F462871
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 553 | 213 | 553 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300026089|Ga0207648_10087878|Ga0207648_100878783 |
| Length | 371 |
| Sequence | MCGIGVVSRQLAIVSSRPRPPQYCELISGSAVADVWMQKRWSMLGWLKAPFDSVLVISFGGPQGLDDIRPFLANVLRGRRVSPERVEEVAHHYELFGGVSPITSITRRQAEGLRLRLEAAGHSLPVYVGMRNWHPLLPDTLRNMHAAGLRHAIGFITAAQHSYSSCQQYRENVTAARVELRNNGEDVDVTFVGSWFEHPLFIAANAAHVMGALARLPEGARAAARLVCTAHSIPIQMAQASRYEAQLKESARLVAEEVGMHDWALVYQSRSGRPGDPWLEPDVCDYLRRERAAGLQAAVLCPIGFVSDHIEVLYDLDREAADVSREIGLLLARAESVNDDPRFLDMMADVVLRTIKRHEQGRPLPLTAAAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 144 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 145 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 146 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 147 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 148 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 149 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 152 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 153 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 156 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 157 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 158 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 159 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 160 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 161 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 179 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 188 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 195 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 196 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 197 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 198 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 199 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 208 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 210 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 211 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 212 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 213 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.71 |
| Nodule | 0 |
| Rhizoplane | 0.54 |
| Rhizosphere | 96.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3115889 | 2162886007 | Unclassified | 1950 |
| 2 | JGI24751J29686_10018045 | 3300002459 | Bacteria | 1459 |
| 3 | JGI25406J46586_10000419 | 3300003203 | Bacteria | 19512 |
| 4 | Ga0065704_10004376 | 3300005289 | Bacteria | 5688 |
| 5 | Ga0065712_10001274 | 3300005290 | Bacteria | 8076 |
| 6 | Ga0065715_10013853 | 3300005293 | Bacteria | 2202 |
| 7 | Ga0065715_10015399 | 3300005293 | Unclassified | 2765 |
| 8 | Ga0065715_10103262 | 3300005293 | Unclassified | 3046 |
| 9 | Ga0065715_10165631 | 3300005293 | Bacteria | 1589 |
| 10 | Ga0065707_10001808 | 3300005295 | Bacteria | 6679 |
| 11 | Ga0065707_10114722 | 3300005295 | Unclassified | 2289 |
| 12 | Ga0070676_10009842 | 3300005328 | Bacteria | 5171 |
| 13 | Ga0070676_10097243 | 3300005328 | Bacteria | 1813 |
| 14 | Ga0070676_10174796 | 3300005328 | Unclassified | 1392 |
| 15 | Ga0070683_100006888 | 3300005329 | Bacteria | 9548 |
| 16 | Ga0070683_100012012 | 3300005329 | Bacteria | 7512 |
| 17 | Ga0070690_100002535 | 3300005330 | Bacteria | 9830 |
| 18 | Ga0070670_100011516 | 3300005331 | Bacteria | 7566 |
| 19 | Ga0070670_100034960 | 3300005331 | Unclassified | 4325 |
| 20 | Ga0070670_100176958 | 3300005331 | Unclassified | 1852 |
| 21 | Ga0070677_10013120 | 3300005333 | Bacteria | 2891 |
| 22 | Ga0070677_10017079 | 3300005333 | Bacteria | 2592 |
| 23 | Ga0068869_100004047 | 3300005334 | Bacteria | 9069 |
| 24 | Ga0068869_100008308 | 3300005334 | Bacteria | 6688 |
| 25 | Ga0068869_100028707 | 3300005334 | Bacteria | 3891 |
| 26 | Ga0068869_100088545 | 3300005334 | Bacteria | 2324 |
| 27 | Ga0068869_100147466 | 3300005334 | Bacteria | 1822 |
| 28 | Ga0068869_100163743 | 3300005334 | Bacteria | 1733 |
| 29 | Ga0068869_100172445 | 3300005334 | Bacteria | 1691 |
| 30 | Ga0068869_100198419 | 3300005334 | Bacteria | 1581 |
| 31 | Ga0070680_100108341 | 3300005336 | Bacteria | 2311 |
| 32 | Ga0070680_100203484 | 3300005336 | Bacteria | 1670 |
| 33 | Ga0070680_100251269 | 3300005336 | Bacteria | 1495 |
| 34 | Ga0070680_100369689 | 3300005336 | Bacteria | 1220 |
| 35 | Ga0068868_100317641 | 3300005338 | Bacteria | 1326 |
| 36 | Ga0070689_100004481 | 3300005340 | Bacteria | 9446 |
| 37 | Ga0070689_100009330 | 3300005340 | Bacteria | 6956 |
| 38 | Ga0070689_100012629 | 3300005340 | Bacteria | 6090 |
| 39 | Ga0070691_10029367 | 3300005341 | Bacteria | 2571 |
| 40 | Ga0070687_100073024 | 3300005343 | Bacteria | 1848 |
| 41 | Ga0070687_100177566 | 3300005343 | Unclassified | 1273 |
| 42 | Ga0070668_100212667 | 3300005347 | Bacteria | 1591 |
| 43 | Ga0070668_100313630 | 3300005347 | Unclassified | 1318 |
| 44 | Ga0070669_100000432 | 3300005353 | Bacteria | 32010 |
| 45 | Ga0070669_100015719 | 3300005353 | Bacteria | 5398 |
| 46 | Ga0070669_100033302 | 3300005353 | Bacteria | 3726 |
| 47 | Ga0070669_100041323 | 3300005353 | Unclassified | 3353 |
| 48 | Ga0070669_100105067 | 3300005353 | Bacteria | 2136 |
| 49 | Ga0070669_100113828 | 3300005353 | Bacteria | 2056 |
| 50 | Ga0070675_100000109 | 3300005354 | Bacteria | 47889 |
| 51 | Ga0070675_100010250 | 3300005354 | Bacteria | 7312 |
| 52 | Ga0070675_100029687 | 3300005354 | Unclassified | 4411 |
| 53 | Ga0070675_100033933 | 3300005354 | Bacteria | 4139 |
| 54 | Ga0070671_100007712 | 3300005355 | Bacteria | 8598 |
| 55 | Ga0070671_100046552 | 3300005355 | Bacteria | 3607 |
| 56 | Ga0070674_100009659 | 3300005356 | Bacteria | 5787 |
| 57 | Ga0070674_100088033 | 3300005356 | Unclassified | 2234 |
| 58 | Ga0070674_100119491 | 3300005356 | Bacteria | 1949 |
| 59 | Ga0070673_100000486 | 3300005364 | Bacteria | 21134 |
| 60 | Ga0070673_100026385 | 3300005364 | Bacteria | 4290 |
| 61 | Ga0070673_100055049 | 3300005364 | Bacteria | 3133 |
| 62 | Ga0070673_100081855 | 3300005364 | Bacteria | 2619 |
| 63 | Ga0070673_100327996 | 3300005364 | Bacteria | 1353 |
| 64 | Ga0070688_100001310 | 3300005365 | Bacteria | 12411 |
| 65 | Ga0070688_100023382 | 3300005365 | Unclassified | 3634 |
| 66 | Ga0070659_100164303 | 3300005366 | Bacteria | 1816 |
| 67 | Ga0070659_100324656 | 3300005366 | Unclassified | 1287 |
| 68 | Ga0070667_100020613 | 3300005367 | Bacteria | 5472 |
| 69 | Ga0070667_100376699 | 3300005367 | Bacteria | 1289 |
| 70 | Ga0070703_10027233 | 3300005406 | Bacteria | 1703 |
| 71 | Ga0070701_10001780 | 3300005438 | Bacteria | 8135 |
| 72 | Ga0070701_10021737 | 3300005438 | Bacteria | 3067 |
| 73 | Ga0070701_10050933 | 3300005438 | Bacteria | 2146 |
| 74 | Ga0070701_10066463 | 3300005438 | Bacteria | 1916 |
| 75 | Ga0070701_10096996 | 3300005438 | Bacteria | 1626 |
| 76 | Ga0070705_100000366 | 3300005440 | Bacteria | 26473 |
| 77 | Ga0070705_100234836 | 3300005440 | Bacteria | 1278 |
| 78 | Ga0070700_100040517 | 3300005441 | Bacteria | 2852 |
| 79 | Ga0070700_100067086 | 3300005441 | Unclassified | 2279 |
| 80 | Ga0070700_100077374 | 3300005441 | Unclassified | 2139 |
| 81 | Ga0070700_100097524 | 3300005441 | Bacteria | 1930 |
| 82 | Ga0070700_100122214 | 3300005441 | Bacteria | 1746 |
| 83 | Ga0070700_100215905 | 3300005441 | Bacteria | 1356 |
| 84 | Ga0070694_100014180 | 3300005444 | Unclassified | 4987 |
| 85 | Ga0070694_100248969 | 3300005444 | Bacteria | 1343 |
| 86 | Ga0070708_100102137 | 3300005445 | Bacteria | 2627 |
| 87 | Ga0070708_100128766 | 3300005445 | Archaea | 2342 |
| 88 | Ga0070663_100010296 | 3300005455 | Bacteria | 5827 |
| 89 | Ga0070663_100022604 | 3300005455 | Bacteria | 4207 |
| 90 | Ga0070678_100111301 | 3300005456 | Bacteria | 2142 |
| 91 | Ga0070678_100243134 | 3300005456 | Bacteria | 1506 |
| 92 | Ga0070678_100316311 | 3300005456 | Bacteria | 1332 |
| 93 | Ga0070662_100059024 | 3300005457 | Unclassified | 2794 |
| 94 | Ga0070681_10025530 | 3300005458 | Bacteria | 5943 |
| 95 | Ga0070681_10394414 | 3300005458 | Bacteria | 1295 |
| 96 | Ga0068867_100016050 | 3300005459 | Bacteria | 5317 |
| 97 | Ga0068867_100025615 | 3300005459 | Bacteria | 4233 |
| 98 | Ga0068867_100082925 | 3300005459 | Bacteria | 2419 |
| 99 | Ga0068867_100217160 | 3300005459 | Bacteria | 1539 |
| 100 | Ga0070685_10065705 | 3300005466 | Bacteria | 2135 |
| 101 | Ga0070707_100040857 | 3300005468 | Bacteria | 4438 |
| 102 | Ga0070707_100067550 | 3300005468 | Unclassified | 3439 |
| 103 | Ga0070698_100008063 | 3300005471 | Bacteria | 11394 |
| 104 | Ga0070698_100373254 | 3300005471 | Bacteria | 1359 |
| 105 | Ga0070699_100015391 | 3300005518 | Bacteria | 6574 |
| 106 | Ga0070699_100042556 | 3300005518 | Unclassified | 3931 |
| 107 | Ga0070699_100264644 | 3300005518 | Unclassified | 1538 |
| 108 | Ga0070699_100421729 | 3300005518 | Bacteria | 1208 |
| 109 | Ga0070679_100247742 | 3300005530 | Bacteria | 1738 |
| 110 | Ga0070697_100021645 | 3300005536 | Bacteria | 5096 |
| 111 | Ga0070672_100003914 | 3300005543 | Bacteria | 9702 |
| 112 | Ga0070672_100008279 | 3300005543 | Bacteria | 7106 |
| 113 | Ga0070672_100015999 | 3300005543 | Bacteria | 5360 |
| 114 | Ga0070672_100024609 | 3300005543 | Bacteria | 4453 |
| 115 | Ga0070672_100096494 | 3300005543 | Bacteria | 2392 |
| 116 | Ga0070672_100169999 | 3300005543 | Bacteria | 1812 |
| 117 | Ga0070672_100193374 | 3300005543 | Bacteria | 1699 |
| 118 | Ga0070672_100340655 | 3300005543 | Bacteria | 1277 |
| 119 | Ga0070686_100067381 | 3300005544 | Unclassified | 2332 |
| 120 | Ga0070686_100106270 | 3300005544 | Unclassified | 1905 |
| 121 | Ga0070686_100127192 | 3300005544 | Bacteria | 1757 |
| 122 | Ga0070695_100000102 | 3300005545 | Bacteria | 37412 |
| 123 | Ga0070696_100134165 | 3300005546 | Unclassified | 1804 |
| 124 | Ga0070693_100032298 | 3300005547 | Bacteria | 2877 |
