
44 Ga0070669_100000432 3300005353 Bacteria 32010
45 Ga0070669_100015719 3300005353 Bacteria 5398
46 Ga0070669_100033302 3300005353 Bacteria 3726
47 Ga0070669_100041323 3300005353 Unclassified 3353
48 Ga0070669_100105067 3300005353 Bacteria 2136
49 Ga0070669_100113828 3300005353 Bacteria 2056
50 Ga0070675_100000109 3300005354 Bacteria 47889
51 Ga0070675_100010250 3300005354 Bacteria 7312
52 Ga0070675_100029687 3300005354 Unclassified 4411
53 Ga0070675_100033933 3300005354 Bacteria 4139
54 Ga0070671_100007712 3300005355 Bacteria 8598
55 Ga0070671_100046552 3300005355 Bacteria 3607
56 Ga0070674_100009659 3300005356 Bacteria 5787
57 Ga0070674_100088033 3300005356 Unclassified 2234
58 Ga0070674_100119491 3300005356 Bacteria 1949
59 Ga0070673_100000486 3300005364 Bacteria 21134
60 Ga0070673_100026385 3300005364 Bacteria 4290
61 Ga0070673_100055049 3300005364 Bacteria 3133
62 Ga0070673_100081855 3300005364 Bacteria 2619
63 Ga0070673_100327996 3300005364 Bacteria 1353
64 Ga0070688_100001310 3300005365 Bacteria 12411
65 Ga0070688_100023382 3300005365 Unclassified 3634
66 Ga0070659_100164303 3300005366 Bacteria 1816
67 Ga0070659_100324656 3300005366 Unclassified 1287
68 Ga0070667_100020613 3300005367 Bacteria 5472
69 Ga0070667_100376699 3300005367 Bacteria 1289
70 Ga0070703_10027233 3300005406 Bacteria 1703
71 Ga0070701_10001780 3300005438 Bacteria 8135
72 Ga0070701_10021737 3300005438 Bacteria 3067
73 Ga0070701_10050933 3300005438 Bacteria 2146
74 Ga0070701_10066463 3300005438 Bacteria 1916
75 Ga0070701_10096996 3300005438 Bacteria 1626
76 Ga0070705_100000366 3300005440 Bacteria 26473
77 Ga0070705_100234836 3300005440 Bacteria 1278
78 Ga0070700_100040517 3300005441 Bacteria 2852
79 Ga0070700_100067086 3300005441 Unclassified 2279
80 Ga0070700_100077374 3300005441 Unclassified 2139
81 Ga0070700_100097524 3300005441 Bacteria 1930
82 Ga0070700_100122214 3300005441 Bacteria 1746
83 Ga0070700_100215905 3300005441 Bacteria 1356
84 Ga0070694_100014180 3300005444 Unclassified 4987
85 Ga0070694_100248969 3300005444 Bacteria 1343
86 Ga0070708_100102137 3300005445 Bacteria 2627
87 Ga0070708_100128766 3300005445 Archaea 2342
88 Ga0070663_100010296 3300005455 Bacteria 5827
89 Ga0070663_100022604 3300005455 Bacteria 4207
90 Ga0070678_100111301 3300005456 Bacteria 2142
91 Ga0070678_100243134 3300005456 Bacteria 1506
92 Ga0070678_100316311 3300005456 Bacteria 1332
93 Ga0070662_100059024 3300005457 Unclassified 2794
94 Ga0070681_10025530 3300005458 Bacteria 5943
95 Ga0070681_10394414 3300005458 Bacteria 1295
96 Ga0068867_100016050 3300005459 Bacteria 5317
97 Ga0068867_100025615 3300005459 Bacteria 4233
98 Ga0068867_100082925 3300005459 Bacteria 2419
99 Ga0068867_100217160 3300005459 Bacteria 1539
100 Ga0070685_10065705 3300005466 Bacteria 2135
101 Ga0070707_100040857 3300005468 Bacteria 4438
102 Ga0070707_100067550 3300005468 Unclassified 3439
103 Ga0070698_100008063 3300005471 Bacteria 11394
104 Ga0070698_100373254 3300005471 Bacteria 1359
105 Ga0070699_100015391 3300005518 Bacteria 6574
106 Ga0070699_100042556 3300005518 Unclassified 3931
107 Ga0070699_100264644 3300005518 Unclassified 1538
108 Ga0070699_100421729 3300005518 Bacteria 1208
109 Ga0070679_100247742 3300005530 Bacteria 1738
110 Ga0070697_100021645 3300005536 Bacteria 5096
111 Ga0070672_100003914 3300005543 Bacteria 9702
112 Ga0070672_100008279 3300005543 Bacteria 7106
113 Ga0070672_100015999 3300005543 Bacteria 5360
114 Ga0070672_100024609 3300005543 Bacteria 4453
115 Ga0070672_100096494 3300005543 Bacteria 2392
116 Ga0070672_100169999 3300005543 Bacteria 1812
117 Ga0070672_100193374 3300005543 Bacteria 1699
118 Ga0070672_100340655 3300005543 Bacteria 1277
119 Ga0070686_100067381 3300005544 Unclassified 2332
120 Ga0070686_100106270 3300005544 Unclassified 1905
121 Ga0070686_100127192 3300005544 Bacteria 1757
122 Ga0070695_100000102 3300005545 Bacteria 37412
123 Ga0070696_100134165 3300005546 Unclassified 1804
124 Ga0070693_100032298 3300005547 Bacteria 2877
125 Ga0070665_100134590 3300005548 Bacteria 2473
126 Ga0070704_100036486 3300005549 Bacteria 3351
127 Ga0070664_100020927 3300005564 Bacteria 5390
128 Ga0070664_100027053 3300005564 Bacteria 4764
129 Ga0070664_100027251 3300005564 Bacteria 4747
130 Ga0068857_100009649 3300005577 Bacteria 8386
131 Ga0068857_100028877 3300005577 Bacteria 4894
132 Ga0068857_100091113 3300005577 Bacteria 2729
133 Ga0068854_100040865 3300005578 Bacteria 3274
134 Ga0070702_100018990 3300005615 Bacteria 3575
135 Ga0070702_100064147 3300005615 Bacteria 2148
136 Ga0068852_100131624 3300005616 Bacteria 2304
137 Ga0068859_100000459 3300005617 Bacteria 40396
138 Ga0068859_100006392 3300005617 Bacteria 11956
139 Ga0068859_100041433 3300005617 Bacteria 4625
140 Ga0068859_100085150 3300005617 Bacteria 3206
141 Ga0068859_100632179 3300005617 Bacteria 1163
142 Ga0068864_100015505 3300005618 Bacteria 6337
143 Ga0068864_100022648 3300005618 Bacteria 5269
144 Ga0068864_100030452 3300005618 Unclassified 4574
145 Ga0068864_100054827 3300005618 Bacteria 3441
146 Ga0068861_100005774 3300005719 Bacteria 8398
147 Ga0068861_100033621 3300005719 Bacteria 3785
148 Ga0068861_100168189 3300005719 Unclassified 1815
149 Ga0068870_10002247 3300005840 Bacteria 8022
150 Ga0068870_10020503 3300005840 Bacteria 3220
151 Ga0068870_10041255 3300005840 Bacteria 2397
152 Ga0068870_10053893 3300005840 Bacteria 2138
153 Ga0068863_100016660 3300005841 Bacteria 7052
154 Ga0068863_100037284 3300005841 Bacteria 4629
155 Ga0068863_100084580 3300005841 Bacteria 3006
156 Ga0068858_100008010 3300005842 Bacteria 10180
157 Ga0068858_100138947 3300005842 Unclassified 2280
158 Ga0068858_100140746 3300005842 Bacteria 2265
159 Ga0068860_100088839 3300005843 Bacteria 2942
160 Ga0068860_100150549 3300005843 Unclassified 2240
161 Ga0068862_100004233 3300005844 Bacteria 12157
162 Ga0068862_100108706 3300005844 Bacteria 2432
163 Ga0068862_100145040 3300005844 Bacteria 2109
164 Ga0081539_10000093 3300005985 Bacteria 207314
165 Ga0081539_10001997 3300005985 Bacteria 30967
166 Ga0081539_10008783 3300005985 Bacteria 8660
167 Ga0075365_10003211 3300006038 Bacteria 8360
168 Ga0075364_10016517 3300006051 Bacteria 4593
169 Ga0075367_10005389 3300006178 Bacteria 6346
170 Ga0075367_10210203 3300006178 Bacteria 1216
171 Ga0075366_10030064 3300006195 Bacteria 3192
172 Ga0075366_10064074 3300006195 Bacteria 2185
173 Ga0097621_100018708 3300006237 Bacteria 5300
174 Ga0075370_10060517 3300006353 Bacteria 2157
175 Ga0068871_100119157 3300006358 Bacteria 2228
176 Ga0075428_100001255 3300006844 Bacteria 27133
177 Ga0075428_100004233 3300006844 Bacteria 15796
178 Ga0075428_100023809 3300006844 Bacteria 6776
179 Ga0075428_100030417 3300006844 Bacteria 5971
180 Ga0075428_100034854 3300006844 Bacteria 5550
181 Ga0075428_100082065 3300006844 Unclassified 3518
182 Ga0075428_100156350 3300006844 Bacteria 2477
183 Ga0075428_100196420 3300006844 Bacteria 2182
184 Ga0075428_100291906 3300006844 Bacteria 1754
185 Ga0075428_100429726 3300006844 Bacteria 1415
186 Ga0075430_100001090 3300006846 Bacteria 21567
187 Ga0075430_100002851 3300006846 Bacteria 14473
188 Ga0075430_100005495 3300006846 Bacteria 10709
189 Ga0075430_100009021 3300006846 Bacteria 8429
190 Ga0075430_100033567 3300006846 Bacteria 4356
191 Ga0075430_100062744 3300006846 Bacteria 3121
192 Ga0075431_100004139 3300006847 Bacteria 14158
193 Ga0075431_100013770 3300006847 Bacteria 8168
194 Ga0075431_100080482 3300006847 Bacteria 3363
195 Ga0075431_100122105 3300006847 Bacteria 2688
196 Ga0075431_100240950 3300006847 Bacteria 1840
197 Ga0075433_10005324 3300006852 Bacteria 10093
198 Ga0075433_10019804 3300006852 Bacteria 5615
199 Ga0075433_10021868 3300006852 Bacteria 5366
200 Ga0075433_10033893 3300006852 Unclassified 4381
201 Ga0075433_10052443 3300006852 Bacteria 3554
202 Ga0075434_100001711 3300006871 Bacteria 18790
203 Ga0075434_100001730 3300006871 Bacteria 18736
204 Ga0075434_100030412 3300006871 Bacteria 5317
205 Ga0075434_100046243 3300006871 Unclassified 4319
206 Ga0075434_100166817 3300006871 Unclassified 2222
207 Ga0075434_100490664 3300006871 Bacteria 1249
208 Ga0075429_100001936 3300006880 Bacteria 17171
209 Ga0075429_100011739 3300006880 Bacteria 7598
210 Ga0075429_100013624 3300006880 Bacteria 7054
211 Ga0075429_100041462 3300006880 Bacteria 4009
212 Ga0075429_100066927 3300006880 Unclassified 3127
213 Ga0068865_100036934 3300006881 Bacteria 3296
214 Ga0068865_100105801 3300006881 Unclassified 2067
215 Ga0068865_100127457 3300006881 Bacteria 1902
216 Ga0097620_100000459 3300006931 Bacteria 40396
217 Ga0097620_100006392 3300006931 Bacteria 11956
218 Ga0097620_100041434 3300006931 Bacteria 4625
219 Ga0097620_100085145 3300006931 Bacteria 3206
220 Ga0097620_100632126 3300006931 Bacteria 1163
221 Ga0075435_100004581 3300007076 Bacteria 9517
222 Ga0075435_100028340 3300007076 Bacteria 4391
223 Ga0075435_100108242 3300007076 Unclassified 2309
224 Ga0075435_100245507 3300007076 Unclassified 1523
225 Ga0105240_10530511 3300009093 Bacteria 1305
226 Ga0111539_10000040 3300009094 Bacteria 136085
227 Ga0111539_10000465 3300009094 Bacteria 50988
228 Ga0111539_10002493 3300009094 Bacteria 24401
229 Ga0111539_10004729 3300009094 Bacteria 17791
230 Ga0111539_10006884 3300009094 Bacteria 14603
231 Ga0111539_10007204 3300009094 Bacteria 14254
232 Ga0111539_10013195 3300009094 Bacteria 10331
233 Ga0111539_10014889 3300009094 Bacteria 9695
234 Ga0111539_10017801 3300009094 Bacteria 8798
235 Ga0111539_10076513 3300009094 Bacteria 3940
236 Ga0111539_10192573 3300009094 Bacteria 2379
237 Ga0111539_10240544 3300009094 Bacteria 2107
238 Ga0111539_10255928 3300009094 Unclassified 2039
239 Ga0111539_10756038 3300009094 Bacteria 1131
240 Ga0105245_10016854 3300009098 Bacteria 6379
241 Ga0114129_10002401 3300009147 Bacteria 26029
242 Ga0114129_10004302 3300009147 Bacteria 20120
243 Ga0114129_10005462 3300009147 Bacteria 17965
244 Ga0114129_10006077 3300009147 Bacteria 17112
245 Ga0114129_10019676 3300009147 Bacteria 9609
246 Ga0114129_10027295 3300009147 Bacteria 8084
247 Ga0114129_10143778 3300009147 Bacteria 3268
248 Ga0114129_10166422 3300009147 Bacteria 3008
249 Ga0114129_10548740 3300009147 Bacteria 1503
250 Ga0114129_10580200 3300009147 Bacteria 1455
251 Ga0105243_10026115 3300009148 Bacteria 4469
252 Ga0105243_10026216 3300009148 Bacteria 4461
253 Ga0105243_10061941 3300009148 Bacteria 2994
254 Ga0105243_10555964 3300009148 Bacteria 1097
255 Ga0105242_10096002 3300009176 Bacteria 2503
256 Ga0105248_10014948 3300009177 Bacteria 8545
257 Ga0105248_10040061 3300009177 Bacteria 5251
258 Ga0105248_10133973 3300009177 Unclassified 2796
259 Ga0105249_10006847 3300009553 Bacteria 9940
260 Ga0105249_10026619 3300009553 Bacteria 5215
261 Ga0105249_10278407 3300009553 Bacteria 1670
262 Ga0157374_10097598 3300013296 Bacteria 2812
263 Ga0157374_10297420 3300013296 Bacteria 1596
264 Ga0157378_10391080 3300013297 Unclassified 1368
265 Ga0157378_10670008 3300013297 Bacteria 1055
266 Ga0163162_10005469 3300013306 Bacteria 12276
267 Ga0157375_10009065 3300013308 Bacteria 8710
268 Ga0163163_10077478 3300014325 Bacteria 3320
269 Ga0157380_10000369 3300014326 Bacteria 27154
270 Ga0157380_10019490 3300014326 Bacteria 5056
271 Ga0157380_10064470 3300014326 Bacteria 2941
272 Ga0157380_10076442 3300014326 Bacteria 2725
273 Ga0157380_10183238 3300014326 Unclassified 1842
274 Ga0157380_10215393 3300014326 Unclassified 1715
275 Ga0157380_10219053 3300014326 Bacteria 1701
276 Ga0157380_10294881 3300014326 Unclassified 1491
277 Ga0157377_10020689 3300014745 Bacteria 3451
278 Ga0157377_10024599 3300014745 Bacteria 3202
279 Ga0157377_10048258 3300014745 Bacteria 2388
280 Ga0157377_10118619 3300014745 Bacteria 1600
281 Ga0157377_10205602 3300014745 Bacteria 1252
282 Ga0157379_10014028 3300014968 Bacteria 7022
283 Ga0157376_10048059 3300014969 Bacteria 3526
284 Ga0157376_10120808 3300014969 Bacteria 2321
285 Ga0163161_10047090 3300017792 Bacteria 3113
286 Ga0163161_10087708 3300017792 Unclassified 2299
287 Ga0207697_10015924 3300025315 Bacteria 3102
288 Ga0207682_10000139 3300025893 Bacteria 32685
289 Ga0207682_10004632 3300025893 Bacteria 5714
290 Ga0207682_10008731 3300025893 Bacteria 4009
291 Ga0207688_10001936 3300025901 Bacteria 11088
292 Ga0207688_10003546 3300025901 Bacteria 8516
293 Ga0207688_10030191 3300025901 Bacteria 2988
294 Ga0207688_10143818 3300025901 Bacteria 1405
295 Ga0207680_10069597 3300025903 Unclassified 2175
296 Ga0207647_10130937 3300025904 Bacteria 1474
297 Ga0207645_10002241 3300025907 Bacteria 15394
298 Ga0207645_10009375 3300025907 Bacteria 6774
299 Ga0207645_10018389 3300025907 Bacteria 4597
300 Ga0207645_10195299 3300025907 Unclassified 1330
301 Ga0207643_10001178 3300025908 Bacteria 15524
302 Ga0207643_10006620 3300025908 Bacteria 6214
303 Ga0207643_10008746 3300025908 Bacteria 5433
304 Ga0207643_10035502 3300025908 Bacteria 2796
305 Ga0207662_10005189 3300025918 Bacteria 6914
306 Ga0207662_10044721 3300025918 Bacteria 2615
307 Ga0207662_10214707 3300025918 Bacteria 1250
308 Ga0207649_10113047 3300025920 Bacteria 1818
309 Ga0207652_10104468 3300025921 Bacteria 2506
310 Ga0207681_10019134 3300025923 Bacteria 4324
311 Ga0207681_10026181 3300025923 Bacteria 3760
312 Ga0207681_10029582 3300025923 Bacteria 3560
313 Ga0207681_10061657 3300025923 Unclassified 2579
314 Ga0207681_10066903 3300025923 Bacteria 2489
315 Ga0207681_10103711 3300025923 Bacteria 2056
316 Ga0207681_10127225 3300025923 Bacteria 1878
317 Ga0207681_10221775 3300025923 Bacteria 1463
318 Ga0207650_10048273 3300025925 Unclassified 3140
319 Ga0207650_10092664 3300025925 Unclassified 2311
320 Ga0207659_10000617 3300025926 Bacteria 21204
321 Ga0207659_10031802 3300025926 Bacteria 3616
322 Ga0207659_10093995 3300025926 Bacteria 2245
323 Ga0207659_10154396 3300025926 Bacteria 1796
324 Ga0207659_10256143 3300025926 Bacteria 1422
325 Ga0207659_10314136 3300025926 Bacteria 1291
326 Ga0207700_10039336 3300025928 Unclassified 3442
327 Ga0207644_10070550 3300025931 Bacteria 2554
328 Ga0207690_10135769 3300025932 Unclassified 1806
329 Ga0207706_10004608 3300025933 Bacteria 12938
330 Ga0207706_10008838 3300025933 Bacteria 9271
331 Ga0207706_10101887 3300025933 Unclassified 2526
332 Ga0207706_10137874 3300025933 Bacteria 2146
333 Ga0207706_10217965 3300025933 Bacteria 1672
334 Ga0207709_10016583 3300025935 Bacteria 4097
335 Ga0207670_10004689 3300025936 Bacteria 7412
336 Ga0207670_10013796 3300025936 Bacteria 4778
337 Ga0207670_10049236 3300025936 Bacteria 2817
338 Ga0207669_10003433 3300025937 Bacteria 6849
339 Ga0207704_10009137 3300025938 Bacteria 4769
340 Ga0207704_10035062 3300025938 Bacteria 2870
341 Ga0207704_10044601 3300025938 Bacteria 2628
342 Ga0207704_10104335 3300025938 Bacteria 1898
343 Ga0207691_10005343 3300025940 Bacteria 12400
344 Ga0207691_10007757 3300025940 Bacteria 10334
345 Ga0207691_10015851 3300025940 Bacteria 7163
346 Ga0207691_10027869 3300025940 Bacteria 5293
347 Ga0207691_10117911 3300025940 Bacteria 2355
348 Ga0207691_10120332 3300025940 Bacteria 2328
349 Ga0207691_10128683 3300025940 Bacteria 2238
350 Ga0207711_10137987 3300025941 Bacteria 2192
351 Ga0207711_10206169 3300025941 Bacteria 1795
352 Ga0207689_10001767 3300025942 Bacteria 20394