| 125 | Ga0070665_100134590 | 3300005548 | Bacteria | 2473 |
| 126 | Ga0070704_100036486 | 3300005549 | Bacteria | 3351 |
| 127 | Ga0070664_100020927 | 3300005564 | Bacteria | 5390 |
| 128 | Ga0070664_100027053 | 3300005564 | Bacteria | 4764 |
| 129 | Ga0070664_100027251 | 3300005564 | Bacteria | 4747 |
| 130 | Ga0068857_100009649 | 3300005577 | Bacteria | 8386 |
| 131 | Ga0068857_100028877 | 3300005577 | Bacteria | 4894 |
| 132 | Ga0068857_100091113 | 3300005577 | Bacteria | 2729 |
| 133 | Ga0068854_100040865 | 3300005578 | Bacteria | 3274 |
| 134 | Ga0070702_100018990 | 3300005615 | Bacteria | 3575 |
| 135 | Ga0070702_100064147 | 3300005615 | Bacteria | 2148 |
| 136 | Ga0068852_100131624 | 3300005616 | Bacteria | 2304 |
| 137 | Ga0068859_100000459 | 3300005617 | Bacteria | 40396 |
| 138 | Ga0068859_100006392 | 3300005617 | Bacteria | 11956 |
| 139 | Ga0068859_100041433 | 3300005617 | Bacteria | 4625 |
| 140 | Ga0068859_100085150 | 3300005617 | Bacteria | 3206 |
| 141 | Ga0068859_100632179 | 3300005617 | Bacteria | 1163 |
| 142 | Ga0068864_100015505 | 3300005618 | Bacteria | 6337 |
| 143 | Ga0068864_100022648 | 3300005618 | Bacteria | 5269 |
| 144 | Ga0068864_100030452 | 3300005618 | Unclassified | 4574 |
| 145 | Ga0068864_100054827 | 3300005618 | Bacteria | 3441 |
| 146 | Ga0068861_100005774 | 3300005719 | Bacteria | 8398 |
| 147 | Ga0068861_100033621 | 3300005719 | Bacteria | 3785 |
| 148 | Ga0068861_100168189 | 3300005719 | Unclassified | 1815 |
| 149 | Ga0068870_10002247 | 3300005840 | Bacteria | 8022 |
| 150 | Ga0068870_10020503 | 3300005840 | Bacteria | 3220 |
| 151 | Ga0068870_10041255 | 3300005840 | Bacteria | 2397 |
| 152 | Ga0068870_10053893 | 3300005840 | Bacteria | 2138 |
| 153 | Ga0068863_100016660 | 3300005841 | Bacteria | 7052 |
| 154 | Ga0068863_100037284 | 3300005841 | Bacteria | 4629 |
| 155 | Ga0068863_100084580 | 3300005841 | Bacteria | 3006 |
| 156 | Ga0068858_100008010 | 3300005842 | Bacteria | 10180 |
| 157 | Ga0068858_100138947 | 3300005842 | Unclassified | 2280 |
| 158 | Ga0068858_100140746 | 3300005842 | Bacteria | 2265 |
| 159 | Ga0068860_100088839 | 3300005843 | Bacteria | 2942 |
| 160 | Ga0068860_100150549 | 3300005843 | Unclassified | 2240 |
| 161 | Ga0068862_100004233 | 3300005844 | Bacteria | 12157 |
| 162 | Ga0068862_100108706 | 3300005844 | Bacteria | 2432 |
| 163 | Ga0068862_100145040 | 3300005844 | Bacteria | 2109 |
| 164 | Ga0081539_10000093 | 3300005985 | Bacteria | 207314 |
| 165 | Ga0081539_10001997 | 3300005985 | Bacteria | 30967 |
| 166 | Ga0081539_10008783 | 3300005985 | Bacteria | 8660 |
| 167 | Ga0075365_10003211 | 3300006038 | Bacteria | 8360 |
| 168 | Ga0075364_10016517 | 3300006051 | Bacteria | 4593 |
| 169 | Ga0075367_10005389 | 3300006178 | Bacteria | 6346 |
| 170 | Ga0075367_10210203 | 3300006178 | Bacteria | 1216 |
| 171 | Ga0075366_10030064 | 3300006195 | Bacteria | 3192 |
| 172 | Ga0075366_10064074 | 3300006195 | Bacteria | 2185 |
| 173 | Ga0097621_100018708 | 3300006237 | Bacteria | 5300 |
| 174 | Ga0075370_10060517 | 3300006353 | Bacteria | 2157 |
| 175 | Ga0068871_100119157 | 3300006358 | Bacteria | 2228 |
| 176 | Ga0075428_100001255 | 3300006844 | Bacteria | 27133 |
| 177 | Ga0075428_100004233 | 3300006844 | Bacteria | 15796 |
| 178 | Ga0075428_100023809 | 3300006844 | Bacteria | 6776 |
| 179 | Ga0075428_100030417 | 3300006844 | Bacteria | 5971 |
| 180 | Ga0075428_100034854 | 3300006844 | Bacteria | 5550 |
| 181 | Ga0075428_100082065 | 3300006844 | Unclassified | 3518 |
| 182 | Ga0075428_100156350 | 3300006844 | Bacteria | 2477 |
| 183 | Ga0075428_100196420 | 3300006844 | Bacteria | 2182 |
| 184 | Ga0075428_100291906 | 3300006844 | Bacteria | 1754 |
| 185 | Ga0075428_100429726 | 3300006844 | Bacteria | 1415 |
| 186 | Ga0075430_100001090 | 3300006846 | Bacteria | 21567 |
| 187 | Ga0075430_100002851 | 3300006846 | Bacteria | 14473 |
| 188 | Ga0075430_100005495 | 3300006846 | Bacteria | 10709 |
| 189 | Ga0075430_100009021 | 3300006846 | Bacteria | 8429 |
| 190 | Ga0075430_100033567 | 3300006846 | Bacteria | 4356 |
| 191 | Ga0075430_100062744 | 3300006846 | Bacteria | 3121 |
| 192 | Ga0075431_100004139 | 3300006847 | Bacteria | 14158 |
| 193 | Ga0075431_100013770 | 3300006847 | Bacteria | 8168 |
| 194 | Ga0075431_100080482 | 3300006847 | Bacteria | 3363 |
| 195 | Ga0075431_100122105 | 3300006847 | Bacteria | 2688 |
| 196 | Ga0075431_100240950 | 3300006847 | Bacteria | 1840 |
| 197 | Ga0075433_10005324 | 3300006852 | Bacteria | 10093 |
| 198 | Ga0075433_10019804 | 3300006852 | Bacteria | 5615 |
| 199 | Ga0075433_10021868 | 3300006852 | Bacteria | 5366 |
| 200 | Ga0075433_10033893 | 3300006852 | Unclassified | 4381 |
| 201 | Ga0075433_10052443 | 3300006852 | Bacteria | 3554 |
| 202 | Ga0075434_100001711 | 3300006871 | Bacteria | 18790 |
| 203 | Ga0075434_100001730 | 3300006871 | Bacteria | 18736 |
| 204 | Ga0075434_100030412 | 3300006871 | Bacteria | 5317 |
| 205 | Ga0075434_100046243 | 3300006871 | Unclassified | 4319 |
| 206 | Ga0075434_100166817 | 3300006871 | Unclassified | 2222 |
| 207 | Ga0075434_100490664 | 3300006871 | Bacteria | 1249 |
| 208 | Ga0075429_100001936 | 3300006880 | Bacteria | 17171 |
| 209 | Ga0075429_100011739 | 3300006880 | Bacteria | 7598 |
| 210 | Ga0075429_100013624 | 3300006880 | Bacteria | 7054 |
| 211 | Ga0075429_100041462 | 3300006880 | Bacteria | 4009 |
| 212 | Ga0075429_100066927 | 3300006880 | Unclassified | 3127 |
| 213 | Ga0068865_100036934 | 3300006881 | Bacteria | 3296 |
| 214 | Ga0068865_100105801 | 3300006881 | Unclassified | 2067 |
| 215 | Ga0068865_100127457 | 3300006881 | Bacteria | 1902 |
| 216 | Ga0097620_100000459 | 3300006931 | Bacteria | 40396 |
| 217 | Ga0097620_100006392 | 3300006931 | Bacteria | 11956 |
| 218 | Ga0097620_100041434 | 3300006931 | Bacteria | 4625 |
| 219 | Ga0097620_100085145 | 3300006931 | Bacteria | 3206 |
| 220 | Ga0097620_100632126 | 3300006931 | Bacteria | 1163 |
| 221 | Ga0075435_100004581 | 3300007076 | Bacteria | 9517 |
| 222 | Ga0075435_100028340 | 3300007076 | Bacteria | 4391 |
| 223 | Ga0075435_100108242 | 3300007076 | Unclassified | 2309 |
| 224 | Ga0075435_100245507 | 3300007076 | Unclassified | 1523 |
| 225 | Ga0105240_10530511 | 3300009093 | Bacteria | 1305 |
| 226 | Ga0111539_10000040 | 3300009094 | Bacteria | 136085 |
| 227 | Ga0111539_10000465 | 3300009094 | Bacteria | 50988 |
| 228 | Ga0111539_10002493 | 3300009094 | Bacteria | 24401 |
| 229 | Ga0111539_10004729 | 3300009094 | Bacteria | 17791 |
| 230 | Ga0111539_10006884 | 3300009094 | Bacteria | 14603 |
| 231 | Ga0111539_10007204 | 3300009094 | Bacteria | 14254 |
| 232 | Ga0111539_10013195 | 3300009094 | Bacteria | 10331 |
| 233 | Ga0111539_10014889 | 3300009094 | Bacteria | 9695 |
| 234 | Ga0111539_10017801 | 3300009094 | Bacteria | 8798 |
| 235 | Ga0111539_10076513 | 3300009094 | Bacteria | 3940 |
| 236 | Ga0111539_10192573 | 3300009094 | Bacteria | 2379 |
| 237 | Ga0111539_10240544 | 3300009094 | Bacteria | 2107 |
| 238 | Ga0111539_10255928 | 3300009094 | Unclassified | 2039 |
| 239 | Ga0111539_10756038 | 3300009094 | Bacteria | 1131 |
| 240 | Ga0105245_10016854 | 3300009098 | Bacteria | 6379 |
| 241 | Ga0114129_10002401 | 3300009147 | Bacteria | 26029 |
| 242 | Ga0114129_10004302 | 3300009147 | Bacteria | 20120 |
| 243 | Ga0114129_10005462 | 3300009147 | Bacteria | 17965 |
| 244 | Ga0114129_10006077 | 3300009147 | Bacteria | 17112 |
| 245 | Ga0114129_10019676 | 3300009147 | Bacteria | 9609 |
| 246 | Ga0114129_10027295 | 3300009147 | Bacteria | 8084 |
| 247 | Ga0114129_10143778 | 3300009147 | Bacteria | 3268 |
| 248 | Ga0114129_10166422 | 3300009147 | Bacteria | 3008 |
| 249 | Ga0114129_10548740 | 3300009147 | Bacteria | 1503 |
| 250 | Ga0114129_10580200 | 3300009147 | Bacteria | 1455 |
| 251 | Ga0105243_10026115 | 3300009148 | Bacteria | 4469 |
| 252 | Ga0105243_10026216 | 3300009148 | Bacteria | 4461 |
| 253 | Ga0105243_10061941 | 3300009148 | Bacteria | 2994 |
| 254 | Ga0105243_10555964 | 3300009148 | Bacteria | 1097 |
| 255 | Ga0105242_10096002 | 3300009176 | Bacteria | 2503 |
| 256 | Ga0105248_10014948 | 3300009177 | Bacteria | 8545 |
| 257 | Ga0105248_10040061 | 3300009177 | Bacteria | 5251 |
| 258 | Ga0105248_10133973 | 3300009177 | Unclassified | 2796 |
| 259 | Ga0105249_10006847 | 3300009553 | Bacteria | 9940 |
| 260 | Ga0105249_10026619 | 3300009553 | Bacteria | 5215 |
| 261 | Ga0105249_10278407 | 3300009553 | Bacteria | 1670 |
| 262 | Ga0157374_10097598 | 3300013296 | Bacteria | 2812 |
| 263 | Ga0157374_10297420 | 3300013296 | Bacteria | 1596 |
| 264 | Ga0157378_10391080 | 3300013297 | Unclassified | 1368 |
| 265 | Ga0157378_10670008 | 3300013297 | Bacteria | 1055 |
| 266 | Ga0163162_10005469 | 3300013306 | Bacteria | 12276 |
| 267 | Ga0157375_10009065 | 3300013308 | Bacteria | 8710 |
| 268 | Ga0163163_10077478 | 3300014325 | Bacteria | 3320 |
| 269 | Ga0157380_10000369 | 3300014326 | Bacteria | 27154 |
| 270 | Ga0157380_10019490 | 3300014326 | Bacteria | 5056 |
| 271 | Ga0157380_10064470 | 3300014326 | Bacteria | 2941 |
| 272 | Ga0157380_10076442 | 3300014326 | Bacteria | 2725 |
| 273 | Ga0157380_10183238 | 3300014326 | Unclassified | 1842 |
| 274 | Ga0157380_10215393 | 3300014326 | Unclassified | 1715 |
| 275 | Ga0157380_10219053 | 3300014326 | Bacteria | 1701 |
| 276 | Ga0157380_10294881 | 3300014326 | Unclassified | 1491 |
| 277 | Ga0157377_10020689 | 3300014745 | Bacteria | 3451 |
| 278 | Ga0157377_10024599 | 3300014745 | Bacteria | 3202 |
| 279 | Ga0157377_10048258 | 3300014745 | Bacteria | 2388 |
| 280 | Ga0157377_10118619 | 3300014745 | Bacteria | 1600 |
| 281 | Ga0157377_10205602 | 3300014745 | Bacteria | 1252 |
| 282 | Ga0157379_10014028 | 3300014968 | Bacteria | 7022 |
| 283 | Ga0157376_10048059 | 3300014969 | Bacteria | 3526 |
| 284 | Ga0157376_10120808 | 3300014969 | Bacteria | 2321 |