353 Ga0207689_10032790 3300025942 Bacteria 4318
354 Ga0207689_10075257 3300025942 Bacteria 2775
355 Ga0207689_10095531 3300025942 Bacteria 2441
356 Ga0207689_10095537 3300025942 Bacteria 2441
357 Ga0207661_10025066 3300025944 Unclassified 4530
358 Ga0207679_10013217 3300025945 Bacteria 5408
359 Ga0207679_10048707 3300025945 Unclassified 3087
360 Ga0207679_10199730 3300025945 Bacteria 1669
361 Ga0207651_10002809 3300025960 Bacteria 8373
362 Ga0207651_10007566 3300025960 Bacteria 5795
363 Ga0207651_10047572 3300025960 Bacteria 2893
364 Ga0207651_10088650 3300025960 Bacteria 2256
365 Ga0207651_10238769 3300025960 Bacteria 1480
366 Ga0207712_10007908 3300025961 Bacteria 6718
367 Ga0207640_10256497 3300025981 Bacteria 1360
368 Ga0207658_10048860 3300025986 Bacteria 3105
369 Ga0207658_10401637 3300025986 Bacteria 1205
370 Ga0207677_10093036 3300026023 Bacteria 2197
371 Ga0207703_10015787 3300026035 Bacteria 5890
372 Ga0207703_10042575 3300026035 Bacteria 3643
373 Ga0207703_10222426 3300026035 Bacteria 1689
374 Ga0207678_10034790 3300026067 Bacteria 4388
375 Ga0207708_10009001 3300026075 Bacteria 7390
376 Ga0207708_10019636 3300026075 Bacteria 5096
377 Ga0207708_10033389 3300026075 Bacteria 3910
378 Ga0207708_10104785 3300026075 Unclassified 2191
379 Ga0207708_10137666 3300026075 Bacteria 1913
380 Ga0207708_10175154 3300026075 Bacteria 1701
381 Ga0207708_10220470 3300026075 Bacteria 1519
382 Ga0207641_10052416 3300026088 Bacteria 3455
383 Ga0207641_10118438 3300026088 Bacteria 2359
384 Ga0207641_10271722 3300026088 Bacteria 1591
385 Ga0207648_10000375 3300026089 Bacteria 49109
386 Ga0207648_10011159 3300026089 Bacteria 8476
387 Ga0207648_10014276 3300026089 Bacteria 7342
388 Ga0207648_10087878 3300026089 Bacteria 2713
389 Ga0207648_10100505 3300026089 Bacteria 2534
390 Ga0207676_10270722 3300026095 Bacteria 1538
391 Ga0207674_10038952 3300026116 Bacteria 4929
392 Ga0207674_10042147 3300026116 Bacteria 4717
393 Ga0207674_10149243 3300026116 Unclassified 2295
394 Ga0207674_10179429 3300026116 Bacteria 2069
395 Ga0207675_100005097 3300026118 Bacteria 12640
396 Ga0207675_100005161 3300026118 Bacteria 12572
397 Ga0207675_100080696 3300026118 Bacteria 3050
398 Ga0207683_10028347 3300026121 Bacteria 4841
399 Ga0207683_10101372 3300026121 Bacteria 2570
400 Ga0207683_10102431 3300026121 Bacteria 2557
401 Ga0207683_10102820 3300026121 Bacteria 2552
402 Ga0207683_10167334 3300026121 Unclassified 1990
403 Ga0207428_10000750 3300027907 Bacteria 37156
404 Ga0207428_10001319 3300027907 Bacteria 26409
405 Ga0207428_10003324 3300027907 Bacteria 15634
406 Ga0207428_10005991 3300027907 Bacteria 11256
407 Ga0207428_10006349 3300027907 Bacteria 10935
408 Ga0207428_10013109 3300027907 Bacteria 7258
409 Ga0207428_10032221 3300027907 Bacteria 4313
410 Ga0268265_10000263 3300028380 Bacteria 59820
411 Ga0268265_10016194 3300028380 Bacteria 5118
412 Ga0268265_10108634 3300028380 Unclassified 2259
413 Ga0268265_10217867 3300028380 Bacteria 1668
414 Ga0268265_10252515 3300028380 Bacteria 1563
415 Ga0268265_10336916 3300028380 Bacteria 1372
416 Ga0268264_10002400 3300028381 Bacteria 16495
417 Ga0268264_10049927 3300028381 Bacteria 3482
418 Ga0268264_10092345 3300028381 Bacteria 2613
419 Ga0268264_10126791 3300028381 Unclassified 2257
420 Ga0307408_100000559 3300031548 Bacteria 32129
421 Ga0307407_10013328 3300031903 Bacteria 3986
422 Ga0307409_100034105 3300031995 Bacteria 3713
423 Ga0307416_100014688 3300032002 Bacteria 5380
424 Ga0307416_100171469 3300032002 Bacteria 2020
425 Ga0307416_100351958 3300032002 Bacteria 1491
426 Ga0307416_100516167 3300032002 Bacteria 1262
427 Ga0307411_10026784 3300032005 Bacteria 3476
428 Ga0307411_10106555 3300032005 Bacteria 1995
429 Ga0307415_100042982 3300032126 Bacteria 3011
430 Ga0373932_0015725 3300035112 Bacteria 1922
431 Ga0373931_0153463 3300035691 Bacteria 1344
432 Ga0373933_0041138 3300035724 Bacteria 2727
433 Ga0373947_0034276 3300035725 Bacteria 3002
434 Ga0373947_0191510 3300035725 Unclassified 1335
435 Ga0373937_0006141 3300036401 Bacteria 10343
436 Ga0373925_0035988 3300037068 Bacteria 3654
437 Ga0451807_2469453 3300041486 Bacteria 1443
438 Ga0439450_005826 3300042008 Bacteria 2189
439 Ga0439450_013275 3300042008 Bacteria 1652
440 Ga0450923_005171 3300042125 Unclassified 2091
441 Ga0439464_0005119 3300042439 Bacteria 3374
442 Ga0453683_0214270 3300044673 Bacteria 1224
443 Ga0451576_0024372 3300045051 Bacteria 6535
444 Ga0451576_0029521 3300045051 Bacteria 5867
445 Ga0451576_0159236 3300045051 Bacteria 2355
446 Ga0451576_0361296 3300045051 Bacteria 1521
447 Ga0495603_0084178 3300046455 Bacteria 1862
448 Ga0495629_0003222 3300046459 Bacteria 12351
449 Ga0495582_0033481 3300046473 Bacteria 2825
450 Ga0495582_0144120 3300046473 Unclassified 1351
451 Ga0495584_0122747 3300046491 Bacteria 1316
452 Ga0495594_0087102 3300046499 Unclassified 1747
453 Ga0495643_0003874 3300046522 Bacteria 10750
454 Ga0495642_0013249 3300046528 Bacteria 3187
455 Ga0495609_0035857 3300046538 Unclassified 2243
456 Ga0495621_0000764 3300046539 Bacteria 8145
457 Ga0495622_0088430 3300046557 Bacteria 1424
458 Ga0495633_0070797 3300046558 Bacteria 1627
459 Ga0495659_0026780 3300046664 Unclassified 1984
460 Ga0495659_0039453 3300046664 Bacteria 1679
461 Ga0495659_0079583 3300046664 Bacteria 1241
462 Ga0495588_0001691 3300046674 Bacteria 9392
463 Ga0495670_0052328 3300046691 Bacteria 2044
464 Ga0495636_0006616 3300047318 Bacteria 4556
465 Ga0495676_0041004 3300047321 Bacteria 3815
466 Ga0496109_0239044 3300048912 Bacteria 1709
467 Ga0496113_0255267 3300048916 Bacteria 1400
468 Ga0501034_0056321 3300049571 Bacteria 3956
469 Ga0501039_0006794 3300049575 Bacteria 8701
470 Ga0501040_0044695 3300049576 Unclassified 3020
471 Ga0501040_0129415 3300049576 Bacteria 1774
472 Ga0501041_0004230 3300049577 Bacteria 8311
473 Ga0501042_0004487 3300049578 Bacteria 8905
474 Ga0501072_0109737 3300049588 Unclassified 2196
475 Ga0501075_0007297 3300049591 Bacteria 7665
476 Ga0501075_0127704 3300049591 Bacteria 1936
477 Ga0501076_0040803 3300049592 Unclassified 3648
478 Ga0501217_012511 3300049661 Bacteria 1891
479 Ga0501217_025215 3300049661 Unclassified 1429
480 Ga0501079_0095319 3300049741 Bacteria 2306
481 Ga0501080_0149697 3300049742 Bacteria 2158
482 Ga0501081_0042538 3300049743 Unclassified 3113
483 Ga0501083_0360123 3300049744 Bacteria 946
484 Ga0501044_0026417 3300049823 Bacteria 6144
485 Ga0501045_0010502 3300049824 Bacteria 6486
486 Ga0501045_0115477 3300049824 Bacteria 1991
487 nmdc:mga03683_4517_c1 3300050489 Bacteria 4629
488 nmdc:mga00v17_140757_c1 3300050491 Bacteria 1547
489 nmdc:mga00v17_1939_c1 3300050491 Bacteria 10684
490 nmdc:mga0yw44_98960_c1 3300050492 Bacteria 1855
491 nmdc:mga0k408_29825_c1 3300050493 Bacteria 3107
492 nmdc:mga06z11_35931_c1 3300050494 Bacteria 2442
493 nmdc:mga06z11_43569_c1 3300050494 Bacteria 2259
494 nmdc:mga05p37_108082_c1 3300050507 Unclassified 3422
495 nmdc:mga05p37_1148_c1 3300050507 Bacteria 30482
496 nmdc:mga05p37_163460_c1 3300050507 Bacteria 2718
497 nmdc:mga05p37_320977_c1 3300050507 Unclassified 1833
498 nmdc:mga05p37_33553_c1 3300050507 Bacteria 6287
499 nmdc:mga05p37_341376_c1 3300050507 Unclassified 1766
500 nmdc:mga05p37_3595_c1 3300050507 Bacteria 18111
501 nmdc:mga05p37_400215_c1 3300050507 Bacteria 1603
502 nmdc:mga05p37_433259_c1 3300050507 Bacteria 1527
503 nmdc:mga05p37_4471_c1 3300050507 Bacteria 16336
504 nmdc:mga05p37_552323_c1 3300050507 Bacteria 1311
505 nmdc:mga09592_115130_c1 3300050508 Unclassified 2308
506 nmdc:mga09592_24167_c1 3300050508 Bacteria 5024
507 nmdc:mga09592_59957_c1 3300050508 Unclassified 3217