| 285 | Ga0163161_10047090 | 3300017792 | Bacteria | 3113 |
| 286 | Ga0163161_10087708 | 3300017792 | Unclassified | 2299 |
| 287 | Ga0207697_10015924 | 3300025315 | Bacteria | 3102 |
| 288 | Ga0207682_10000139 | 3300025893 | Bacteria | 32685 |
| 289 | Ga0207682_10004632 | 3300025893 | Bacteria | 5714 |
| 290 | Ga0207682_10008731 | 3300025893 | Bacteria | 4009 |
| 291 | Ga0207688_10001936 | 3300025901 | Bacteria | 11088 |
| 292 | Ga0207688_10003546 | 3300025901 | Bacteria | 8516 |
| 293 | Ga0207688_10030191 | 3300025901 | Bacteria | 2988 |
| 294 | Ga0207688_10143818 | 3300025901 | Bacteria | 1405 |
| 295 | Ga0207680_10069597 | 3300025903 | Unclassified | 2175 |
| 296 | Ga0207647_10130937 | 3300025904 | Bacteria | 1474 |
| 297 | Ga0207645_10002241 | 3300025907 | Bacteria | 15394 |
| 298 | Ga0207645_10009375 | 3300025907 | Bacteria | 6774 |
| 299 | Ga0207645_10018389 | 3300025907 | Bacteria | 4597 |
| 300 | Ga0207645_10195299 | 3300025907 | Unclassified | 1330 |
| 301 | Ga0207643_10001178 | 3300025908 | Bacteria | 15524 |
| 302 | Ga0207643_10006620 | 3300025908 | Bacteria | 6214 |
| 303 | Ga0207643_10008746 | 3300025908 | Bacteria | 5433 |
| 304 | Ga0207643_10035502 | 3300025908 | Bacteria | 2796 |
| 305 | Ga0207662_10005189 | 3300025918 | Bacteria | 6914 |
| 306 | Ga0207662_10044721 | 3300025918 | Bacteria | 2615 |
| 307 | Ga0207662_10214707 | 3300025918 | Bacteria | 1250 |
| 308 | Ga0207649_10113047 | 3300025920 | Bacteria | 1818 |
| 309 | Ga0207652_10104468 | 3300025921 | Bacteria | 2506 |
| 310 | Ga0207681_10019134 | 3300025923 | Bacteria | 4324 |
| 311 | Ga0207681_10026181 | 3300025923 | Bacteria | 3760 |
| 312 | Ga0207681_10029582 | 3300025923 | Bacteria | 3560 |
| 313 | Ga0207681_10061657 | 3300025923 | Unclassified | 2579 |
| 314 | Ga0207681_10066903 | 3300025923 | Bacteria | 2489 |
| 315 | Ga0207681_10103711 | 3300025923 | Bacteria | 2056 |
| 316 | Ga0207681_10127225 | 3300025923 | Bacteria | 1878 |
| 317 | Ga0207681_10221775 | 3300025923 | Bacteria | 1463 |
| 318 | Ga0207650_10048273 | 3300025925 | Unclassified | 3140 |
| 319 | Ga0207650_10092664 | 3300025925 | Unclassified | 2311 |
| 320 | Ga0207659_10000617 | 3300025926 | Bacteria | 21204 |
| 321 | Ga0207659_10031802 | 3300025926 | Bacteria | 3616 |
| 322 | Ga0207659_10093995 | 3300025926 | Bacteria | 2245 |
| 323 | Ga0207659_10154396 | 3300025926 | Bacteria | 1796 |
| 324 | Ga0207659_10256143 | 3300025926 | Bacteria | 1422 |
| 325 | Ga0207659_10314136 | 3300025926 | Bacteria | 1291 |
| 326 | Ga0207700_10039336 | 3300025928 | Unclassified | 3442 |
| 327 | Ga0207644_10070550 | 3300025931 | Bacteria | 2554 |
| 328 | Ga0207690_10135769 | 3300025932 | Unclassified | 1806 |
| 329 | Ga0207706_10004608 | 3300025933 | Bacteria | 12938 |
| 330 | Ga0207706_10008838 | 3300025933 | Bacteria | 9271 |
| 331 | Ga0207706_10101887 | 3300025933 | Unclassified | 2526 |
| 332 | Ga0207706_10137874 | 3300025933 | Bacteria | 2146 |
| 333 | Ga0207706_10217965 | 3300025933 | Bacteria | 1672 |
| 334 | Ga0207709_10016583 | 3300025935 | Bacteria | 4097 |
| 335 | Ga0207670_10004689 | 3300025936 | Bacteria | 7412 |
| 336 | Ga0207670_10013796 | 3300025936 | Bacteria | 4778 |
| 337 | Ga0207670_10049236 | 3300025936 | Bacteria | 2817 |
| 338 | Ga0207669_10003433 | 3300025937 | Bacteria | 6849 |
| 339 | Ga0207704_10009137 | 3300025938 | Bacteria | 4769 |
| 340 | Ga0207704_10035062 | 3300025938 | Bacteria | 2870 |
| 341 | Ga0207704_10044601 | 3300025938 | Bacteria | 2628 |
| 342 | Ga0207704_10104335 | 3300025938 | Bacteria | 1898 |
| 343 | Ga0207691_10005343 | 3300025940 | Bacteria | 12400 |
| 344 | Ga0207691_10007757 | 3300025940 | Bacteria | 10334 |
| 345 | Ga0207691_10015851 | 3300025940 | Bacteria | 7163 |
| 346 | Ga0207691_10027869 | 3300025940 | Bacteria | 5293 |
| 347 | Ga0207691_10117911 | 3300025940 | Bacteria | 2355 |
| 348 | Ga0207691_10120332 | 3300025940 | Bacteria | 2328 |
| 349 | Ga0207691_10128683 | 3300025940 | Bacteria | 2238 |
| 350 | Ga0207711_10137987 | 3300025941 | Bacteria | 2192 |
| 351 | Ga0207711_10206169 | 3300025941 | Bacteria | 1795 |
| 352 | Ga0207689_10001767 | 3300025942 | Bacteria | 20394 |
| 353 | Ga0207689_10032790 | 3300025942 | Bacteria | 4318 |
| 354 | Ga0207689_10075257 | 3300025942 | Bacteria | 2775 |
| 355 | Ga0207689_10095531 | 3300025942 | Bacteria | 2441 |
| 356 | Ga0207689_10095537 | 3300025942 | Bacteria | 2441 |
| 357 | Ga0207661_10025066 | 3300025944 | Unclassified | 4530 |
| 358 | Ga0207679_10013217 | 3300025945 | Bacteria | 5408 |
| 359 | Ga0207679_10048707 | 3300025945 | Unclassified | 3087 |
| 360 | Ga0207679_10199730 | 3300025945 | Bacteria | 1669 |
| 361 | Ga0207651_10002809 | 3300025960 | Bacteria | 8373 |
| 362 | Ga0207651_10007566 | 3300025960 | Bacteria | 5795 |
| 363 | Ga0207651_10047572 | 3300025960 | Bacteria | 2893 |
| 364 | Ga0207651_10088650 | 3300025960 | Bacteria | 2256 |
| 365 | Ga0207651_10238769 | 3300025960 | Bacteria | 1480 |
| 366 | Ga0207712_10007908 | 3300025961 | Bacteria | 6718 |
| 367 | Ga0207640_10256497 | 3300025981 | Bacteria | 1360 |
| 368 | Ga0207658_10048860 | 3300025986 | Bacteria | 3105 |
| 369 | Ga0207658_10401637 | 3300025986 | Bacteria | 1205 |
| 370 | Ga0207677_10093036 | 3300026023 | Bacteria | 2197 |
| 371 | Ga0207703_10015787 | 3300026035 | Bacteria | 5890 |
| 372 | Ga0207703_10042575 | 3300026035 | Bacteria | 3643 |
| 373 | Ga0207703_10222426 | 3300026035 | Bacteria | 1689 |
| 374 | Ga0207678_10034790 | 3300026067 | Bacteria | 4388 |
| 375 | Ga0207708_10009001 | 3300026075 | Bacteria | 7390 |
| 376 | Ga0207708_10019636 | 3300026075 | Bacteria | 5096 |
| 377 | Ga0207708_10033389 | 3300026075 | Bacteria | 3910 |
| 378 | Ga0207708_10104785 | 3300026075 | Unclassified | 2191 |
| 379 | Ga0207708_10137666 | 3300026075 | Bacteria | 1913 |
| 380 | Ga0207708_10175154 | 3300026075 | Bacteria | 1701 |
| 381 | Ga0207708_10220470 | 3300026075 | Bacteria | 1519 |
| 382 | Ga0207641_10052416 | 3300026088 | Bacteria | 3455 |
| 383 | Ga0207641_10118438 | 3300026088 | Bacteria | 2359 |
| 384 | Ga0207641_10271722 | 3300026088 | Bacteria | 1591 |
| 385 | Ga0207648_10000375 | 3300026089 | Bacteria | 49109 |
| 386 | Ga0207648_10011159 | 3300026089 | Bacteria | 8476 |
| 387 | Ga0207648_10014276 | 3300026089 | Bacteria | 7342 |
| 388 | Ga0207648_10087878 | 3300026089 | Bacteria | 2713 |
| 389 | Ga0207648_10100505 | 3300026089 | Bacteria | 2534 |
| 390 | Ga0207676_10270722 | 3300026095 | Bacteria | 1538 |
| 391 | Ga0207674_10038952 | 3300026116 | Bacteria | 4929 |
| 392 | Ga0207674_10042147 | 3300026116 | Bacteria | 4717 |
| 393 | Ga0207674_10149243 | 3300026116 | Unclassified | 2295 |
| 394 | Ga0207674_10179429 | 3300026116 | Bacteria | 2069 |
| 395 | Ga0207675_100005097 | 3300026118 | Bacteria | 12640 |
| 396 | Ga0207675_100005161 | 3300026118 | Bacteria | 12572 |
| 397 | Ga0207675_100080696 | 3300026118 | Bacteria | 3050 |
| 398 | Ga0207683_10028347 | 3300026121 | Bacteria | 4841 |
| 399 | Ga0207683_10101372 | 3300026121 | Bacteria | 2570 |
| 400 | Ga0207683_10102431 | 3300026121 | Bacteria | 2557 |
| 401 | Ga0207683_10102820 | 3300026121 | Bacteria | 2552 |
| 402 | Ga0207683_10167334 | 3300026121 | Unclassified | 1990 |
| 403 | Ga0207428_10000750 | 3300027907 | Bacteria | 37156 |
| 404 | Ga0207428_10001319 | 3300027907 | Bacteria | 26409 |
| 405 | Ga0207428_10003324 | 3300027907 | Bacteria | 15634 |
| 406 | Ga0207428_10005991 | 3300027907 | Bacteria | 11256 |
| 407 | Ga0207428_10006349 | 3300027907 | Bacteria | 10935 |
| 408 | Ga0207428_10013109 | 3300027907 | Bacteria | 7258 |
| 409 | Ga0207428_10032221 | 3300027907 | Bacteria | 4313 |
| 410 | Ga0268265_10000263 | 3300028380 | Bacteria | 59820 |
| 411 | Ga0268265_10016194 | 3300028380 | Bacteria | 5118 |
| 412 | Ga0268265_10108634 | 3300028380 | Unclassified | 2259 |
| 413 | Ga0268265_10217867 | 3300028380 | Bacteria | 1668 |
| 414 | Ga0268265_10252515 | 3300028380 | Bacteria | 1563 |
| 415 | Ga0268265_10336916 | 3300028380 | Bacteria | 1372 |
| 416 | Ga0268264_10002400 | 3300028381 | Bacteria | 16495 |
| 417 | Ga0268264_10049927 | 3300028381 | Bacteria | 3482 |
| 418 | Ga0268264_10092345 | 3300028381 | Bacteria | 2613 |
| 419 | Ga0268264_10126791 | 3300028381 | Unclassified | 2257 |
| 420 | Ga0307408_100000559 | 3300031548 | Bacteria | 32129 |
| 421 | Ga0307407_10013328 | 3300031903 | Bacteria | 3986 |
| 422 | Ga0307409_100034105 | 3300031995 | Bacteria | 3713 |
| 423 | Ga0307416_100014688 | 3300032002 | Bacteria | 5380 |
| 424 | Ga0307416_100171469 | 3300032002 | Bacteria | 2020 |
| 425 | Ga0307416_100351958 | 3300032002 | Bacteria | 1491 |
| 426 | Ga0307416_100516167 | 3300032002 | Bacteria | 1262 |
| 427 | Ga0307411_10026784 | 3300032005 | Bacteria | 3476 |
| 428 | Ga0307411_10106555 | 3300032005 | Bacteria | 1995 |
| 429 | Ga0307415_100042982 | 3300032126 | Bacteria | 3011 |
| 430 | Ga0373932_0015725 | 3300035112 | Bacteria | 1922 |
| 431 | Ga0373931_0153463 | 3300035691 | Bacteria | 1344 |
| 432 | Ga0373933_0041138 | 3300035724 | Bacteria | 2727 |
| 433 | Ga0373947_0034276 | 3300035725 | Bacteria | 3002 |
| 434 | Ga0373947_0191510 | 3300035725 | Unclassified | 1335 |
| 435 | Ga0373937_0006141 | 3300036401 | Bacteria | 10343 |
| 436 | Ga0373925_0035988 | 3300037068 | Bacteria | 3654 |
| 437 | Ga0451807_2469453 | 3300041486 | Bacteria | 1443 |
| 438 | Ga0439450_005826 | 3300042008 | Bacteria | 2189 |
| 439 | Ga0439450_013275 | 3300042008 | Bacteria | 1652 |
| 440 | Ga0450923_005171 | 3300042125 | Unclassified | 2091 |
| 441 | Ga0439464_0005119 | 3300042439 | Bacteria | 3374 |
| 442 | Ga0453683_0214270 | 3300044673 | Bacteria | 1224 |
| 443 | Ga0451576_0024372 | 3300045051 | Bacteria | 6535 |
| 444 | Ga0451576_0029521 | 3300045051 | Bacteria | 5867 |
| 445 | Ga0451576_0159236 | 3300045051 | Bacteria | 2355 |
| 446 | Ga0451576_0361296 | 3300045051 | Bacteria | 1521 |