508 nmdc:mga09592_69785_c1 3300050508 Bacteria 2981
509 nmdc:mga09592_86496_c1 3300050508 Unclassified 2675
510 nmdc:mga0qj67_276313_c1 3300050509 Bacteria 1362
511 nmdc:mga0qj67_30242_c1 3300050509 Bacteria 4213
512 nmdc:mga0qj67_480202_c1 3300050509 Bacteria 1000
513 nmdc:mga0qj67_4864_c2 3300050509 Bacteria 9271
514 nmdc:mga0qj67_70020_c1 3300050509 Bacteria 2798
515 nmdc:mga06r32_349650_c1 3300050510 Bacteria 1463
516 nmdc:mga06r32_39152_c1 3300050510 Unclassified 4497
517 nmdc:mga06r32_81377_c1 3300050510 Bacteria 3154
518 nmdc:mga06r32_85540_c1 3300050510 Unclassified 3075
519 nmdc:mga08y16_105820_c1 3300050511 Bacteria 2929
520 nmdc:mga08y16_1149_c1 3300050511 Bacteria 26073
521 nmdc:mga08y16_14292_c1 3300050511 Bacteria 8357
522 nmdc:mga08y16_156_c1 3300050511 Bacteria 59323
523 nmdc:mga08y16_178577_c1 3300050511 Bacteria 2205
524 nmdc:mga08y16_25196_c1 3300050511 Bacteria 6272
525 nmdc:mga08y16_339523_c1 3300050511 Unclassified 1544
526 nmdc:mga08y16_355173_c1 3300050511 Unclassified 1505
527 nmdc:mga08y16_40753_c1 3300050511 Bacteria 4866
528 nmdc:mga08y16_639_c1 3300050511 Bacteria 32927
529 nmdc:mga08y16_83_c1 3300050511 Bacteria 80182
530 nmdc:mga0n895_130606_c1 3300050512 Unclassified 2537
531 nmdc:mga0n895_137637_c1 3300050512 Bacteria 2469
532 nmdc:mga0n895_300185_c1 3300050512 Unclassified 1628
533 nmdc:mga0n895_31123_c1 3300050512 Bacteria 5106
534 nmdc:mga0n895_3603_c1 3300050512 Bacteria 12518
535 nmdc:mga0n895_487445_c1 3300050512 Bacteria 1243
536 nmdc:mga0n895_51493_c1 3300050512 Bacteria 4039
537 nmdc:mga0rr50_206474_c1 3300050513 Unclassified 1617
538 nmdc:mga0rr50_407615_c1 3300050513 Bacteria 1149
539 nmdc:mga0rr50_5035_c1 3300050513 Bacteria 7833
540 nmdc:mga0rr50_773_c1 3300050513 Bacteria 17222
541 nmdc:mga0a205_229967_c1 3300050515 Bacteria 1738
542 nmdc:mga0a205_231649_c1 3300050515 Bacteria 1730
543 nmdc:mga0a205_38252_c1 3300050515 Bacteria 4615
544 nmdc:mga0a205_6894_c1 3300050515 Bacteria 10270
545 nmdc:mga0a205_9084_c1 3300050515 Bacteria 9068
546 Ga0500556_0016051 3300053104 Bacteria 2323
547 Ga0501084_0079406 3300054114 Bacteria 2750
548 Ga0590071_000024 3300059421 Bacteria 39075
549 Ga0590074_000167 3300059423 Bacteria 8029
550 Ga0590075_000297 3300059424 Bacteria 14053
551 Ga0590077_000948 3300059426 Bacteria 7399
552 Ga0590077_006313 3300059426 Bacteria 2431
553 Ga0501082_0027190 3300060353 Unclassified 4927

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006852 Ga0075433_10033893 Ga0075433_100338932 283
2 3300005444 Ga0070694_100248969 Ga0070694_1002489692 287
3 3300006846 Ga0075430_100062744 Ga0075430_1000627442 287
4 3300006880 Ga0075429_100001936 Ga0075429_1000019368 287
5 3300049744 Ga0501083_0360123 Ga0501083_0360123_21_929 289
6 3300050509 nmdc:mga0qj67_480202_c1 nmdc:mga0qj67_480202_c1_47_940 294
7 3300006844 Ga0075428_100429726 Ga0075428_1004297261 296
8 3300005334 Ga0068869_100163743 Ga0068869_1001637432 299
9 3300005617 Ga0068859_100632179 Ga0068859_1006321792 299
10 3300006931 Ga0097620_100632126 Ga0097620_1006321262 299
11 3300025942 Ga0207689_10095537 Ga0207689_100955374 299
12 3300005334 Ga0068869_100198419 Ga0068869_1001984193 300
13 3300005353 Ga0070669_100105067 Ga0070669_1001050673 300
14 3300005840 Ga0068870_10053893 Ga0068870_100538932 300
15 3300025923 Ga0207681_10127225 Ga0207681_101272253 300
16 3300025942 Ga0207689_10095531 Ga0207689_100955312 300
17 3300026121 Ga0207683_10102820 Ga0207683_101028202 300
18 3300028380 Ga0268265_10336916 Ga0268265_103369162 300
19 3300005334 Ga0068869_100147466 Ga0068869_1001474662 301
20 3300005354 Ga0070675_100029687 Ga0070675_1000296874 301
21 3300014326 Ga0157380_10019490 Ga0157380_100194907 301
22 3300025908 Ga0207643_10006620 Ga0207643_100066206 301
23 3300025926 Ga0207659_10154396 Ga0207659_101543961 301
24 3300026035 Ga0207703_10222426 Ga0207703_102224262 301
25 3300050508 nmdc:mga09592_86496_c1 nmdc:mga09592_86496_c1_403_1323 301
26 3300025904 Ga0207647_10130937 Ga0207647_101309372 302
27 3300005356 Ga0070674_100088033 Ga0070674_1000880331 304
28 3300050507 nmdc:mga05p37_400215_c1 nmdc:mga05p37_400215_c1_285_1205 304
29 3300005347 Ga0070668_100313630 Ga0070668_1003136302 305
30 3300005353 Ga0070669_100033302 Ga0070669_1000333024 305
31 3300005353 Ga0070669_100041323 Ga0070669_1000413233 305
32 3300005364 Ga0070673_100327996 Ga0070673_1003279962 305
33 3300005455 Ga0070663_100022604 Ga0070663_1000226042 305
34 3300005543 Ga0070672_100193374 Ga0070672_1001933742 305
35 3300005544 Ga0070686_100106270 Ga0070686_1001062702 305
36 3300025901 Ga0207688_10143818 Ga0207688_101438182 305
37 3300025903 Ga0207680_10069597 Ga0207680_100695973 305
38 3300025923 Ga0207681_10061657 Ga0207681_100616572 305
39 3300025923 Ga0207681_10221775 Ga0207681_102217752 305
40 3300025933 Ga0207706_10101887 Ga0207706_101018872 305
41 3300025940 Ga0207691_10128683 Ga0207691_101286832 305
42 3300026067 Ga0207678_10034790 Ga0207678_100347903 305
43 3300059421 Ga0590071_000024 Ga0590071_000024_26728_27663 305
44 3300059423 Ga0590074_000167 Ga0590074_000167_2452_3387 305
45 3300059424 Ga0590075_000297 Ga0590075_000297_11608_12543 305
46 3300059426 Ga0590077_000948 Ga0590077_000948_2277_3212 305
47 3300054114 Ga0501084_0079406 Ga0501084_0079406_1126_2058 308
48 3300005336 Ga0070680_100108341 Ga0070680_1001083412 310
49 3300005543 Ga0070672_100340655 Ga0070672_1003406552 310
50 3300026075 Ga0207708_10220470 Ga0207708_102204702 310
51 3300027907 Ga0207428_10006349 Ga0207428_100063493 311
52 3300005328 Ga0070676_10174796 Ga0070676_101747962 312
53 3300005333 Ga0070677_10013120 Ga0070677_100131202 312
54 3300006847 Ga0075431_100013770 Ga0075431_1000137703 312
55 3300009094 Ga0111539_10255928 Ga0111539_102559282 312
56 3300009177 Ga0105248_10133973 Ga0105248_101339733 312
57 3300025893 Ga0207682_10008731 Ga0207682_100087313 312
58 3300025907 Ga0207645_10195299 Ga0207645_101952991 312
59 3300025937 Ga0207669_10003433 Ga0207669_100034335 312
60 3300005441 Ga0070700_100215905 Ga0070700_1002159051 314
61 3300005468 Ga0070707_100040857 Ga0070707_1000408573 314
62 3300006844 Ga0075428_100001255 Ga0075428_10000125519 315
63 3300006846 Ga0075430_100002851 Ga0075430_1000028515 315
64 3300006847 Ga0075431_100122105 Ga0075431_1001221051 315
65 3300027907 Ga0207428_10003324 Ga0207428_1000332410 315
66 3300031548 Ga0307408_100000559 Ga0307408_1000005598 315
67 3300032002 Ga0307416_100014688 Ga0307416_1000146884 315
68 3300032005 Ga0307411_10106555 Ga0307411_101065552 315
69 3300035725 Ga0373947_0034276 Ga0373947_0034276_1979_2971 316
70 3300050507 nmdc:mga05p37_433259_c1 nmdc:mga05p37_433259_c1_427_1419 316
71 3300050515 nmdc:mga0a205_229967_c1 nmdc:mga0a205_229967_c1_733_1716 316
72 3300005290 Ga0065712_10001274 Ga0065712_100012744 317
73 3300005295 Ga0065707_10114722 Ga0065707_101147221 317
74 3300005440 Ga0070705_100234836 Ga0070705_1002348361 317
75 3300005840 Ga0068870_10041255 Ga0068870_100412552 317
76 3300006051 Ga0075364_10016517 Ga0075364_100165172 317
77 3300006178 Ga0075367_10005389 Ga0075367_100053892 317
78 3300006178 Ga0075367_10210203 Ga0075367_102102032 317
79 3300006195 Ga0075366_10030064 Ga0075366_100300642 317
80 3300006353 Ga0075370_10060517 Ga0075370_100605172 317
81 3300006846 Ga0075430_100009021 Ga0075430_1000090213 317
82 3300006847 Ga0075431_100080482 Ga0075431_1000804823 317
83 3300006871 Ga0075434_100490664 Ga0075434_1004906642 317
84 3300006880 Ga0075429_100013624 Ga0075429_1000136246 317
85 3300009094 Ga0111539_10004729 Ga0111539_1000472919 317
86 3300009094 Ga0111539_10006884 Ga0111539_100068847 317
87 3300009094 Ga0111539_10240544 Ga0111539_102405443 317
88 3300009147 Ga0114129_10027295 Ga0114129_100272953 317
89 3300009147 Ga0114129_10580200 Ga0114129_105802002 317
90 3300013296 Ga0157374_10097598 Ga0157374_100975984 317
91 3300014745 Ga0157377_10024599 Ga0157377_100245992 317
92 3300014745 Ga0157377_10205602 Ga0157377_102056022 317
93 3300014969 Ga0157376_10120808 Ga0157376_101208082 317
94 3300025918 Ga0207662_10214707 Ga0207662_102147072 317
95 3300025933 Ga0207706_10137874 Ga0207706_101378742 317
96 3300025960 Ga0207651_10007566 Ga0207651_100075666 317
97 3300025986 Ga0207658_10401637 Ga0207658_104016372 317
98 3300026118 Ga0207675_100080696 Ga0207675_1000806963 317
99 3300027907 Ga0207428_10013109 Ga0207428_100131097 317
100 3300027907 Ga0207428_10032221 Ga0207428_100322213 317
101 3300046664 Ga0495659_0039453 Ga0495659_0039453_256_1221 317
102 3300048912 Ga0496109_0239044 Ga0496109_0239044_38_1000 317
103 3300048916 Ga0496113_0255267 Ga0496113_0255267_206_1168 317
104 3300050489 nmdc:mga03683_4517_c1 nmdc:mga03683_4517_c1_1743_2702 317
105 3300050491 nmdc:mga00v17_140757_c1 nmdc:mga00v17_140757_c1_424_1383 317
106 3300050491 nmdc:mga00v17_1939_c1 nmdc:mga00v17_1939_c1_3566_4525 317
107 3300050493 nmdc:mga0k408_29825_c1 nmdc:mga0k408_29825_c1_999_1958 317
108 3300050494 nmdc:mga06z11_35931_c1 nmdc:mga06z11_35931_c1_279_1238 317
109 3300050494 nmdc:mga06z11_43569_c1 nmdc:mga06z11_43569_c1_704_1663 317
110 3300050507 nmdc:mga05p37_33553_c1 nmdc:mga05p37_33553_c1_4898_5866 317
111 3300050507 nmdc:mga05p37_341376_c1 nmdc:mga05p37_341376_c1_473_1435 317
112 3300050508 nmdc:mga09592_69785_c1 nmdc:mga09592_69785_c1_1380_2345 317
113 3300050511 nmdc:mga08y16_178577_c1 nmdc:mga08y16_178577_c1_1146_2108 317
114 3300050511 nmdc:mga08y16_639_c1 nmdc:mga08y16_639_c1_23430_24404 317
115 3300050512 nmdc:mga0n895_487445_c1 nmdc:mga0n895_487445_c1_128_1090 317
116 3300050515 nmdc:mga0a205_231649_c1 nmdc:mga0a205_231649_c1_316_1275 317
117 3300005328 Ga0070676_10097243 Ga0070676_100972432 318
118 3300005329 Ga0070683_100006888 Ga0070683_1000068884 318
119 3300005334 Ga0068869_100028707 Ga0068869_1000287073 318
120 3300005340 Ga0070689_100004481 Ga0070689_1000044812 318
121 3300005353 Ga0070669_100015719 Ga0070669_1000157194 318
122 3300005354 Ga0070675_100010250 Ga0070675_1000102502 318
123 3300005438 Ga0070701_10096996 Ga0070701_100969962 318
124 3300005543 Ga0070672_100008279 Ga0070672_1000082792 318
125 3300005615 Ga0070702_100064147 Ga0070702_1000641473 318
126 3300005617 Ga0068859_100085150 Ga0068859_1000851503 318
127 3300005842 Ga0068858_100138947 Ga0068858_1001389472 318
128 3300006844 Ga0075428_100034854 Ga0075428_1000348542 318
129 3300006844 Ga0075428_100156350 Ga0075428_1001563502 318
130 3300006852 Ga0075433_10005324 Ga0075433_100053246 318
131 3300006852 Ga0075433_10021868 Ga0075433_100218682 318
132 3300006871 Ga0075434_100001730 Ga0075434_1000017308 318
133 3300006871 Ga0075434_100030412 Ga0075434_1000304123 318
134 3300006931 Ga0097620_100085145 Ga0097620_1000851452 318
135 3300007076 Ga0075435_100108242 Ga0075435_1001082422 318
136 3300009093 Ga0105240_10530511 Ga0105240_105305111 318
137 3300009094 Ga0111539_10000040 Ga0111539_1000004034 318
138 3300009094 Ga0111539_10007204 Ga0111539_100072044 318
139 3300009094 Ga0111539_10017801 Ga0111539_100178014 318
140 3300009147 Ga0114129_10004302 Ga0114129_100043022 318
141 3300009148 Ga0105243_10555964 Ga0105243_105559641 318
142 3300025923 Ga0207681_10019134 Ga0207681_100191343 318
143 3300025926 Ga0207659_10256143 Ga0207659_102561432 318
144 3300025926 Ga0207659_10314136 Ga0207659_103141362 318
145 3300025931 Ga0207644_10070550 Ga0207644_100705505 318
146 3300025940 Ga0207691_10027869 Ga0207691_100278694 318
147 3300025945 Ga0207679_10199730 Ga0207679_101997302 318
148 3300026075 Ga0207708_10175154 Ga0207708_101751542 318
149 3300027907 Ga0207428_10000750 Ga0207428_1000075027 318
150 3300031903 Ga0307407_10013328 Ga0307407_100133284 318
151 3300031995 Ga0307409_100034105 Ga0307409_1000341054 318
152 3300032002 Ga0307416_100171469 Ga0307416_1001714693 318
153 3300032005 Ga0307411_10026784 Ga0307411_100267843 318
154 3300032126 Ga0307415_100042982 Ga0307415_1000429821 318
155 3300045051 Ga0451576_0361296 Ga0451576_0361296_154_1119 318
156 3300049591 Ga0501075_0127704 Ga0501075_0127704_133_1104 318
157 3300050507 nmdc:mga05p37_4471_c1 nmdc:mga05p37_4471_c1_7430_8392 318
158 3300050511 nmdc:mga08y16_1149_c1 nmdc:mga08y16_1149_c1_2481_3443 318
159 3300050511 nmdc:mga08y16_355173_c1 nmdc:mga08y16_355173_c1_482_1456 318
160 3300050511 nmdc:mga08y16_83_c1 nmdc:mga08y16_83_c1_65297_66280 318
161 3300050512 nmdc:mga0n895_130606_c1 nmdc:mga0n895_130606_c1_774_1739 318
162 3300050512 nmdc:mga0n895_31123_c1 nmdc:mga0n895_31123_c1_846_1811 318
163 3300050513 nmdc:mga0rr50_5035_c1 nmdc:mga0rr50_5035_c1_3113_4078 318
164 3300050515 nmdc:mga0a205_6894_c1 nmdc:mga0a205_6894_c1_8996_9961 318
165 3300003203 JGI25406J46586_10000419 JGI25406J46586_1000041914 319
166 3300005366 Ga0070659_100324656 Ga0070659_1003246562 319
167 3300005438 Ga0070701_10001780 Ga0070701_100017807 319
168 3300005471 Ga0070698_100373254 Ga0070698_1003732541 319
169 3300005518 Ga0070699_100015391 Ga0070699_1000153913 319
170 3300005985 Ga0081539_10000093 Ga0081539_100000939 319
171 3300006844 Ga0075428_100196420 Ga0075428_1001964202 319
172 3300006846 Ga0075430_100005495 Ga0075430_10000549511 319
173 3300006846 Ga0075430_100033567 Ga0075430_1000335672 319
174 3300006880 Ga0075429_100066927 Ga0075429_1000669272 319
175 3300014326 Ga0157380_10076442 Ga0157380_100764424 319
176 3300026088 Ga0207641_10271722 Ga0207641_102717222 319
177 3300042008 Ga0439450_013275 Ga0439450_013275_315_1301 319
178 3300042125 Ga0450923_005171 Ga0450923_005171_424_1410 319
179 3300049575 Ga0501039_0006794 Ga0501039_0006794_16_984 319
180 3300049576 Ga0501040_0044695 Ga0501040_0044695_926_1894 319
181 3300049577 Ga0501041_0004230 Ga0501041_0004230_4324_5292 319
182 3300049578 Ga0501042_0004487 Ga0501042_0004487_7234_8202 319
183 3300049588 Ga0501072_0109737 Ga0501072_0109737_143_1111 319
184 3300049591 Ga0501075_0007297 Ga0501075_0007297_2725_3693 319
185 3300049592 Ga0501076_0040803 Ga0501076_0040803_933_1901 319
186 3300049741 Ga0501079_0095319 Ga0501079_0095319_781_1749 319
187 3300049743 Ga0501081_0042538 Ga0501081_0042538_164_1132 319
188 3300049824 Ga0501045_0115477 Ga0501045_0115477_319_1287 319
189 3300050508 nmdc:mga09592_59957_c1 nmdc:mga09592_59957_c1_2148_3122 319
190 3300050509 nmdc:mga0qj67_30242_c1 nmdc:mga0qj67_30242_c1_258_1232 319
191 3300050509 nmdc:mga0qj67_4864_c2 nmdc:mga0qj67_4864_c2_745_1731 319
192 3300050509 nmdc:mga0qj67_70020_c1 nmdc:mga0qj67_70020_c1_986_1960 319
193 3300050510 nmdc:mga06r32_39152_c1 nmdc:mga06r32_39152_c1_3061_4035 319
194 3300050510 nmdc:mga06r32_81377_c1 nmdc:mga06r32_81377_c1_241_1215 319
195 3300060353 Ga0501082_0027190 Ga0501082_0027190_3655_4623 319
196 3300002459 JGI24751J29686_10018045 JGI24751J29686_100180451 320
197 3300005293 Ga0065715_10015399 Ga0065715_100153992 320
198 3300005293 Ga0065715_10103262 Ga0065715_101032621 320
199 3300005293 Ga0065715_10165631 Ga0065715_101656312 320
200 3300005295 Ga0065707_10001808 Ga0065707_100018082 320
201 3300005329 Ga0070683_100012012 Ga0070683_1000120124 320
202 3300005331 Ga0070670_100011516 Ga0070670_1000115163 320
203 3300005331 Ga0070670_100034960 Ga0070670_1000349603 320
204 3300005331 Ga0070670_100176958 Ga0070670_1001769581 320
205 3300005336 Ga0070680_100203484 Ga0070680_1002034842 320
206 3300005336 Ga0070680_100251269 Ga0070680_1002512692 320
207 3300005336 Ga0070680_100369689 Ga0070680_1003696891 320