| 447 | Ga0495603_0084178 | 3300046455 | Bacteria | 1862 |
| 448 | Ga0495629_0003222 | 3300046459 | Bacteria | 12351 |
| 449 | Ga0495582_0033481 | 3300046473 | Bacteria | 2825 |
| 450 | Ga0495582_0144120 | 3300046473 | Unclassified | 1351 |
| 451 | Ga0495584_0122747 | 3300046491 | Bacteria | 1316 |
| 452 | Ga0495594_0087102 | 3300046499 | Unclassified | 1747 |
| 453 | Ga0495643_0003874 | 3300046522 | Bacteria | 10750 |
| 454 | Ga0495642_0013249 | 3300046528 | Bacteria | 3187 |
| 455 | Ga0495609_0035857 | 3300046538 | Unclassified | 2243 |
| 456 | Ga0495621_0000764 | 3300046539 | Bacteria | 8145 |
| 457 | Ga0495622_0088430 | 3300046557 | Bacteria | 1424 |
| 458 | Ga0495633_0070797 | 3300046558 | Bacteria | 1627 |
| 459 | Ga0495659_0026780 | 3300046664 | Unclassified | 1984 |
| 460 | Ga0495659_0039453 | 3300046664 | Bacteria | 1679 |
| 461 | Ga0495659_0079583 | 3300046664 | Bacteria | 1241 |
| 462 | Ga0495588_0001691 | 3300046674 | Bacteria | 9392 |
| 463 | Ga0495670_0052328 | 3300046691 | Bacteria | 2044 |
| 464 | Ga0495636_0006616 | 3300047318 | Bacteria | 4556 |
| 465 | Ga0495676_0041004 | 3300047321 | Bacteria | 3815 |
| 466 | Ga0496109_0239044 | 3300048912 | Bacteria | 1709 |
| 467 | Ga0496113_0255267 | 3300048916 | Bacteria | 1400 |
| 468 | Ga0501034_0056321 | 3300049571 | Bacteria | 3956 |
| 469 | Ga0501039_0006794 | 3300049575 | Bacteria | 8701 |
| 470 | Ga0501040_0044695 | 3300049576 | Unclassified | 3020 |
| 471 | Ga0501040_0129415 | 3300049576 | Bacteria | 1774 |
| 472 | Ga0501041_0004230 | 3300049577 | Bacteria | 8311 |
| 473 | Ga0501042_0004487 | 3300049578 | Bacteria | 8905 |
| 474 | Ga0501072_0109737 | 3300049588 | Unclassified | 2196 |
| 475 | Ga0501075_0007297 | 3300049591 | Bacteria | 7665 |
| 476 | Ga0501075_0127704 | 3300049591 | Bacteria | 1936 |
| 477 | Ga0501076_0040803 | 3300049592 | Unclassified | 3648 |
| 478 | Ga0501217_012511 | 3300049661 | Bacteria | 1891 |
| 479 | Ga0501217_025215 | 3300049661 | Unclassified | 1429 |
| 480 | Ga0501079_0095319 | 3300049741 | Bacteria | 2306 |
| 481 | Ga0501080_0149697 | 3300049742 | Bacteria | 2158 |
| 482 | Ga0501081_0042538 | 3300049743 | Unclassified | 3113 |
| 483 | Ga0501083_0360123 | 3300049744 | Bacteria | 946 |
| 484 | Ga0501044_0026417 | 3300049823 | Bacteria | 6144 |
| 485 | Ga0501045_0010502 | 3300049824 | Bacteria | 6486 |
| 486 | Ga0501045_0115477 | 3300049824 | Bacteria | 1991 |
| 487 | nmdc:mga03683_4517_c1 | 3300050489 | Bacteria | 4629 |
| 488 | nmdc:mga00v17_140757_c1 | 3300050491 | Bacteria | 1547 |
| 489 | nmdc:mga00v17_1939_c1 | 3300050491 | Bacteria | 10684 |
| 490 | nmdc:mga0yw44_98960_c1 | 3300050492 | Bacteria | 1855 |
| 491 | nmdc:mga0k408_29825_c1 | 3300050493 | Bacteria | 3107 |
| 492 | nmdc:mga06z11_35931_c1 | 3300050494 | Bacteria | 2442 |
| 493 | nmdc:mga06z11_43569_c1 | 3300050494 | Bacteria | 2259 |
| 494 | nmdc:mga05p37_108082_c1 | 3300050507 | Unclassified | 3422 |
| 495 | nmdc:mga05p37_1148_c1 | 3300050507 | Bacteria | 30482 |
| 496 | nmdc:mga05p37_163460_c1 | 3300050507 | Bacteria | 2718 |
| 497 | nmdc:mga05p37_320977_c1 | 3300050507 | Unclassified | 1833 |
| 498 | nmdc:mga05p37_33553_c1 | 3300050507 | Bacteria | 6287 |
| 499 | nmdc:mga05p37_341376_c1 | 3300050507 | Unclassified | 1766 |
| 500 | nmdc:mga05p37_3595_c1 | 3300050507 | Bacteria | 18111 |
| 501 | nmdc:mga05p37_400215_c1 | 3300050507 | Bacteria | 1603 |
| 502 | nmdc:mga05p37_433259_c1 | 3300050507 | Bacteria | 1527 |
| 503 | nmdc:mga05p37_4471_c1 | 3300050507 | Bacteria | 16336 |
| 504 | nmdc:mga05p37_552323_c1 | 3300050507 | Bacteria | 1311 |
| 505 | nmdc:mga09592_115130_c1 | 3300050508 | Unclassified | 2308 |
| 506 | nmdc:mga09592_24167_c1 | 3300050508 | Bacteria | 5024 |
| 507 | nmdc:mga09592_59957_c1 | 3300050508 | Unclassified | 3217 |
| 508 | nmdc:mga09592_69785_c1 | 3300050508 | Bacteria | 2981 |
| 509 | nmdc:mga09592_86496_c1 | 3300050508 | Unclassified | 2675 |
| 510 | nmdc:mga0qj67_276313_c1 | 3300050509 | Bacteria | 1362 |
| 511 | nmdc:mga0qj67_30242_c1 | 3300050509 | Bacteria | 4213 |
| 512 | nmdc:mga0qj67_480202_c1 | 3300050509 | Bacteria | 1000 |
| 513 | nmdc:mga0qj67_4864_c2 | 3300050509 | Bacteria | 9271 |
| 514 | nmdc:mga0qj67_70020_c1 | 3300050509 | Bacteria | 2798 |
| 515 | nmdc:mga06r32_349650_c1 | 3300050510 | Bacteria | 1463 |
| 516 | nmdc:mga06r32_39152_c1 | 3300050510 | Unclassified | 4497 |
| 517 | nmdc:mga06r32_81377_c1 | 3300050510 | Bacteria | 3154 |
| 518 | nmdc:mga06r32_85540_c1 | 3300050510 | Unclassified | 3075 |
| 519 | nmdc:mga08y16_105820_c1 | 3300050511 | Bacteria | 2929 |
| 520 | nmdc:mga08y16_1149_c1 | 3300050511 | Bacteria | 26073 |
| 521 | nmdc:mga08y16_14292_c1 | 3300050511 | Bacteria | 8357 |
| 522 | nmdc:mga08y16_156_c1 | 3300050511 | Bacteria | 59323 |
| 523 | nmdc:mga08y16_178577_c1 | 3300050511 | Bacteria | 2205 |
| 524 | nmdc:mga08y16_25196_c1 | 3300050511 | Bacteria | 6272 |
| 525 | nmdc:mga08y16_339523_c1 | 3300050511 | Unclassified | 1544 |
| 526 | nmdc:mga08y16_355173_c1 | 3300050511 | Unclassified | 1505 |
| 527 | nmdc:mga08y16_40753_c1 | 3300050511 | Bacteria | 4866 |
| 528 | nmdc:mga08y16_639_c1 | 3300050511 | Bacteria | 32927 |
| 529 | nmdc:mga08y16_83_c1 | 3300050511 | Bacteria | 80182 |
| 530 | nmdc:mga0n895_130606_c1 | 3300050512 | Unclassified | 2537 |
| 531 | nmdc:mga0n895_137637_c1 | 3300050512 | Bacteria | 2469 |
| 532 | nmdc:mga0n895_300185_c1 | 3300050512 | Unclassified | 1628 |
| 533 | nmdc:mga0n895_31123_c1 | 3300050512 | Bacteria | 5106 |
| 534 | nmdc:mga0n895_3603_c1 | 3300050512 | Bacteria | 12518 |
| 535 | nmdc:mga0n895_487445_c1 | 3300050512 | Bacteria | 1243 |
| 536 | nmdc:mga0n895_51493_c1 | 3300050512 | Bacteria | 4039 |
| 537 | nmdc:mga0rr50_206474_c1 | 3300050513 | Unclassified | 1617 |
| 538 | nmdc:mga0rr50_407615_c1 | 3300050513 | Bacteria | 1149 |
| 539 | nmdc:mga0rr50_5035_c1 | 3300050513 | Bacteria | 7833 |
| 540 | nmdc:mga0rr50_773_c1 | 3300050513 | Bacteria | 17222 |
| 541 | nmdc:mga0a205_229967_c1 | 3300050515 | Bacteria | 1738 |
| 542 | nmdc:mga0a205_231649_c1 | 3300050515 | Bacteria | 1730 |
| 543 | nmdc:mga0a205_38252_c1 | 3300050515 | Bacteria | 4615 |
| 544 | nmdc:mga0a205_6894_c1 | 3300050515 | Bacteria | 10270 |
| 545 | nmdc:mga0a205_9084_c1 | 3300050515 | Bacteria | 9068 |
| 546 | Ga0500556_0016051 | 3300053104 | Bacteria | 2323 |
| 547 | Ga0501084_0079406 | 3300054114 | Bacteria | 2750 |
| 548 | Ga0590071_000024 | 3300059421 | Bacteria | 39075 |
| 549 | Ga0590074_000167 | 3300059423 | Bacteria | 8029 |
| 550 | Ga0590075_000297 | 3300059424 | Bacteria | 14053 |
| 551 | Ga0590077_000948 | 3300059426 | Bacteria | 7399 |
| 552 | Ga0590077_006313 | 3300059426 | Bacteria | 2431 |
| 553 | Ga0501082_0027190 | 3300060353 | Unclassified | 4927 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006852 | Ga0075433_10033893 | Ga0075433_100338932 | 283 |
| 2 | 3300005444 | Ga0070694_100248969 | Ga0070694_1002489692 | 287 |
| 3 | 3300006846 | Ga0075430_100062744 | Ga0075430_1000627442 | 287 |
| 4 | 3300006880 | Ga0075429_100001936 | Ga0075429_1000019368 | 287 |
| 5 | 3300049744 | Ga0501083_0360123 | Ga0501083_0360123_21_929 | 289 |
| 6 | 3300050509 | nmdc:mga0qj67_480202_c1 | nmdc:mga0qj67_480202_c1_47_940 | 294 |
| 7 | 3300006844 | Ga0075428_100429726 | Ga0075428_1004297261 | 296 |
| 8 | 3300005334 | Ga0068869_100163743 | Ga0068869_1001637432 | 299 |
| 9 | 3300005617 | Ga0068859_100632179 | Ga0068859_1006321792 | 299 |
| 10 | 3300006931 | Ga0097620_100632126 | Ga0097620_1006321262 | 299 |
| 11 | 3300025942 | Ga0207689_10095537 | Ga0207689_100955374 | 299 |
| 12 | 3300005334 | Ga0068869_100198419 | Ga0068869_1001984193 | 300 |
| 13 | 3300005353 | Ga0070669_100105067 | Ga0070669_1001050673 | 300 |
| 14 | 3300005840 | Ga0068870_10053893 | Ga0068870_100538932 | 300 |
| 15 | 3300025923 | Ga0207681_10127225 | Ga0207681_101272253 | 300 |
| 16 | 3300025942 | Ga0207689_10095531 | Ga0207689_100955312 | 300 |
| 17 | 3300026121 | Ga0207683_10102820 | Ga0207683_101028202 | 300 |
| 18 | 3300028380 | Ga0268265_10336916 | Ga0268265_103369162 | 300 |
| 19 | 3300005334 | Ga0068869_100147466 | Ga0068869_1001474662 | 301 |
| 20 | 3300005354 | Ga0070675_100029687 | Ga0070675_1000296874 | 301 |
| 21 | 3300014326 | Ga0157380_10019490 | Ga0157380_100194907 | 301 |
| 22 | 3300025908 | Ga0207643_10006620 | Ga0207643_100066206 | 301 |
| 23 | 3300025926 | Ga0207659_10154396 | Ga0207659_101543961 | 301 |
| 24 | 3300026035 | Ga0207703_10222426 | Ga0207703_102224262 | 301 |
| 25 | 3300050508 | nmdc:mga09592_86496_c1 | nmdc:mga09592_86496_c1_403_1323 | 301 |
| 26 | 3300025904 | Ga0207647_10130937 | Ga0207647_101309372 | 302 |
| 27 | 3300005356 | Ga0070674_100088033 | Ga0070674_1000880331 | 304 |
| 28 | 3300050507 | nmdc:mga05p37_400215_c1 | nmdc:mga05p37_400215_c1_285_1205 | 304 |
| 29 | 3300005347 | Ga0070668_100313630 | Ga0070668_1003136302 | 305 |
| 30 | 3300005353 | Ga0070669_100033302 | Ga0070669_1000333024 | 305 |
| 31 | 3300005353 | Ga0070669_100041323 | Ga0070669_1000413233 | 305 |
| 32 | 3300005364 | Ga0070673_100327996 | Ga0070673_1003279962 | 305 |
| 33 | 3300005455 | Ga0070663_100022604 | Ga0070663_1000226042 | 305 |
| 34 | 3300005543 | Ga0070672_100193374 | Ga0070672_1001933742 | 305 |
| 35 | 3300005544 | Ga0070686_100106270 | Ga0070686_1001062702 | 305 |
| 36 | 3300025901 | Ga0207688_10143818 | Ga0207688_101438182 | 305 |
| 37 | 3300025903 | Ga0207680_10069597 | Ga0207680_100695973 | 305 |
| 38 | 3300025923 | Ga0207681_10061657 | Ga0207681_100616572 | 305 |
| 39 | 3300025923 | Ga0207681_10221775 | Ga0207681_102217752 | 305 |
| 40 | 3300025933 | Ga0207706_10101887 | Ga0207706_101018872 | 305 |
| 41 | 3300025940 | Ga0207691_10128683 | Ga0207691_101286832 | 305 |
| 42 | 3300026067 | Ga0207678_10034790 | Ga0207678_100347903 | 305 |