208 3300005338 Ga0068868_100317641 Ga0068868_1003176411 320
209 3300005340 Ga0070689_100012629 Ga0070689_1000126292 320
210 3300005343 Ga0070687_100177566 Ga0070687_1001775662 320
211 3300005353 Ga0070669_100000432 Ga0070669_1000004323 320
212 3300005353 Ga0070669_100113828 Ga0070669_1001138282 320
213 3300005354 Ga0070675_100000109 Ga0070675_10000010942 320
214 3300005354 Ga0070675_100033933 Ga0070675_1000339332 320
215 3300005355 Ga0070671_100007712 Ga0070671_10000771210 320
216 3300005356 Ga0070674_100009659 Ga0070674_1000096593 320
217 3300005356 Ga0070674_100119491 Ga0070674_1001194912 320
218 3300005364 Ga0070673_100081855 Ga0070673_1000818553 320
219 3300005365 Ga0070688_100001310 Ga0070688_1000013108 320
220 3300005365 Ga0070688_100023382 Ga0070688_1000233822 320
221 3300005406 Ga0070703_10027233 Ga0070703_100272332 320
222 3300005441 Ga0070700_100067086 Ga0070700_1000670863 320
223 3300005441 Ga0070700_100077374 Ga0070700_1000773743 320
224 3300005445 Ga0070708_100102137 Ga0070708_1001021371 320
225 3300005445 Ga0070708_100128766 Ga0070708_1001287662 320
226 3300005456 Ga0070678_100316311 Ga0070678_1003163112 320
227 3300005457 Ga0070662_100059024 Ga0070662_1000590241 320
228 3300005458 Ga0070681_10025530 Ga0070681_100255305 320
229 3300005459 Ga0068867_100025615 Ga0068867_1000256153 320
230 3300005518 Ga0070699_100421729 Ga0070699_1004217291 320
231 3300005543 Ga0070672_100003914 Ga0070672_1000039145 320
232 3300005543 Ga0070672_100015999 Ga0070672_1000159994 320
233 3300005543 Ga0070672_100169999 Ga0070672_1001699992 320
234 3300005544 Ga0070686_100067381 Ga0070686_1000673812 320
235 3300005564 Ga0070664_100020927 Ga0070664_1000209272 320
236 3300005577 Ga0068857_100009649 Ga0068857_1000096494 320
237 3300005577 Ga0068857_100028877 Ga0068857_1000288774 320
238 3300005617 Ga0068859_100000459 Ga0068859_1000004597 320
239 3300005617 Ga0068859_100006392 Ga0068859_10000639210 320
240 3300005618 Ga0068864_100015505 Ga0068864_1000155052 320
241 3300005618 Ga0068864_100030452 Ga0068864_1000304524 320
242 3300005618 Ga0068864_100054827 Ga0068864_1000548273 320
243 3300005719 Ga0068861_100005774 Ga0068861_1000057742 320
244 3300005719 Ga0068861_100168189 Ga0068861_1001681892 320
245 3300005840 Ga0068870_10020503 Ga0068870_100205032 320
246 3300005841 Ga0068863_100084580 Ga0068863_1000845802 320
247 3300005842 Ga0068858_100008010 Ga0068858_10000801010 320
248 3300005843 Ga0068860_100088839 Ga0068860_1000888392 320
249 3300005843 Ga0068860_100150549 Ga0068860_1001505493 320
250 3300005985 Ga0081539_10008783 Ga0081539_100087837 320
251 3300006844 Ga0075428_100004233 Ga0075428_1000042336 320
252 3300006844 Ga0075428_100030417 Ga0075428_1000304174 320
253 3300006871 Ga0075434_100046243 Ga0075434_1000462434 320
254 3300006871 Ga0075434_100166817 Ga0075434_1001668171 320
255 3300006881 Ga0068865_100105801 Ga0068865_1001058013 320
256 3300006931 Ga0097620_100000459 Ga0097620_1000004597 320
257 3300006931 Ga0097620_100006392 Ga0097620_10000639210 320
258 3300007076 Ga0075435_100028340 Ga0075435_1000283404 320
259 3300007076 Ga0075435_100245507 Ga0075435_1002455072 320
260 3300009094 Ga0111539_10002493 Ga0111539_1000249315 320
261 3300009147 Ga0114129_10002401 Ga0114129_1000240124 320
262 3300009147 Ga0114129_10143778 Ga0114129_101437782 320
263 3300009553 Ga0105249_10006847 Ga0105249_100068476 320
264 3300013297 Ga0157378_10391080 Ga0157378_103910801 320
265 3300013308 Ga0157375_10009065 Ga0157375_100090655 320
266 3300014326 Ga0157380_10000369 Ga0157380_1000036915 320
267 3300014326 Ga0157380_10294881 Ga0157380_102948812 320
268 3300014745 Ga0157377_10118619 Ga0157377_101186192 320
269 3300017792 Ga0163161_10087708 Ga0163161_100877083 320
270 3300025893 Ga0207682_10004632 Ga0207682_100046325 320
271 3300025901 Ga0207688_10003546 Ga0207688_100035466 320
272 3300025908 Ga0207643_10008746 Ga0207643_100087464 320
273 3300025908 Ga0207643_10035502 Ga0207643_100355022 320
274 3300025925 Ga0207650_10048273 Ga0207650_100482733 320
275 3300025925 Ga0207650_10092664 Ga0207650_100926641 320
276 3300025926 Ga0207659_10000617 Ga0207659_1000061718 320
277 3300025932 Ga0207690_10135769 Ga0207690_101357691 320
278 3300025933 Ga0207706_10008838 Ga0207706_1000883811 320
279 3300025933 Ga0207706_10217965 Ga0207706_102179652 320
280 3300025936 Ga0207670_10004689 Ga0207670_100046892 320
281 3300025938 Ga0207704_10044601 Ga0207704_100446013 320
282 3300025940 Ga0207691_10007757 Ga0207691_100077575 320
283 3300025940 Ga0207691_10015851 Ga0207691_100158515 320
284 3300025940 Ga0207691_10117911 Ga0207691_101179112 320
285 3300025941 Ga0207711_10206169 Ga0207711_102061692 320
286 3300025944 Ga0207661_10025066 Ga0207661_100250664 320
287 3300025945 Ga0207679_10048707 Ga0207679_100487073 320
288 3300025960 Ga0207651_10088650 Ga0207651_100886502 320
289 3300025960 Ga0207651_10238769 Ga0207651_102387691 320
290 3300026035 Ga0207703_10042575 Ga0207703_100425753 320
291 3300026075 Ga0207708_10104785 Ga0207708_101047852 320
292 3300026088 Ga0207641_10118438 Ga0207641_101184383 320
293 3300026089 Ga0207648_10000375 Ga0207648_1000037519 320
294 3300026095 Ga0207676_10270722 Ga0207676_102707222 320
295 3300026116 Ga0207674_10038952 Ga0207674_100389522 320
296 3300026116 Ga0207674_10042147 Ga0207674_100421474 320
297 3300026116 Ga0207674_10149243 Ga0207674_101492431 320
298 3300026118 Ga0207675_100005097 Ga0207675_1000050973 320
299 3300026121 Ga0207683_10028347 Ga0207683_100283473 320
300 3300026121 Ga0207683_10101372 Ga0207683_101013722 320
301 3300026121 Ga0207683_10167334 Ga0207683_101673342 320
302 3300027907 Ga0207428_10001319 Ga0207428_1000131916 320
303 3300028380 Ga0268265_10000263 Ga0268265_1000026349 320
304 3300028380 Ga0268265_10108634 Ga0268265_101086342 320
305 3300028381 Ga0268264_10002400 Ga0268264_100024003 320
306 3300028381 Ga0268264_10126791 Ga0268264_101267911 320
307 3300035725 Ga0373947_0191510 Ga0373947_0191510_262_1227 320
308 3300041486 Ga0451807_2469453 Ga0451807_2469453_382_1350 320
309 3300045051 Ga0451576_0029521 Ga0451576_0029521_1890_2855 320
310 3300046455 Ga0495603_0084178 Ga0495603_0084178_294_1271 320
311 3300046459 Ga0495629_0003222 Ga0495629_0003222_7693_8670 320
312 3300046473 Ga0495582_0033481 Ga0495582_0033481_1228_2205 320
313 3300046473 Ga0495582_0144120 Ga0495582_0144120_261_1226 320
314 3300046491 Ga0495584_0122747 Ga0495584_0122747_282_1244 320
315 3300046499 Ga0495594_0087102 Ga0495594_0087102_144_1109 320
316 3300046557 Ga0495622_0088430 Ga0495622_0088430_101_1078 320
317 3300046558 Ga0495633_0070797 Ga0495633_0070797_638_1600 320
318 3300046664 Ga0495659_0026780 Ga0495659_0026780_35_997 320
319 3300046664 Ga0495659_0079583 Ga0495659_0079583_172_1134 320
320 3300046674 Ga0495588_0001691 Ga0495588_0001691_3599_4564 320
321 3300046691 Ga0495670_0052328 Ga0495670_0052328_858_1820 320
322 3300047318 Ga0495636_0006616 Ga0495636_0006616_853_1815 320
323 3300047321 Ga0495676_0041004 Ga0495676_0041004_516_1493 320
324 3300050507 nmdc:mga05p37_320977_c1 nmdc:mga05p37_320977_c1_321_1283 320
325 3300050507 nmdc:mga05p37_3595_c1 nmdc:mga05p37_3595_c1_5750_6712 320
326 3300050511 nmdc:mga08y16_105820_c1 nmdc:mga08y16_105820_c1_22_984 320
327 3300050512 nmdc:mga0n895_137637_c1 nmdc:mga0n895_137637_c1_291_1253 320
328 3300050512 nmdc:mga0n895_300185_c1 nmdc:mga0n895_300185_c1_307_1272 320
329 3300050512 nmdc:mga0n895_51493_c1 nmdc:mga0n895_51493_c1_2631_3596 320
330 3300050513 nmdc:mga0rr50_206474_c1 nmdc:mga0rr50_206474_c1_383_1348 320
331 3300050515 nmdc:mga0a205_9084_c1 nmdc:mga0a205_9084_c1_843_1805 320