| 43 | 3300059421 | Ga0590071_000024 | Ga0590071_000024_26728_27663 | 305 |
| 44 | 3300059423 | Ga0590074_000167 | Ga0590074_000167_2452_3387 | 305 |
| 45 | 3300059424 | Ga0590075_000297 | Ga0590075_000297_11608_12543 | 305 |
| 46 | 3300059426 | Ga0590077_000948 | Ga0590077_000948_2277_3212 | 305 |
| 47 | 3300054114 | Ga0501084_0079406 | Ga0501084_0079406_1126_2058 | 308 |
| 48 | 3300005336 | Ga0070680_100108341 | Ga0070680_1001083412 | 310 |
| 49 | 3300005543 | Ga0070672_100340655 | Ga0070672_1003406552 | 310 |
| 50 | 3300026075 | Ga0207708_10220470 | Ga0207708_102204702 | 310 |
| 51 | 3300027907 | Ga0207428_10006349 | Ga0207428_100063493 | 311 |
| 52 | 3300005328 | Ga0070676_10174796 | Ga0070676_101747962 | 312 |
| 53 | 3300005333 | Ga0070677_10013120 | Ga0070677_100131202 | 312 |
| 54 | 3300006847 | Ga0075431_100013770 | Ga0075431_1000137703 | 312 |
| 55 | 3300009094 | Ga0111539_10255928 | Ga0111539_102559282 | 312 |
| 56 | 3300009177 | Ga0105248_10133973 | Ga0105248_101339733 | 312 |
| 57 | 3300025893 | Ga0207682_10008731 | Ga0207682_100087313 | 312 |
| 58 | 3300025907 | Ga0207645_10195299 | Ga0207645_101952991 | 312 |
| 59 | 3300025937 | Ga0207669_10003433 | Ga0207669_100034335 | 312 |
| 60 | 3300005441 | Ga0070700_100215905 | Ga0070700_1002159051 | 314 |
| 61 | 3300005468 | Ga0070707_100040857 | Ga0070707_1000408573 | 314 |
| 62 | 3300006844 | Ga0075428_100001255 | Ga0075428_10000125519 | 315 |
| 63 | 3300006846 | Ga0075430_100002851 | Ga0075430_1000028515 | 315 |
| 64 | 3300006847 | Ga0075431_100122105 | Ga0075431_1001221051 | 315 |
| 65 | 3300027907 | Ga0207428_10003324 | Ga0207428_1000332410 | 315 |
| 66 | 3300031548 | Ga0307408_100000559 | Ga0307408_1000005598 | 315 |
| 67 | 3300032002 | Ga0307416_100014688 | Ga0307416_1000146884 | 315 |
| 68 | 3300032005 | Ga0307411_10106555 | Ga0307411_101065552 | 315 |
| 69 | 3300035725 | Ga0373947_0034276 | Ga0373947_0034276_1979_2971 | 316 |
| 70 | 3300050507 | nmdc:mga05p37_433259_c1 | nmdc:mga05p37_433259_c1_427_1419 | 316 |
| 71 | 3300050515 | nmdc:mga0a205_229967_c1 | nmdc:mga0a205_229967_c1_733_1716 | 316 |
| 72 | 3300005290 | Ga0065712_10001274 | Ga0065712_100012744 | 317 |
| 73 | 3300005295 | Ga0065707_10114722 | Ga0065707_101147221 | 317 |
| 74 | 3300005440 | Ga0070705_100234836 | Ga0070705_1002348361 | 317 |
| 75 | 3300005840 | Ga0068870_10041255 | Ga0068870_100412552 | 317 |
| 76 | 3300006051 | Ga0075364_10016517 | Ga0075364_100165172 | 317 |
| 77 | 3300006178 | Ga0075367_10005389 | Ga0075367_100053892 | 317 |
| 78 | 3300006178 | Ga0075367_10210203 | Ga0075367_102102032 | 317 |
| 79 | 3300006195 | Ga0075366_10030064 | Ga0075366_100300642 | 317 |
| 80 | 3300006353 | Ga0075370_10060517 | Ga0075370_100605172 | 317 |
| 81 | 3300006846 | Ga0075430_100009021 | Ga0075430_1000090213 | 317 |
| 82 | 3300006847 | Ga0075431_100080482 | Ga0075431_1000804823 | 317 |
| 83 | 3300006871 | Ga0075434_100490664 | Ga0075434_1004906642 | 317 |
| 84 | 3300006880 | Ga0075429_100013624 | Ga0075429_1000136246 | 317 |
| 85 | 3300009094 | Ga0111539_10004729 | Ga0111539_1000472919 | 317 |
| 86 | 3300009094 | Ga0111539_10006884 | Ga0111539_100068847 | 317 |
| 87 | 3300009094 | Ga0111539_10240544 | Ga0111539_102405443 | 317 |
| 88 | 3300009147 | Ga0114129_10027295 | Ga0114129_100272953 | 317 |
| 89 | 3300009147 | Ga0114129_10580200 | Ga0114129_105802002 | 317 |
| 90 | 3300013296 | Ga0157374_10097598 | Ga0157374_100975984 | 317 |
| 91 | 3300014745 | Ga0157377_10024599 | Ga0157377_100245992 | 317 |
| 92 | 3300014745 | Ga0157377_10205602 | Ga0157377_102056022 | 317 |
| 93 | 3300014969 | Ga0157376_10120808 | Ga0157376_101208082 | 317 |
| 94 | 3300025918 | Ga0207662_10214707 | Ga0207662_102147072 | 317 |
| 95 | 3300025933 | Ga0207706_10137874 | Ga0207706_101378742 | 317 |
| 96 | 3300025960 | Ga0207651_10007566 | Ga0207651_100075666 | 317 |
| 97 | 3300025986 | Ga0207658_10401637 | Ga0207658_104016372 | 317 |
| 98 | 3300026118 | Ga0207675_100080696 | Ga0207675_1000806963 | 317 |
| 99 | 3300027907 | Ga0207428_10013109 | Ga0207428_100131097 | 317 |
| 100 | 3300027907 | Ga0207428_10032221 | Ga0207428_100322213 | 317 |
| 101 | 3300046664 | Ga0495659_0039453 | Ga0495659_0039453_256_1221 | 317 |
| 102 | 3300048912 | Ga0496109_0239044 | Ga0496109_0239044_38_1000 | 317 |
| 103 | 3300048916 | Ga0496113_0255267 | Ga0496113_0255267_206_1168 | 317 |
| 104 | 3300050489 | nmdc:mga03683_4517_c1 | nmdc:mga03683_4517_c1_1743_2702 | 317 |
| 105 | 3300050491 | nmdc:mga00v17_140757_c1 | nmdc:mga00v17_140757_c1_424_1383 | 317 |
| 106 | 3300050491 | nmdc:mga00v17_1939_c1 | nmdc:mga00v17_1939_c1_3566_4525 | 317 |
| 107 | 3300050493 | nmdc:mga0k408_29825_c1 | nmdc:mga0k408_29825_c1_999_1958 | 317 |
| 108 | 3300050494 | nmdc:mga06z11_35931_c1 | nmdc:mga06z11_35931_c1_279_1238 | 317 |
| 109 | 3300050494 | nmdc:mga06z11_43569_c1 | nmdc:mga06z11_43569_c1_704_1663 | 317 |
| 110 | 3300050507 | nmdc:mga05p37_33553_c1 | nmdc:mga05p37_33553_c1_4898_5866 | 317 |
| 111 | 3300050507 | nmdc:mga05p37_341376_c1 | nmdc:mga05p37_341376_c1_473_1435 | 317 |
| 112 | 3300050508 | nmdc:mga09592_69785_c1 | nmdc:mga09592_69785_c1_1380_2345 | 317 |
| 113 | 3300050511 | nmdc:mga08y16_178577_c1 | nmdc:mga08y16_178577_c1_1146_2108 | 317 |
| 114 | 3300050511 | nmdc:mga08y16_639_c1 | nmdc:mga08y16_639_c1_23430_24404 | 317 |
| 115 | 3300050512 | nmdc:mga0n895_487445_c1 | nmdc:mga0n895_487445_c1_128_1090 | 317 |
| 116 | 3300050515 | nmdc:mga0a205_231649_c1 | nmdc:mga0a205_231649_c1_316_1275 | 317 |
| 117 | 3300005328 | Ga0070676_10097243 | Ga0070676_100972432 | 318 |
| 118 | 3300005329 | Ga0070683_100006888 | Ga0070683_1000068884 | 318 |
| 119 | 3300005334 | Ga0068869_100028707 | Ga0068869_1000287073 | 318 |
| 120 | 3300005340 | Ga0070689_100004481 | Ga0070689_1000044812 | 318 |
| 121 | 3300005353 | Ga0070669_100015719 | Ga0070669_1000157194 | 318 |
| 122 | 3300005354 | Ga0070675_100010250 | Ga0070675_1000102502 | 318 |
| 123 | 3300005438 | Ga0070701_10096996 | Ga0070701_100969962 | 318 |
| 124 | 3300005543 | Ga0070672_100008279 | Ga0070672_1000082792 | 318 |
| 125 | 3300005615 | Ga0070702_100064147 | Ga0070702_1000641473 | 318 |
| 126 | 3300005617 | Ga0068859_100085150 | Ga0068859_1000851503 | 318 |
| 127 | 3300005842 | Ga0068858_100138947 | Ga0068858_1001389472 | 318 |
| 128 | 3300006844 | Ga0075428_100034854 | Ga0075428_1000348542 | 318 |
| 129 | 3300006844 | Ga0075428_100156350 | Ga0075428_1001563502 | 318 |
| 130 | 3300006852 | Ga0075433_10005324 | Ga0075433_100053246 | 318 |
| 131 | 3300006852 | Ga0075433_10021868 | Ga0075433_100218682 | 318 |
| 132 | 3300006871 | Ga0075434_100001730 | Ga0075434_1000017308 | 318 |
| 133 | 3300006871 | Ga0075434_100030412 | Ga0075434_1000304123 | 318 |
| 134 | 3300006931 | Ga0097620_100085145 | Ga0097620_1000851452 | 318 |
| 135 | 3300007076 | Ga0075435_100108242 | Ga0075435_1001082422 | 318 |
| 136 | 3300009093 | Ga0105240_10530511 | Ga0105240_105305111 | 318 |
| 137 | 3300009094 | Ga0111539_10000040 | Ga0111539_1000004034 | 318 |
| 138 | 3300009094 | Ga0111539_10007204 | Ga0111539_100072044 | 318 |
| 139 | 3300009094 | Ga0111539_10017801 | Ga0111539_100178014 | 318 |
| 140 | 3300009147 | Ga0114129_10004302 | Ga0114129_100043022 | 318 |
| 141 | 3300009148 | Ga0105243_10555964 | Ga0105243_105559641 | 318 |
| 142 | 3300025923 | Ga0207681_10019134 | Ga0207681_100191343 | 318 |
| 143 | 3300025926 | Ga0207659_10256143 | Ga0207659_102561432 | 318 |
| 144 | 3300025926 | Ga0207659_10314136 | Ga0207659_103141362 | 318 |
| 145 | 3300025931 | Ga0207644_10070550 | Ga0207644_100705505 | 318 |
| 146 | 3300025940 | Ga0207691_10027869 | Ga0207691_100278694 | 318 |
| 147 | 3300025945 | Ga0207679_10199730 | Ga0207679_101997302 | 318 |
| 148 | 3300026075 | Ga0207708_10175154 | Ga0207708_101751542 | 318 |
| 149 | 3300027907 | Ga0207428_10000750 | Ga0207428_1000075027 | 318 |
| 150 | 3300031903 | Ga0307407_10013328 | Ga0307407_100133284 | 318 |
| 151 | 3300031995 | Ga0307409_100034105 | Ga0307409_1000341054 | 318 |
| 152 | 3300032002 | Ga0307416_100171469 | Ga0307416_1001714693 | 318 |
| 153 | 3300032005 | Ga0307411_10026784 | Ga0307411_100267843 | 318 |
| 154 | 3300032126 | Ga0307415_100042982 | Ga0307415_1000429821 | 318 |
| 155 | 3300045051 | Ga0451576_0361296 | Ga0451576_0361296_154_1119 | 318 |
| 156 | 3300049591 | Ga0501075_0127704 | Ga0501075_0127704_133_1104 | 318 |
| 157 | 3300050507 | nmdc:mga05p37_4471_c1 | nmdc:mga05p37_4471_c1_7430_8392 | 318 |
| 158 | 3300050511 | nmdc:mga08y16_1149_c1 | nmdc:mga08y16_1149_c1_2481_3443 | 318 |
| 159 | 3300050511 | nmdc:mga08y16_355173_c1 | nmdc:mga08y16_355173_c1_482_1456 | 318 |
| 160 | 3300050511 | nmdc:mga08y16_83_c1 | nmdc:mga08y16_83_c1_65297_66280 | 318 |
| 161 | 3300050512 | nmdc:mga0n895_130606_c1 | nmdc:mga0n895_130606_c1_774_1739 | 318 |
| 162 | 3300050512 | nmdc:mga0n895_31123_c1 | nmdc:mga0n895_31123_c1_846_1811 | 318 |
| 163 | 3300050513 | nmdc:mga0rr50_5035_c1 | nmdc:mga0rr50_5035_c1_3113_4078 | 318 |
| 164 | 3300050515 | nmdc:mga0a205_6894_c1 | nmdc:mga0a205_6894_c1_8996_9961 | 318 |
| 165 | 3300003203 | JGI25406J46586_10000419 | JGI25406J46586_1000041914 | 319 |
| 166 | 3300005366 | Ga0070659_100324656 | Ga0070659_1003246562 | 319 |
| 167 | 3300005438 | Ga0070701_10001780 | Ga0070701_100017807 | 319 |
| 168 | 3300005471 | Ga0070698_100373254 | Ga0070698_1003732541 | 319 |
| 169 | 3300005518 | Ga0070699_100015391 | Ga0070699_1000153913 | 319 |
| 170 | 3300005985 | Ga0081539_10000093 | Ga0081539_100000939 | 319 |
| 171 | 3300006844 | Ga0075428_100196420 | Ga0075428_1001964202 | 319 |
| 172 | 3300006846 | Ga0075430_100005495 | Ga0075430_10000549511 | 319 |
| 173 | 3300006846 | Ga0075430_100033567 | Ga0075430_1000335672 | 319 |
| 174 | 3300006880 | Ga0075429_100066927 | Ga0075429_1000669272 | 319 |
| 175 | 3300014326 | Ga0157380_10076442 | Ga0157380_100764424 | 319 |
| 176 | 3300026088 | Ga0207641_10271722 | Ga0207641_102717222 | 319 |
| 177 | 3300042008 | Ga0439450_013275 | Ga0439450_013275_315_1301 | 319 |
| 178 | 3300042125 | Ga0450923_005171 | Ga0450923_005171_424_1410 | 319 |
| 179 | 3300049575 | Ga0501039_0006794 | Ga0501039_0006794_16_984 | 319 |
| 180 | 3300049576 | Ga0501040_0044695 | Ga0501040_0044695_926_1894 | 319 |
| 181 | 3300049577 | Ga0501041_0004230 | Ga0501041_0004230_4324_5292 | 319 |
| 182 | 3300049578 | Ga0501042_0004487 | Ga0501042_0004487_7234_8202 | 319 |
| 183 | 3300049588 | Ga0501072_0109737 | Ga0501072_0109737_143_1111 | 319 |
| 184 | 3300049591 | Ga0501075_0007297 | Ga0501075_0007297_2725_3693 | 319 |
| 185 | 3300049592 | Ga0501076_0040803 | Ga0501076_0040803_933_1901 | 319 |
| 186 | 3300049741 | Ga0501079_0095319 | Ga0501079_0095319_781_1749 | 319 |
| 187 | 3300049743 | Ga0501081_0042538 | Ga0501081_0042538_164_1132 | 319 |
| 188 | 3300049824 | Ga0501045_0115477 | Ga0501045_0115477_319_1287 | 319 |
| 189 | 3300050508 | nmdc:mga09592_59957_c1 | nmdc:mga09592_59957_c1_2148_3122 | 319 |
| 190 | 3300050509 | nmdc:mga0qj67_30242_c1 | nmdc:mga0qj67_30242_c1_258_1232 | 319 |
| 191 | 3300050509 | nmdc:mga0qj67_4864_c2 | nmdc:mga0qj67_4864_c2_745_1731 | 319 |
| 192 | 3300050509 | nmdc:mga0qj67_70020_c1 | nmdc:mga0qj67_70020_c1_986_1960 | 319 |
| 193 | 3300050510 | nmdc:mga06r32_39152_c1 | nmdc:mga06r32_39152_c1_3061_4035 | 319 |
| 194 | 3300050510 | nmdc:mga06r32_81377_c1 | nmdc:mga06r32_81377_c1_241_1215 | 319 |
| 195 | 3300060353 | Ga0501082_0027190 | Ga0501082_0027190_3655_4623 | 319 |
| 196 | 3300002459 | JGI24751J29686_10018045 | JGI24751J29686_100180451 | 320 |
| 197 | 3300005293 | Ga0065715_10015399 | Ga0065715_100153992 | 320 |
| 198 | 3300005293 | Ga0065715_10103262 | Ga0065715_101032621 | 320 |
| 199 | 3300005293 | Ga0065715_10165631 | Ga0065715_101656312 | 320 |
| 200 | 3300005295 | Ga0065707_10001808 | Ga0065707_100018082 | 320 |
| 201 | 3300005329 | Ga0070683_100012012 | Ga0070683_1000120124 | 320 |
| 202 | 3300005331 | Ga0070670_100011516 | Ga0070670_1000115163 | 320 |
| 203 | 3300005331 | Ga0070670_100034960 | Ga0070670_1000349603 | 320 |
| 204 | 3300005331 | Ga0070670_100176958 | Ga0070670_1001769581 | 320 |
| 205 | 3300005336 | Ga0070680_100203484 | Ga0070680_1002034842 | 320 |
| 206 | 3300005336 | Ga0070680_100251269 | Ga0070680_1002512692 | 320 |
| 207 | 3300005336 | Ga0070680_100369689 | Ga0070680_1003696891 | 320 |
| 208 | 3300005338 | Ga0068868_100317641 | Ga0068868_1003176411 | 320 |
| 209 | 3300005340 | Ga0070689_100012629 | Ga0070689_1000126292 | 320 |
| 210 | 3300005343 | Ga0070687_100177566 | Ga0070687_1001775662 | 320 |
| 211 | 3300005353 | Ga0070669_100000432 | Ga0070669_1000004323 | 320 |
| 212 | 3300005353 | Ga0070669_100113828 | Ga0070669_1001138282 | 320 |
| 213 | 3300005354 | Ga0070675_100000109 | Ga0070675_10000010942 | 320 |
| 214 | 3300005354 | Ga0070675_100033933 | Ga0070675_1000339332 | 320 |
| 215 | 3300005355 | Ga0070671_100007712 | Ga0070671_10000771210 | 320 |
| 216 | 3300005356 | Ga0070674_100009659 | Ga0070674_1000096593 | 320 |
| 217 | 3300005356 | Ga0070674_100119491 | Ga0070674_1001194912 | 320 |
| 218 | 3300005364 | Ga0070673_100081855 | Ga0070673_1000818553 | 320 |
| 219 | 3300005365 | Ga0070688_100001310 | Ga0070688_1000013108 | 320 |
| 220 | 3300005365 | Ga0070688_100023382 | Ga0070688_1000233822 | 320 |
| 221 | 3300005406 | Ga0070703_10027233 | Ga0070703_100272332 | 320 |
| 222 | 3300005441 | Ga0070700_100067086 | Ga0070700_1000670863 | 320 |
| 223 | 3300005441 | Ga0070700_100077374 | Ga0070700_1000773743 | 320 |
| 224 | 3300005445 | Ga0070708_100102137 | Ga0070708_1001021371 | 320 |
| 225 | 3300005445 | Ga0070708_100128766 | Ga0070708_1001287662 | 320 |
| 226 | 3300005456 | Ga0070678_100316311 | Ga0070678_1003163112 | 320 |
| 227 | 3300005457 | Ga0070662_100059024 | Ga0070662_1000590241 | 320 |
| 228 | 3300005458 | Ga0070681_10025530 | Ga0070681_100255305 | 320 |
| 229 | 3300005459 | Ga0068867_100025615 | Ga0068867_1000256153 | 320 |
| 230 | 3300005518 | Ga0070699_100421729 | Ga0070699_1004217291 | 320 |
| 231 | 3300005543 | Ga0070672_100003914 | Ga0070672_1000039145 | 320 |
| 232 | 3300005543 | Ga0070672_100015999 | Ga0070672_1000159994 | 320 |
| 233 | 3300005543 | Ga0070672_100169999 | Ga0070672_1001699992 | 320 |
| 234 | 3300005544 | Ga0070686_100067381 | Ga0070686_1000673812 | 320 |
| 235 | 3300005564 | Ga0070664_100020927 | Ga0070664_1000209272 | 320 |
| 236 | 3300005577 | Ga0068857_100009649 | Ga0068857_1000096494 | 320 |
| 237 | 3300005577 | Ga0068857_100028877 | Ga0068857_1000288774 | 320 |
| 238 | 3300005617 | Ga0068859_100000459 | Ga0068859_1000004597 | 320 |
| 239 | 3300005617 | Ga0068859_100006392 | Ga0068859_10000639210 | 320 |
| 240 | 3300005618 | Ga0068864_100015505 | Ga0068864_1000155052 | 320 |
| 241 | 3300005618 | Ga0068864_100030452 | Ga0068864_1000304524 | 320 |
| 242 | 3300005618 | Ga0068864_100054827 | Ga0068864_1000548273 | 320 |
| 243 | 3300005719 | Ga0068861_100005774 | Ga0068861_1000057742 | 320 |
| 244 | 3300005719 | Ga0068861_100168189 | Ga0068861_1001681892 | 320 |
| 245 | 3300005840 | Ga0068870_10020503 | Ga0068870_100205032 | 320 |
| 246 | 3300005841 | Ga0068863_100084580 | Ga0068863_1000845802 | 320 |
| 247 | 3300005842 | Ga0068858_100008010 | Ga0068858_10000801010 | 320 |
| 248 | 3300005843 | Ga0068860_100088839 | Ga0068860_1000888392 | 320 |
| 249 | 3300005843 | Ga0068860_100150549 | Ga0068860_1001505493 | 320 |
| 250 | 3300005985 | Ga0081539_10008783 | Ga0081539_100087837 | 320 |
| 251 | 3300006844 | Ga0075428_100004233 | Ga0075428_1000042336 | 320 |
| 252 | 3300006844 | Ga0075428_100030417 | Ga0075428_1000304174 | 320 |
| 253 | 3300006871 | Ga0075434_100046243 | Ga0075434_1000462434 | 320 |
| 254 | 3300006871 | Ga0075434_100166817 | Ga0075434_1001668171 | 320 |
| 255 | 3300006881 | Ga0068865_100105801 | Ga0068865_1001058013 | 320 |
| 256 | 3300006931 | Ga0097620_100000459 | Ga0097620_1000004597 | 320 |
| 257 | 3300006931 | Ga0097620_100006392 | Ga0097620_10000639210 | 320 |
| 258 | 3300007076 | Ga0075435_100028340 | Ga0075435_1000283404 | 320 |
| 259 | 3300007076 | Ga0075435_100245507 | Ga0075435_1002455072 | 320 |
| 260 | 3300009094 | Ga0111539_10002493 | Ga0111539_1000249315 | 320 |
| 261 | 3300009147 | Ga0114129_10002401 | Ga0114129_1000240124 | 320 |
| 262 | 3300009147 | Ga0114129_10143778 | Ga0114129_101437782 | 320 |
| 263 | 3300009553 | Ga0105249_10006847 | Ga0105249_100068476 | 320 |
| 264 | 3300013297 | Ga0157378_10391080 | Ga0157378_103910801 | 320 |
| 265 | 3300013308 | Ga0157375_10009065 | Ga0157375_100090655 | 320 |
| 266 | 3300014326 | Ga0157380_10000369 | Ga0157380_1000036915 | 320 |
| 267 | 3300014326 | Ga0157380_10294881 | Ga0157380_102948812 | 320 |
| 268 | 3300014745 | Ga0157377_10118619 | Ga0157377_101186192 | 320 |
| 269 | 3300017792 | Ga0163161_10087708 | Ga0163161_100877083 | 320 |
| 270 | 3300025893 | Ga0207682_10004632 | Ga0207682_100046325 | 320 |
| 271 | 3300025901 | Ga0207688_10003546 | Ga0207688_100035466 | 320 |
| 272 | 3300025908 | Ga0207643_10008746 | Ga0207643_100087464 | 320 |
| 273 | 3300025908 | Ga0207643_10035502 | Ga0207643_100355022 | 320 |
| 274 | 3300025925 | Ga0207650_10048273 | Ga0207650_100482733 | 320 |
| 275 | 3300025925 | Ga0207650_10092664 | Ga0207650_100926641 | 320 |
| 276 | 3300025926 | Ga0207659_10000617 | Ga0207659_1000061718 | 320 |
| 277 | 3300025932 | Ga0207690_10135769 | Ga0207690_101357691 | 320 |
| 278 | 3300025933 | Ga0207706_10008838 | Ga0207706_1000883811 | 320 |
| 279 | 3300025933 | Ga0207706_10217965 | Ga0207706_102179652 | 320 |
| 280 | 3300025936 | Ga0207670_10004689 | Ga0207670_100046892 | 320 |
| 281 | 3300025938 | Ga0207704_10044601 | Ga0207704_100446013 | 320 |
| 282 | 3300025940 | Ga0207691_10007757 | Ga0207691_100077575 | 320 |
| 283 | 3300025940 | Ga0207691_10015851 | Ga0207691_100158515 | 320 |
| 284 | 3300025940 | Ga0207691_10117911 | Ga0207691_101179112 | 320 |
| 285 | 3300025941 | Ga0207711_10206169 | Ga0207711_102061692 | 320 |
| 286 | 3300025944 | Ga0207661_10025066 | Ga0207661_100250664 | 320 |
| 287 | 3300025945 | Ga0207679_10048707 | Ga0207679_100487073 | 320 |
| 288 | 3300025960 | Ga0207651_10088650 | Ga0207651_100886502 | 320 |
| 289 | 3300025960 | Ga0207651_10238769 | Ga0207651_102387691 | 320 |
| 290 | 3300026035 | Ga0207703_10042575 | Ga0207703_100425753 | 320 |
| 291 | 3300026075 | Ga0207708_10104785 | Ga0207708_101047852 | 320 |
| 292 | 3300026088 | Ga0207641_10118438 | Ga0207641_101184383 | 320 |
| 293 | 3300026089 | Ga0207648_10000375 | Ga0207648_1000037519 | 320 |
| 294 | 3300026095 | Ga0207676_10270722 | Ga0207676_102707222 | 320 |
| 295 | 3300026116 | Ga0207674_10038952 | Ga0207674_100389522 | 320 |
| 296 | 3300026116 | Ga0207674_10042147 | Ga0207674_100421474 | 320 |
| 297 | 3300026116 | Ga0207674_10149243 | Ga0207674_101492431 | 320 |
| 298 | 3300026118 | Ga0207675_100005097 | Ga0207675_1000050973 | 320 |
| 299 | 3300026121 | Ga0207683_10028347 | Ga0207683_100283473 | 320 |
| 300 | 3300026121 | Ga0207683_10101372 | Ga0207683_101013722 | 320 |
| 301 | 3300026121 | Ga0207683_10167334 | Ga0207683_101673342 | 320 |
| 302 | 3300027907 | Ga0207428_10001319 | Ga0207428_1000131916 | 320 |
| 303 | 3300028380 | Ga0268265_10000263 | Ga0268265_1000026349 | 320 |
| 304 | 3300028380 | Ga0268265_10108634 | Ga0268265_101086342 | 320 |
| 305 | 3300028381 | Ga0268264_10002400 | Ga0268264_100024003 | 320 |
| 306 | 3300028381 | Ga0268264_10126791 | Ga0268264_101267911 | 320 |
| 307 | 3300035725 | Ga0373947_0191510 | Ga0373947_0191510_262_1227 | 320 |
| 308 | 3300041486 | Ga0451807_2469453 | Ga0451807_2469453_382_1350 | 320 |
| 309 | 3300045051 | Ga0451576_0029521 | Ga0451576_0029521_1890_2855 | 320 |
| 310 | 3300046455 | Ga0495603_0084178 | Ga0495603_0084178_294_1271 | 320 |