332 3300059426 Ga0590077_006313 Ga0590077_006313_876_1853 320
333 3300005293 Ga0065715_10013853 Ga0065715_100138531 321
334 3300005328 Ga0070676_10009842 Ga0070676_100098426 321
335 3300005330 Ga0070690_100002535 Ga0070690_1000025356 321
336 3300005333 Ga0070677_10017079 Ga0070677_100170792 321
337 3300005334 Ga0068869_100004047 Ga0068869_1000040475 321
338 3300005334 Ga0068869_100008308 Ga0068869_1000083085 321
339 3300005343 Ga0070687_100073024 Ga0070687_1000730242 321
340 3300005347 Ga0070668_100212667 Ga0070668_1002126672 321
341 3300005364 Ga0070673_100026385 Ga0070673_1000263852 321
342 3300005364 Ga0070673_100055049 Ga0070673_1000550492 321
343 3300005366 Ga0070659_100164303 Ga0070659_1001643032 321
344 3300005367 Ga0070667_100020613 Ga0070667_1000206134 321
345 3300005438 Ga0070701_10021737 Ga0070701_100217372 321
346 3300005438 Ga0070701_10066463 Ga0070701_100664631 321
347 3300005441 Ga0070700_100040517 Ga0070700_1000405172 321
348 3300005455 Ga0070663_100010296 Ga0070663_1000102962 321
349 3300005456 Ga0070678_100111301 Ga0070678_1001113012 321
350 3300005456 Ga0070678_100243134 Ga0070678_1002431342 321
351 3300005458 Ga0070681_10394414 Ga0070681_103944142 321
352 3300005459 Ga0068867_100016050 Ga0068867_1000160502 321
353 3300005459 Ga0068867_100217160 Ga0068867_1002171601 321
354 3300005466 Ga0070685_10065705 Ga0070685_100657052 321
355 3300005518 Ga0070699_100264644 Ga0070699_1002646442 321
356 3300005530 Ga0070679_100247742 Ga0070679_1002477422 321
357 3300005543 Ga0070672_100024609 Ga0070672_1000246095 321
358 3300005543 Ga0070672_100096494 Ga0070672_1000964942 321
359 3300005544 Ga0070686_100127192 Ga0070686_1001271922 321
360 3300005548 Ga0070665_100134590 Ga0070665_1001345904 321
361 3300005549 Ga0070704_100036486 Ga0070704_1000364863 321
362 3300005564 Ga0070664_100027053 Ga0070664_1000270532 321
363 3300005564 Ga0070664_100027251 Ga0070664_1000272512 321
364 3300005577 Ga0068857_100091113 Ga0068857_1000911132 321
365 3300005578 Ga0068854_100040865 Ga0068854_1000408654 321
366 3300005616 Ga0068852_100131624 Ga0068852_1001316242 321
367 3300005617 Ga0068859_100041433 Ga0068859_1000414332 321
368 3300005618 Ga0068864_100022648 Ga0068864_1000226484 321
369 3300005719 Ga0068861_100033621 Ga0068861_1000336212 321
370 3300005840 Ga0068870_10002247 Ga0068870_100022475 321
371 3300005841 Ga0068863_100016660 Ga0068863_1000166604 321
372 3300005842 Ga0068858_100140746 Ga0068858_1001407462 321
373 3300005844 Ga0068862_100004233 Ga0068862_1000042334 321
374 3300005844 Ga0068862_100108706 Ga0068862_1001087063 321
375 3300006237 Ga0097621_100018708 Ga0097621_1000187084 321
376 3300006358 Ga0068871_100119157 Ga0068871_1001191572 321
377 3300006844 Ga0075428_100082065 Ga0075428_1000820652 321
378 3300006846 Ga0075430_100001090 Ga0075430_1000010902 321
379 3300006847 Ga0075431_100004139 Ga0075431_1000041396 321
380 3300006847 Ga0075431_100240950 Ga0075431_1002409502 321
381 3300006852 Ga0075433_10019804 Ga0075433_100198044 321
382 3300006871 Ga0075434_100001711 Ga0075434_1000017114 321
383 3300006880 Ga0075429_100011739 Ga0075429_1000117395 321
384 3300006880 Ga0075429_100041462 Ga0075429_1000414623 321
385 3300006881 Ga0068865_100036934 Ga0068865_1000369343 321
386 3300006931 Ga0097620_100041434 Ga0097620_1000414342 321
387 3300009094 Ga0111539_10013195 Ga0111539_100131954 321
388 3300009094 Ga0111539_10014889 Ga0111539_100148895 321
389 3300009094 Ga0111539_10192573 Ga0111539_101925733 321
390 3300009147 Ga0114129_10019676 Ga0114129_100196767 321
391 3300009148 Ga0105243_10061941 Ga0105243_100619412 321
392 3300009176 Ga0105242_10096002 Ga0105242_100960022 321
393 3300009177 Ga0105248_10014948 Ga0105248_100149483 321
394 3300009553 Ga0105249_10026619 Ga0105249_100266194 321
395 3300013296 Ga0157374_10297420 Ga0157374_102974202 321
396 3300013306 Ga0163162_10005469 Ga0163162_100054699 321
397 3300014325 Ga0163163_10077478 Ga0163163_100774782 321
398 3300014326 Ga0157380_10183238 Ga0157380_101832382 321
399 3300014326 Ga0157380_10219053 Ga0157380_102190531 321
400 3300014745 Ga0157377_10020689 Ga0157377_100206893 321
401 3300014745 Ga0157377_10048258 Ga0157377_100482582 321
402 3300014968 Ga0157379_10014028 Ga0157379_100140285 321
403 3300014969 Ga0157376_10048059 Ga0157376_100480592 321
404 3300017792 Ga0163161_10047090 Ga0163161_100470904 321
405 3300025315 Ga0207697_10015924 Ga0207697_100159243 321
406 3300025893 Ga0207682_10000139 Ga0207682_1000013922 321
407 3300025901 Ga0207688_10001936 Ga0207688_100019364 321
408 3300025907 Ga0207645_10009375 Ga0207645_100093757 321
409 3300025907 Ga0207645_10018389 Ga0207645_100183893 321
410 3300025908 Ga0207643_10001178 Ga0207643_100011784 321
411 3300025918 Ga0207662_10044721 Ga0207662_100447214 321
412 3300025921 Ga0207652_10104468 Ga0207652_101044682 321
413 3300025923 Ga0207681_10026181 Ga0207681_100261812 321
414 3300025923 Ga0207681_10029582 Ga0207681_100295824 321
415 3300025926 Ga0207659_10031802 Ga0207659_100318023 321
416 3300025926 Ga0207659_10093995 Ga0207659_100939952 321
417 3300025933 Ga0207706_10004608 Ga0207706_100046089 321
418 3300025935 Ga0207709_10016583 Ga0207709_100165833 321
419 3300025936 Ga0207670_10013796 Ga0207670_100137963 321
420 3300025938 Ga0207704_10009137 Ga0207704_100091374 321
421 3300025938 Ga0207704_10035062 Ga0207704_100350622 321
422 3300025940 Ga0207691_10005343 Ga0207691_100053431 321
423 3300025940 Ga0207691_10120332 Ga0207691_101203321 321
424 3300025942 Ga0207689_10001767 Ga0207689_100017677 321
425 3300025942 Ga0207689_10075257 Ga0207689_100752573 321
426 3300025945 Ga0207679_10013217 Ga0207679_100132174 321
427 3300025960 Ga0207651_10047572 Ga0207651_100475722 321
428 3300025961 Ga0207712_10007908 Ga0207712_100079085 321
429 3300025986 Ga0207658_10048860 Ga0207658_100488602 321
430 3300026023 Ga0207677_10093036 Ga0207677_100930363 321
431 3300026035 Ga0207703_10015787 Ga0207703_100157874 321
432 3300026075 Ga0207708_10033389 Ga0207708_100333893 321
433 3300026089 Ga0207648_10011159 Ga0207648_100111596 321
434 3300026089 Ga0207648_10087878 Ga0207648_100878783 321
435 3300026116 Ga0207674_10179429 Ga0207674_101794292 321
436 3300026118 Ga0207675_100005161 Ga0207675_1000051618 321
437 3300026121 Ga0207683_10102431 Ga0207683_101024313 321
438 3300027907 Ga0207428_10005991 Ga0207428_100059913 321
439 3300028380 Ga0268265_10016194 Ga0268265_100161944 321
440 3300028380 Ga0268265_10217867 Ga0268265_102178672 321
441 3300028381 Ga0268264_10049927 Ga0268264_100499274 321
442 3300028381 Ga0268264_10092345 Ga0268264_100923452 321
443 3300035112 Ga0373932_0015725 Ga0373932_0015725_688_1677 321
444 3300037068 Ga0373925_0035988 Ga0373925_0035988_816_1805 321
445 3300045051 Ga0451576_0159236 Ga0451576_0159236_455_1444 321
446 3300046522 Ga0495643_0003874 Ga0495643_0003874_1074_2054 321
447 3300050508 nmdc:mga09592_24167_c1 nmdc:mga09592_24167_c1_2432_3421 321
448 3300050509 nmdc:mga0qj67_276313_c1 nmdc:mga0qj67_276313_c1_266_1267 321
449 3300050510 nmdc:mga06r32_349650_c1 nmdc:mga06r32_349650_c1_133_1134 321
450 3300050511 nmdc:mga08y16_14292_c1 nmdc:mga08y16_14292_c1_2827_3816 321
451 3300050511 nmdc:mga08y16_25196_c1 nmdc:mga08y16_25196_c1_104_1105 321
452 3300050511 nmdc:mga08y16_339523_c1 nmdc:mga08y16_339523_c1_82_1074 321
453 3300050512 nmdc:mga0n895_3603_c1 nmdc:mga0n895_3603_c1_8626_9615 321
454 3300050513 nmdc:mga0rr50_407615_c1 nmdc:mga0rr50_407615_c1_84_1073 321
455 3300050515 nmdc:mga0a205_38252_c1 nmdc:mga0a205_38252_c1_3050_4039 321
456 3300005334 Ga0068869_100088545 Ga0068869_1000885451 322
457 3300005441 Ga0070700_100097524 Ga0070700_1000975241 322
458 3300006844 Ga0075428_100023809 Ga0075428_1000238092 322
459 3300009094 Ga0111539_10076513 Ga0111539_100765133 322
460 3300009147 Ga0114129_10166422 Ga0114129_101664222 322
461 3300026075 Ga0207708_10137666 Ga0207708_101376661 322
462 3300032002 Ga0307416_100351958 Ga0307416_1003519582 322
463 3300032002 Ga0307416_100516167 Ga0307416_1005161672 322
464 3300035724 Ga0373933_0041138 Ga0373933_0041138_1172_2173 322
465 3300036401 Ga0373937_0006141 Ga0373937_0006141_3414_4415 322
466 3300044673 Ga0453683_0214270 Ga0453683_0214270_237_1208 322
467 3300045051 Ga0451576_0024372 Ga0451576_0024372_5289_6260 322
468 3300049661 Ga0501217_012511 Ga0501217_012511_163_1164 322
469 3300049661 Ga0501217_025215 Ga0501217_025215_31_1005 322
470 3300049742 Ga0501080_0149697 Ga0501080_0149697_929_1906 322
471 3300050507 nmdc:mga05p37_552323_c1 nmdc:mga05p37_552323_c1_308_1285 322
472 3300050510 nmdc:mga06r32_85540_c1 nmdc:mga06r32_85540_c1_1594_2595 322
473 3300050511 nmdc:mga08y16_40753_c1 nmdc:mga08y16_40753_c1_1906_2907 322
474 3300005334 Ga0068869_100172445 Ga0068869_1001724452 323
475 3300005340 Ga0070689_100009330 Ga0070689_1000093303 323
476 3300005341 Ga0070691_10029367 Ga0070691_100293673 323
477 3300005355 Ga0070671_100046552 Ga0070671_1000465522 323
478 3300005364 Ga0070673_100000486 Ga0070673_10000048610 323
479 3300005367 Ga0070667_100376699 Ga0070667_1003766992 323
480 3300005438 Ga0070701_10050933 Ga0070701_100509331 323
481 3300005440 Ga0070705_100000366 Ga0070705_10000036620 323
482 3300005441 Ga0070700_100122214 Ga0070700_1001222142 323
483 3300005444 Ga0070694_100014180 Ga0070694_1000141802 323
484 3300005459 Ga0068867_100082925 Ga0068867_1000829252 323
485 3300005545 Ga0070695_100000102 Ga0070695_1000001028 323
486 3300005547 Ga0070693_100032298 Ga0070693_1000322982 323
487 3300005615 Ga0070702_100018990 Ga0070702_1000189902 323
488 3300005841 Ga0068863_100037284 Ga0068863_1000372844 323
489 3300005844 Ga0068862_100145040 Ga0068862_1001450402 323
490 3300005985 Ga0081539_10001997 Ga0081539_1000199726 323
491 3300006038 Ga0075365_10003211 Ga0075365_100032116 323
492 3300006844 Ga0075428_100291906 Ga0075428_1002919062 323
493 3300006852 Ga0075433_10052443 Ga0075433_100524433 323
494 3300006881 Ga0068865_100127457 Ga0068865_1001274572 323
495 3300007076 Ga0075435_100004581 Ga0075435_1000045815 323
496 3300009094 Ga0111539_10000465 Ga0111539_1000046543 323
497 3300009094 Ga0111539_10756038 Ga0111539_107560381 323
498 3300009098 Ga0105245_10016854 Ga0105245_100168543 323
499 3300009147 Ga0114129_10005462 Ga0114129_100054629 323
500 3300009148 Ga0105243_10026115 Ga0105243_100261154 323
501 3300009148 Ga0105243_10026216 Ga0105243_100262162 323
502 3300009177 Ga0105248_10040061 Ga0105248_100400612 323
503 3300009553 Ga0105249_10278407 Ga0105249_102784072 323
504 3300013297 Ga0157378_10670008 Ga0157378_106700081 323
505 3300014326 Ga0157380_10064470 Ga0157380_100644704 323
506 3300025901 Ga0207688_10030191 Ga0207688_100301912 323
507 3300025907 Ga0207645_10002241 Ga0207645_100022412 323
508 3300025918 Ga0207662_10005189 Ga0207662_100051895 323
509 3300025923 Ga0207681_10066903 Ga0207681_100669031 323
510 3300025923 Ga0207681_10103711 Ga0207681_101037111 323
511 3300025928 Ga0207700_10039336 Ga0207700_100393362 323
512 3300025936 Ga0207670_10049236 Ga0207670_100492362 323
513 3300025938 Ga0207704_10104335 Ga0207704_101043352 323
514 3300025941 Ga0207711_10137987 Ga0207711_101379872 323
515 3300025942 Ga0207689_10032790 Ga0207689_100327903 323
516 3300025960 Ga0207651_10002809 Ga0207651_100028096 323
517 3300025981 Ga0207640_10256497 Ga0207640_102564971 323
518 3300026075 Ga0207708_10009001 Ga0207708_100090016 323
519 3300026075 Ga0207708_10019636 Ga0207708_100196362 323
520 3300026088 Ga0207641_10052416 Ga0207641_100524162 323
521 3300026089 Ga0207648_10014276 Ga0207648_100142767 323
522 3300026089 Ga0207648_10100505 Ga0207648_101005051 323
523 3300028380 Ga0268265_10252515 Ga0268265_102525152 323
524 3300035691 Ga0373931_0153463 Ga0373931_0153463_94_1071 323
525 3300042008 Ga0439450_005826 Ga0439450_005826_681_1685 323
526 3300042439 Ga0439464_0005119 Ga0439464_0005119_1817_2821 323
527 3300046528 Ga0495642_0013249 Ga0495642_0013249_2104_3093 323
528 3300046539 Ga0495621_0000764 Ga0495621_0000764_858_1847 323
529 3300049571 Ga0501034_0056321 Ga0501034_0056321_1272_2303 323
530 3300049823 Ga0501044_0026417 Ga0501044_0026417_3349_4380 323
531 3300050492 nmdc:mga0yw44_98960_c1 nmdc:mga0yw44_98960_c1_828_1805 323
532 3300050507 nmdc:mga05p37_1148_c1 nmdc:mga05p37_1148_c1_19728_20732 323
533 3300050508 nmdc:mga09592_115130_c1 nmdc:mga09592_115130_c1_20_1024 323
534 3300050511 nmdc:mga08y16_156_c1 nmdc:mga08y16_156_c1_45159_46163 323
535 3300050513 nmdc:mga0rr50_773_c1 nmdc:mga0rr50_773_c1_1790_2767 323
536 3300005546 Ga0070696_100134165 Ga0070696_1001341652 324
537 3300025920 Ga0207649_10113047 Ga0207649_101130472 324
538 3300050507 nmdc:mga05p37_163460_c1 nmdc:mga05p37_163460_c1_956_1963 324
539 2162886007 SwRhRL2b_contig_3115889 SwRhRL2b_0225.00002830 325
540 3300005289 Ga0065704_10004376 Ga0065704_100043762 325
541 3300005468 Ga0070707_100067550 Ga0070707_1000675501 325
542 3300005471 Ga0070698_100008063 Ga0070698_1000080633 325
543 3300005518 Ga0070699_100042556 Ga0070699_1000425561 325
544 3300005536 Ga0070697_100021645 Ga0070697_1000216454 325
545 3300006195 Ga0075366_10064074 Ga0075366_100640742 325
546 3300009147 Ga0114129_10006077 Ga0114129_1000607711 325
547 3300009147 Ga0114129_10548740 Ga0114129_105487402 325
548 3300014326 Ga0157380_10215393 Ga0157380_102153931 325
549 3300046538 Ga0495609_0035857 Ga0495609_0035857_562_1548 325
550 3300049576 Ga0501040_0129415 Ga0501040_0129415_14_1096 325
551 3300049824 Ga0501045_0010502 Ga0501045_0010502_3724_4806 325
552 3300050507 nmdc:mga05p37_108082_c1 nmdc:mga05p37_108082_c1_896_1909 325
553 3300053104 Ga0500556_0016051 Ga0500556_0016051_873_1916 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00762

Ferrochelatase

Ferrochelatase

52

355

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ofl-assembly1.cif.gz_A coproporphyrin iii - lmcpfc complex soaked 4min with fe2+ 0.9249 9 311
8aw7-assembly1.cif.gz_A structure of coproporphyrin iii-lmcpfc r45l 0.9213 9 313
8ofl-assembly1.cif.gz_A coproporphyrin iii - lmcpfc complex soaked 4min with fe2+ 0.9133 9 311
2h1v-assembly1.cif.gz_A crystal structure of the lys87ala mutant variant of bacillus subtilis ferrochelatase 0.91 9 312
8aw7-assembly1.cif.gz_A structure of coproporphyrin iii-lmcpfc r45l 0.9071 9 313
ID Description Score Start End Superfamily
af_P9WNE3_5_124_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9377 9 132 3.40.50.1400
1ak1A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9292 153 290 3.40.50.1400
af_P9WNE3_146_279_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9275 158 290 3.40.50.1400
af_P9WNE3_5_124_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9226 9 132 3.40.50.1400
af_P9WNE3_146_279_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9141 158 290 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A383BKM2-F1-model_v4 Ferrochelatase 0.9873 6 239 GO:0004325
GO:0006783
AF-A0A7Y4WFJ6-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.9856 6 323 GO:0004325
GO:0005737
GO:0006783
GO:0046872
AF-A0A382CW72-F1-model_v4 Ferrochelatase 0.9803 4 159 GO:0004325
GO:0006783
AF-A0A2V9XY23-F1-model_v4 Ferrochelatase 0.9792 7 100 GO:0004325
GO:0006783
AF-A0A7Y4WUD1-F1-model_v4 Ferrochelatase 0.9789 4 199 GO:0004325
GO:0006783

Feature Viewer

pLDDT pTM Quality
93.14 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map