| 311 | 3300046459 | Ga0495629_0003222 | Ga0495629_0003222_7693_8670 | 320 |
| 312 | 3300046473 | Ga0495582_0033481 | Ga0495582_0033481_1228_2205 | 320 |
| 313 | 3300046473 | Ga0495582_0144120 | Ga0495582_0144120_261_1226 | 320 |
| 314 | 3300046491 | Ga0495584_0122747 | Ga0495584_0122747_282_1244 | 320 |
| 315 | 3300046499 | Ga0495594_0087102 | Ga0495594_0087102_144_1109 | 320 |
| 316 | 3300046557 | Ga0495622_0088430 | Ga0495622_0088430_101_1078 | 320 |
| 317 | 3300046558 | Ga0495633_0070797 | Ga0495633_0070797_638_1600 | 320 |
| 318 | 3300046664 | Ga0495659_0026780 | Ga0495659_0026780_35_997 | 320 |
| 319 | 3300046664 | Ga0495659_0079583 | Ga0495659_0079583_172_1134 | 320 |
| 320 | 3300046674 | Ga0495588_0001691 | Ga0495588_0001691_3599_4564 | 320 |
| 321 | 3300046691 | Ga0495670_0052328 | Ga0495670_0052328_858_1820 | 320 |
| 322 | 3300047318 | Ga0495636_0006616 | Ga0495636_0006616_853_1815 | 320 |
| 323 | 3300047321 | Ga0495676_0041004 | Ga0495676_0041004_516_1493 | 320 |
| 324 | 3300050507 | nmdc:mga05p37_320977_c1 | nmdc:mga05p37_320977_c1_321_1283 | 320 |
| 325 | 3300050507 | nmdc:mga05p37_3595_c1 | nmdc:mga05p37_3595_c1_5750_6712 | 320 |
| 326 | 3300050511 | nmdc:mga08y16_105820_c1 | nmdc:mga08y16_105820_c1_22_984 | 320 |
| 327 | 3300050512 | nmdc:mga0n895_137637_c1 | nmdc:mga0n895_137637_c1_291_1253 | 320 |
| 328 | 3300050512 | nmdc:mga0n895_300185_c1 | nmdc:mga0n895_300185_c1_307_1272 | 320 |
| 329 | 3300050512 | nmdc:mga0n895_51493_c1 | nmdc:mga0n895_51493_c1_2631_3596 | 320 |
| 330 | 3300050513 | nmdc:mga0rr50_206474_c1 | nmdc:mga0rr50_206474_c1_383_1348 | 320 |
| 331 | 3300050515 | nmdc:mga0a205_9084_c1 | nmdc:mga0a205_9084_c1_843_1805 | 320 |
| 332 | 3300059426 | Ga0590077_006313 | Ga0590077_006313_876_1853 | 320 |
| 333 | 3300005293 | Ga0065715_10013853 | Ga0065715_100138531 | 321 |
| 334 | 3300005328 | Ga0070676_10009842 | Ga0070676_100098426 | 321 |
| 335 | 3300005330 | Ga0070690_100002535 | Ga0070690_1000025356 | 321 |
| 336 | 3300005333 | Ga0070677_10017079 | Ga0070677_100170792 | 321 |
| 337 | 3300005334 | Ga0068869_100004047 | Ga0068869_1000040475 | 321 |
| 338 | 3300005334 | Ga0068869_100008308 | Ga0068869_1000083085 | 321 |
| 339 | 3300005343 | Ga0070687_100073024 | Ga0070687_1000730242 | 321 |
| 340 | 3300005347 | Ga0070668_100212667 | Ga0070668_1002126672 | 321 |
| 341 | 3300005364 | Ga0070673_100026385 | Ga0070673_1000263852 | 321 |
| 342 | 3300005364 | Ga0070673_100055049 | Ga0070673_1000550492 | 321 |
| 343 | 3300005366 | Ga0070659_100164303 | Ga0070659_1001643032 | 321 |
| 344 | 3300005367 | Ga0070667_100020613 | Ga0070667_1000206134 | 321 |
| 345 | 3300005438 | Ga0070701_10021737 | Ga0070701_100217372 | 321 |
| 346 | 3300005438 | Ga0070701_10066463 | Ga0070701_100664631 | 321 |
| 347 | 3300005441 | Ga0070700_100040517 | Ga0070700_1000405172 | 321 |
| 348 | 3300005455 | Ga0070663_100010296 | Ga0070663_1000102962 | 321 |
| 349 | 3300005456 | Ga0070678_100111301 | Ga0070678_1001113012 | 321 |
| 350 | 3300005456 | Ga0070678_100243134 | Ga0070678_1002431342 | 321 |
| 351 | 3300005458 | Ga0070681_10394414 | Ga0070681_103944142 | 321 |
| 352 | 3300005459 | Ga0068867_100016050 | Ga0068867_1000160502 | 321 |
| 353 | 3300005459 | Ga0068867_100217160 | Ga0068867_1002171601 | 321 |
| 354 | 3300005466 | Ga0070685_10065705 | Ga0070685_100657052 | 321 |
| 355 | 3300005518 | Ga0070699_100264644 | Ga0070699_1002646442 | 321 |
| 356 | 3300005530 | Ga0070679_100247742 | Ga0070679_1002477422 | 321 |
| 357 | 3300005543 | Ga0070672_100024609 | Ga0070672_1000246095 | 321 |
| 358 | 3300005543 | Ga0070672_100096494 | Ga0070672_1000964942 | 321 |
| 359 | 3300005544 | Ga0070686_100127192 | Ga0070686_1001271922 | 321 |
| 360 | 3300005548 | Ga0070665_100134590 | Ga0070665_1001345904 | 321 |
| 361 | 3300005549 | Ga0070704_100036486 | Ga0070704_1000364863 | 321 |
| 362 | 3300005564 | Ga0070664_100027053 | Ga0070664_1000270532 | 321 |
| 363 | 3300005564 | Ga0070664_100027251 | Ga0070664_1000272512 | 321 |
| 364 | 3300005577 | Ga0068857_100091113 | Ga0068857_1000911132 | 321 |
| 365 | 3300005578 | Ga0068854_100040865 | Ga0068854_1000408654 | 321 |
| 366 | 3300005616 | Ga0068852_100131624 | Ga0068852_1001316242 | 321 |
| 367 | 3300005617 | Ga0068859_100041433 | Ga0068859_1000414332 | 321 |
| 368 | 3300005618 | Ga0068864_100022648 | Ga0068864_1000226484 | 321 |
| 369 | 3300005719 | Ga0068861_100033621 | Ga0068861_1000336212 | 321 |
| 370 | 3300005840 | Ga0068870_10002247 | Ga0068870_100022475 | 321 |
| 371 | 3300005841 | Ga0068863_100016660 | Ga0068863_1000166604 | 321 |
| 372 | 3300005842 | Ga0068858_100140746 | Ga0068858_1001407462 | 321 |
| 373 | 3300005844 | Ga0068862_100004233 | Ga0068862_1000042334 | 321 |
| 374 | 3300005844 | Ga0068862_100108706 | Ga0068862_1001087063 | 321 |
| 375 | 3300006237 | Ga0097621_100018708 | Ga0097621_1000187084 | 321 |
| 376 | 3300006358 | Ga0068871_100119157 | Ga0068871_1001191572 | 321 |
| 377 | 3300006844 | Ga0075428_100082065 | Ga0075428_1000820652 | 321 |
| 378 | 3300006846 | Ga0075430_100001090 | Ga0075430_1000010902 | 321 |
| 379 | 3300006847 | Ga0075431_100004139 | Ga0075431_1000041396 | 321 |
| 380 | 3300006847 | Ga0075431_100240950 | Ga0075431_1002409502 | 321 |
| 381 | 3300006852 | Ga0075433_10019804 | Ga0075433_100198044 | 321 |
| 382 | 3300006871 | Ga0075434_100001711 | Ga0075434_1000017114 | 321 |
| 383 | 3300006880 | Ga0075429_100011739 | Ga0075429_1000117395 | 321 |
| 384 | 3300006880 | Ga0075429_100041462 | Ga0075429_1000414623 | 321 |
| 385 | 3300006881 | Ga0068865_100036934 | Ga0068865_1000369343 | 321 |
| 386 | 3300006931 | Ga0097620_100041434 | Ga0097620_1000414342 | 321 |
| 387 | 3300009094 | Ga0111539_10013195 | Ga0111539_100131954 | 321 |
| 388 | 3300009094 | Ga0111539_10014889 | Ga0111539_100148895 | 321 |
| 389 | 3300009094 | Ga0111539_10192573 | Ga0111539_101925733 | 321 |
| 390 | 3300009147 | Ga0114129_10019676 | Ga0114129_100196767 | 321 |
| 391 | 3300009148 | Ga0105243_10061941 | Ga0105243_100619412 | 321 |
| 392 | 3300009176 | Ga0105242_10096002 | Ga0105242_100960022 | 321 |
| 393 | 3300009177 | Ga0105248_10014948 | Ga0105248_100149483 | 321 |
| 394 | 3300009553 | Ga0105249_10026619 | Ga0105249_100266194 | 321 |
| 395 | 3300013296 | Ga0157374_10297420 | Ga0157374_102974202 | 321 |
| 396 | 3300013306 | Ga0163162_10005469 | Ga0163162_100054699 | 321 |
| 397 | 3300014325 | Ga0163163_10077478 | Ga0163163_100774782 | 321 |
| 398 | 3300014326 | Ga0157380_10183238 | Ga0157380_101832382 | 321 |
| 399 | 3300014326 | Ga0157380_10219053 | Ga0157380_102190531 | 321 |
| 400 | 3300014745 | Ga0157377_10020689 | Ga0157377_100206893 | 321 |
| 401 | 3300014745 | Ga0157377_10048258 | Ga0157377_100482582 | 321 |
| 402 | 3300014968 | Ga0157379_10014028 | Ga0157379_100140285 | 321 |
| 403 | 3300014969 | Ga0157376_10048059 | Ga0157376_100480592 | 321 |
| 404 | 3300017792 | Ga0163161_10047090 | Ga0163161_100470904 | 321 |
| 405 | 3300025315 | Ga0207697_10015924 | Ga0207697_100159243 | 321 |
| 406 | 3300025893 | Ga0207682_10000139 | Ga0207682_1000013922 | 321 |
| 407 | 3300025901 | Ga0207688_10001936 | Ga0207688_100019364 | 321 |
| 408 | 3300025907 | Ga0207645_10009375 | Ga0207645_100093757 | 321 |
| 409 | 3300025907 | Ga0207645_10018389 | Ga0207645_100183893 | 321 |
| 410 | 3300025908 | Ga0207643_10001178 | Ga0207643_100011784 | 321 |
| 411 | 3300025918 | Ga0207662_10044721 | Ga0207662_100447214 | 321 |
| 412 | 3300025921 | Ga0207652_10104468 | Ga0207652_101044682 | 321 |
| 413 | 3300025923 | Ga0207681_10026181 | Ga0207681_100261812 | 321 |
| 414 | 3300025923 | Ga0207681_10029582 | Ga0207681_100295824 | 321 |
| 415 | 3300025926 | Ga0207659_10031802 | Ga0207659_100318023 | 321 |
| 416 | 3300025926 | Ga0207659_10093995 | Ga0207659_100939952 | 321 |
| 417 | 3300025933 | Ga0207706_10004608 | Ga0207706_100046089 | 321 |
| 418 | 3300025935 | Ga0207709_10016583 | Ga0207709_100165833 | 321 |
| 419 | 3300025936 | Ga0207670_10013796 | Ga0207670_100137963 | 321 |
| 420 | 3300025938 | Ga0207704_10009137 | Ga0207704_100091374 | 321 |
| 421 | 3300025938 | Ga0207704_10035062 | Ga0207704_100350622 | 321 |
| 422 | 3300025940 | Ga0207691_10005343 | Ga0207691_100053431 | 321 |
| 423 | 3300025940 | Ga0207691_10120332 | Ga0207691_101203321 | 321 |
| 424 | 3300025942 | Ga0207689_10001767 | Ga0207689_100017677 | 321 |
| 425 | 3300025942 | Ga0207689_10075257 | Ga0207689_100752573 | 321 |
| 426 | 3300025945 | Ga0207679_10013217 | Ga0207679_100132174 | 321 |
| 427 | 3300025960 | Ga0207651_10047572 | Ga0207651_100475722 | 321 |
| 428 | 3300025961 | Ga0207712_10007908 | Ga0207712_100079085 | 321 |
| 429 | 3300025986 | Ga0207658_10048860 | Ga0207658_100488602 | 321 |
| 430 | 3300026023 | Ga0207677_10093036 | Ga0207677_100930363 | 321 |
| 431 | 3300026035 | Ga0207703_10015787 | Ga0207703_100157874 | 321 |
| 432 | 3300026075 | Ga0207708_10033389 | Ga0207708_100333893 | 321 |
| 433 | 3300026089 | Ga0207648_10011159 | Ga0207648_100111596 | 321 |
| 434 | 3300026089 | Ga0207648_10087878 | Ga0207648_100878783 | 321 |
| 435 | 3300026116 | Ga0207674_10179429 | Ga0207674_101794292 | 321 |
| 436 | 3300026118 | Ga0207675_100005161 | Ga0207675_1000051618 | 321 |
| 437 | 3300026121 | Ga0207683_10102431 | Ga0207683_101024313 | 321 |
| 438 | 3300027907 | Ga0207428_10005991 | Ga0207428_100059913 | 321 |
| 439 | 3300028380 | Ga0268265_10016194 | Ga0268265_100161944 | 321 |
| 440 | 3300028380 | Ga0268265_10217867 | Ga0268265_102178672 | 321 |
| 441 | 3300028381 | Ga0268264_10049927 | Ga0268264_100499274 | 321 |
| 442 | 3300028381 | Ga0268264_10092345 | Ga0268264_100923452 | 321 |
| 443 | 3300035112 | Ga0373932_0015725 | Ga0373932_0015725_688_1677 | 321 |
| 444 | 3300037068 | Ga0373925_0035988 | Ga0373925_0035988_816_1805 | 321 |
| 445 | 3300045051 | Ga0451576_0159236 | Ga0451576_0159236_455_1444 | 321 |
| 446 | 3300046522 | Ga0495643_0003874 | Ga0495643_0003874_1074_2054 | 321 |
| 447 | 3300050508 | nmdc:mga09592_24167_c1 | nmdc:mga09592_24167_c1_2432_3421 | 321 |
| 448 | 3300050509 | nmdc:mga0qj67_276313_c1 | nmdc:mga0qj67_276313_c1_266_1267 | 321 |
| 449 | 3300050510 | nmdc:mga06r32_349650_c1 | nmdc:mga06r32_349650_c1_133_1134 | 321 |
| 450 | 3300050511 | nmdc:mga08y16_14292_c1 | nmdc:mga08y16_14292_c1_2827_3816 | 321 |
| 451 | 3300050511 | nmdc:mga08y16_25196_c1 | nmdc:mga08y16_25196_c1_104_1105 | 321 |
| 452 | 3300050511 | nmdc:mga08y16_339523_c1 | nmdc:mga08y16_339523_c1_82_1074 | 321 |
| 453 | 3300050512 | nmdc:mga0n895_3603_c1 | nmdc:mga0n895_3603_c1_8626_9615 | 321 |
| 454 | 3300050513 | nmdc:mga0rr50_407615_c1 | nmdc:mga0rr50_407615_c1_84_1073 | 321 |
| 455 | 3300050515 | nmdc:mga0a205_38252_c1 | nmdc:mga0a205_38252_c1_3050_4039 | 321 |
| 456 | 3300005334 | Ga0068869_100088545 | Ga0068869_1000885451 | 322 |
| 457 | 3300005441 | Ga0070700_100097524 | Ga0070700_1000975241 | 322 |
| 458 | 3300006844 | Ga0075428_100023809 | Ga0075428_1000238092 | 322 |
| 459 | 3300009094 | Ga0111539_10076513 | Ga0111539_100765133 | 322 |
| 460 | 3300009147 | Ga0114129_10166422 | Ga0114129_101664222 | 322 |
| 461 | 3300026075 | Ga0207708_10137666 | Ga0207708_101376661 | 322 |
| 462 | 3300032002 | Ga0307416_100351958 | Ga0307416_1003519582 | 322 |
| 463 | 3300032002 | Ga0307416_100516167 | Ga0307416_1005161672 | 322 |
| 464 | 3300035724 | Ga0373933_0041138 | Ga0373933_0041138_1172_2173 | 322 |
| 465 | 3300036401 | Ga0373937_0006141 | Ga0373937_0006141_3414_4415 | 322 |
| 466 | 3300044673 | Ga0453683_0214270 | Ga0453683_0214270_237_1208 | 322 |
| 467 | 3300045051 | Ga0451576_0024372 | Ga0451576_0024372_5289_6260 | 322 |
| 468 | 3300049661 | Ga0501217_012511 | Ga0501217_012511_163_1164 | 322 |
| 469 | 3300049661 | Ga0501217_025215 | Ga0501217_025215_31_1005 | 322 |
| 470 | 3300049742 | Ga0501080_0149697 | Ga0501080_0149697_929_1906 | 322 |
| 471 | 3300050507 | nmdc:mga05p37_552323_c1 | nmdc:mga05p37_552323_c1_308_1285 | 322 |
| 472 | 3300050510 | nmdc:mga06r32_85540_c1 | nmdc:mga06r32_85540_c1_1594_2595 | 322 |
| 473 | 3300050511 | nmdc:mga08y16_40753_c1 | nmdc:mga08y16_40753_c1_1906_2907 | 322 |
| 474 | 3300005334 | Ga0068869_100172445 | Ga0068869_1001724452 | 323 |
| 475 | 3300005340 | Ga0070689_100009330 | Ga0070689_1000093303 | 323 |
| 476 | 3300005341 | Ga0070691_10029367 | Ga0070691_100293673 | 323 |
| 477 | 3300005355 | Ga0070671_100046552 | Ga0070671_1000465522 | 323 |
| 478 | 3300005364 | Ga0070673_100000486 | Ga0070673_10000048610 | 323 |
| 479 | 3300005367 | Ga0070667_100376699 | Ga0070667_1003766992 | 323 |
| 480 | 3300005438 | Ga0070701_10050933 | Ga0070701_100509331 | 323 |
| 481 | 3300005440 | Ga0070705_100000366 | Ga0070705_10000036620 | 323 |
| 482 | 3300005441 | Ga0070700_100122214 | Ga0070700_1001222142 | 323 |
| 483 | 3300005444 | Ga0070694_100014180 | Ga0070694_1000141802 | 323 |
| 484 | 3300005459 | Ga0068867_100082925 | Ga0068867_1000829252 | 323 |
| 485 | 3300005545 | Ga0070695_100000102 | Ga0070695_1000001028 | 323 |
| 486 | 3300005547 | Ga0070693_100032298 | Ga0070693_1000322982 | 323 |
| 487 | 3300005615 | Ga0070702_100018990 | Ga0070702_1000189902 | 323 |
| 488 | 3300005841 | Ga0068863_100037284 | Ga0068863_1000372844 | 323 |
| 489 | 3300005844 | Ga0068862_100145040 | Ga0068862_1001450402 | 323 |
| 490 | 3300005985 | Ga0081539_10001997 | Ga0081539_1000199726 | 323 |
| 491 | 3300006038 | Ga0075365_10003211 | Ga0075365_100032116 | 323 |
| 492 | 3300006844 | Ga0075428_100291906 | Ga0075428_1002919062 | 323 |
| 493 | 3300006852 | Ga0075433_10052443 | Ga0075433_100524433 | 323 |
| 494 | 3300006881 | Ga0068865_100127457 | Ga0068865_1001274572 | 323 |
| 495 | 3300007076 | Ga0075435_100004581 | Ga0075435_1000045815 | 323 |
| 496 | 3300009094 | Ga0111539_10000465 | Ga0111539_1000046543 | 323 |
| 497 | 3300009094 | Ga0111539_10756038 | Ga0111539_107560381 | 323 |
| 498 | 3300009098 | Ga0105245_10016854 | Ga0105245_100168543 | 323 |
| 499 | 3300009147 | Ga0114129_10005462 | Ga0114129_100054629 | 323 |
| 500 | 3300009148 | Ga0105243_10026115 | Ga0105243_100261154 | 323 |
| 501 | 3300009148 | Ga0105243_10026216 | Ga0105243_100262162 | 323 |
| 502 | 3300009177 | Ga0105248_10040061 | Ga0105248_100400612 | 323 |
| 503 | 3300009553 | Ga0105249_10278407 | Ga0105249_102784072 | 323 |
| 504 | 3300013297 | Ga0157378_10670008 | Ga0157378_106700081 | 323 |
| 505 | 3300014326 | Ga0157380_10064470 | Ga0157380_100644704 | 323 |
| 506 | 3300025901 | Ga0207688_10030191 | Ga0207688_100301912 | 323 |
| 507 | 3300025907 | Ga0207645_10002241 | Ga0207645_100022412 | 323 |
| 508 | 3300025918 | Ga0207662_10005189 | Ga0207662_100051895 | 323 |
| 509 | 3300025923 | Ga0207681_10066903 | Ga0207681_100669031 | 323 |
| 510 | 3300025923 | Ga0207681_10103711 | Ga0207681_101037111 | 323 |
| 511 | 3300025928 | Ga0207700_10039336 | Ga0207700_100393362 | 323 |
| 512 | 3300025936 | Ga0207670_10049236 | Ga0207670_100492362 | 323 |
| 513 | 3300025938 | Ga0207704_10104335 | Ga0207704_101043352 | 323 |
| 514 | 3300025941 | Ga0207711_10137987 | Ga0207711_101379872 | 323 |
| 515 | 3300025942 | Ga0207689_10032790 | Ga0207689_100327903 | 323 |
| 516 | 3300025960 | Ga0207651_10002809 | Ga0207651_100028096 | 323 |
| 517 | 3300025981 | Ga0207640_10256497 | Ga0207640_102564971 | 323 |
| 518 | 3300026075 | Ga0207708_10009001 | Ga0207708_100090016 | 323 |
| 519 | 3300026075 | Ga0207708_10019636 | Ga0207708_100196362 | 323 |
| 520 | 3300026088 | Ga0207641_10052416 | Ga0207641_100524162 | 323 |
| 521 | 3300026089 | Ga0207648_10014276 | Ga0207648_100142767 | 323 |
| 522 | 3300026089 | Ga0207648_10100505 | Ga0207648_101005051 | 323 |
| 523 | 3300028380 | Ga0268265_10252515 | Ga0268265_102525152 | 323 |
| 524 | 3300035691 | Ga0373931_0153463 | Ga0373931_0153463_94_1071 | 323 |
| 525 | 3300042008 | Ga0439450_005826 | Ga0439450_005826_681_1685 | 323 |
| 526 | 3300042439 | Ga0439464_0005119 | Ga0439464_0005119_1817_2821 | 323 |
| 527 | 3300046528 | Ga0495642_0013249 | Ga0495642_0013249_2104_3093 | 323 |
| 528 | 3300046539 | Ga0495621_0000764 | Ga0495621_0000764_858_1847 | 323 |
| 529 | 3300049571 | Ga0501034_0056321 | Ga0501034_0056321_1272_2303 | 323 |
| 530 | 3300049823 | Ga0501044_0026417 | Ga0501044_0026417_3349_4380 | 323 |
| 531 | 3300050492 | nmdc:mga0yw44_98960_c1 | nmdc:mga0yw44_98960_c1_828_1805 | 323 |
| 532 | 3300050507 | nmdc:mga05p37_1148_c1 | nmdc:mga05p37_1148_c1_19728_20732 | 323 |
| 533 | 3300050508 | nmdc:mga09592_115130_c1 | nmdc:mga09592_115130_c1_20_1024 | 323 |
| 534 | 3300050511 | nmdc:mga08y16_156_c1 | nmdc:mga08y16_156_c1_45159_46163 | 323 |
| 535 | 3300050513 | nmdc:mga0rr50_773_c1 | nmdc:mga0rr50_773_c1_1790_2767 | 323 |
| 536 | 3300005546 | Ga0070696_100134165 | Ga0070696_1001341652 | 324 |
| 537 | 3300025920 | Ga0207649_10113047 | Ga0207649_101130472 | 324 |
| 538 | 3300050507 | nmdc:mga05p37_163460_c1 | nmdc:mga05p37_163460_c1_956_1963 | 324 |
| 539 | 2162886007 | SwRhRL2b_contig_3115889 | SwRhRL2b_0225.00002830 | 325 |
| 540 | 3300005289 | Ga0065704_10004376 | Ga0065704_100043762 | 325 |
| 541 | 3300005468 | Ga0070707_100067550 | Ga0070707_1000675501 | 325 |
| 542 | 3300005471 | Ga0070698_100008063 | Ga0070698_1000080633 | 325 |
| 543 | 3300005518 | Ga0070699_100042556 | Ga0070699_1000425561 | 325 |
| 544 | 3300005536 | Ga0070697_100021645 | Ga0070697_1000216454 | 325 |
| 545 | 3300006195 | Ga0075366_10064074 | Ga0075366_100640742 | 325 |
| 546 | 3300009147 | Ga0114129_10006077 | Ga0114129_1000607711 | 325 |
| 547 | 3300009147 | Ga0114129_10548740 | Ga0114129_105487402 | 325 |
| 548 | 3300014326 | Ga0157380_10215393 | Ga0157380_102153931 | 325 |
| 549 | 3300046538 | Ga0495609_0035857 | Ga0495609_0035857_562_1548 | 325 |
| 550 | 3300049576 | Ga0501040_0129415 | Ga0501040_0129415_14_1096 | 325 |
| 551 | 3300049824 | Ga0501045_0010502 | Ga0501045_0010502_3724_4806 | 325 |
| 552 | 3300050507 | nmdc:mga05p37_108082_c1 | nmdc:mga05p37_108082_c1_896_1909 | 325 |
| 553 | 3300053104 | Ga0500556_0016051 | Ga0500556_0016051_873_1916 | 325 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ofl-assembly1.cif.gz_A | coproporphyrin iii - lmcpfc complex soaked 4min with fe2+ | 0.9249 | 9 | 311 |
| 8aw7-assembly1.cif.gz_A | structure of coproporphyrin iii-lmcpfc r45l | 0.9213 | 9 | 313 |
| 8ofl-assembly1.cif.gz_A | coproporphyrin iii - lmcpfc complex soaked 4min with fe2+ | 0.9133 | 9 | 311 |
| 2h1v-assembly1.cif.gz_A | crystal structure of the lys87ala mutant variant of bacillus subtilis ferrochelatase | 0.91 | 9 | 312 |
| 8aw7-assembly1.cif.gz_A | structure of coproporphyrin iii-lmcpfc r45l | 0.9071 | 9 | 313 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WNE3_5_124_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9377 | 9 | 132 | 3.40.50.1400 |
| 1ak1A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9292 | 153 | 290 | 3.40.50.1400 |
| af_P9WNE3_146_279_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9275 | 158 | 290 | 3.40.50.1400 |
| af_P9WNE3_5_124_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9226 | 9 | 132 | 3.40.50.1400 |
| af_P9WNE3_146_279_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9141 | 158 | 290 | 3.40.50.1400 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383BKM2-F1-model_v4 | Ferrochelatase | 0.9873 | 6 | 239 |
GO:0004325
GO:0006783 |
| AF-A0A7Y4WFJ6-F1-model_v4 | Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) | 0.9856 | 6 | 323 |
GO:0004325
GO:0005737 GO:0006783 GO:0046872 |
| AF-A0A382CW72-F1-model_v4 | Ferrochelatase | 0.9803 | 4 | 159 |
GO:0004325
GO:0006783 |
| AF-A0A2V9XY23-F1-model_v4 | Ferrochelatase | 0.9792 | 7 | 100 |
GO:0004325
GO:0006783 |
| AF-A0A7Y4WUD1-F1-model_v4 | Ferrochelatase | 0.9789 | 4 | 199 |
GO:0004325
GO:0006783 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar