F462879

General Info

Members Datasets Scaffolds Average Seq Length
553 322 1106 89

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100342918|Ga0307416_1003429182
Length 109
Sequence MEHEWSNGQTGLESDPKDAAMIEQDLTVTNRLGLHARATAKLVQTLSAYRSSATLTAKGREVNAKSIMGVMLLAAGQGTQVKLRVEGDDEDQAAAAVVSLFERRFDEDS

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
78 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
79 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
80 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
81 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
82 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
98 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
160 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
161 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
182 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
183 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
184 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
185 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
186 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
187 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
190 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
191 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
192 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
193 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
194 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
197 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
198 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
199 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
202 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
203 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
204 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
205 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
208 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
209 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
210 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
211 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
212 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
213 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
214 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
215 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
216 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
217 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
218 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
219 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
222 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
223 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
224 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
225 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
237 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
257 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
274 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
294 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
295 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
296 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
297 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
298 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
299 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
304 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
305 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
306 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
320 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.19
Nodule 0
Rhizoplane 2.71
Rhizosphere 72.51
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100342918 3300032002 Bacteria 1508
2 SwRhRL2b_contig_145288 2162886007 Bacteria 5558
3 JGI25152J39213_1000866 3300002773 Bacteria 14941
4 JGI25150J39212_1005456 3300002774 Bacteria 2711
5 JGI25159J45721_1041898 3300002987 Bacteria 664
6 JGI25159J45721_1047796 3300002987 Bacteria 596
7 JGI25151J46595_10000351 3300003187 Bacteria 49103
8 JGI25151J46595_10070536 3300003187 Bacteria 1060
9 JGI25151J46595_10070674 3300003187 Bacteria 1058
10 JGI25153J46596_10000219 3300003215 Bacteria 49103
11 rootH1_10228024 3300003323 Bacteria 1233
12 Ga0055526_1000428 3300003771 Bacteria 33858
13 Ga0055537_1000017 3300003773 Bacteria 123856
14 Ga0055537_1001080 3300003773 Bacteria 11996
15 Ga0055524_1000280 3300003775 Bacteria 50037
16 Ga0055524_1031360 3300003775 Bacteria 1530
17 Ga0055536_1004171 3300003781 Bacteria 7477
18 Ga0055536_1004653 3300003781 Bacteria 6939
19 Ga0055534_1000163 3300003784 Bacteria 50001
20 Ga0055534_1000267 3300003784 Bacteria 36162
21 Ga0055534_1018274 3300003784 Bacteria 1222
22 Ga0055528_1000182 3300003790 Bacteria 53454
23 Ga0055528_1000204 3300003790 Bacteria 50037
24 Ga0055530_10001486 3300003791 Bacteria 17027
25 Ga0055530_10004170 3300003791 Bacteria 7633
26 Ga0055530_10031900 3300003791 Bacteria 1377
27 Ga0055531_10019722 3300003794 Bacteria 2709
28 Ga0055531_10031196 3300003794 Bacteria 1771
29 Ga0055531_10047038 3300003794 Bacteria 1178
30 Ga0065704_10070357 3300005289 Bacteria 30374
31 Ga0065707_10102372 3300005295 Bacteria 2810
32 Ga0065707_10299350 3300005295 Bacteria 1008
33 Ga0070676_10182928 3300005328 Bacteria 1364
34 Ga0070676_10828839 3300005328 Bacteria 684
35 Ga0070677_10406146 3300005333 Bacteria 719
36 Ga0068869_100063267 3300005334 Bacteria 2717
37 Ga0068868_100276504 3300005338 Bacteria 1420
38 Ga0070689_100097433 3300005340 Bacteria 2326
39 Ga0070689_101370967 3300005340 Bacteria 638
40 Ga0070691_10452015 3300005341 Bacteria 734
41 Ga0070668_100101467 3300005347 Bacteria 2280
42 Ga0070668_100308055 3300005347 Bacteria 1330
43 Ga0070669_100284429 3300005353 Bacteria 1326
44 Ga0070669_100522997 3300005353 Bacteria 986
45 Ga0070675_100030112 3300005354 Bacteria 4379
46 Ga0070674_100004643 3300005356 Bacteria 7847
47 Ga0070674_101538441 3300005356 Bacteria 599
48 Ga0070673_100134417 3300005364 Bacteria 2080
49 Ga0070673_100814779 3300005364 Bacteria 863
50 Ga0070667_100049436 3300005367 Bacteria 3542
51 Ga0070667_100293756 3300005367 Bacteria 1462
52 Ga0070701_10092027 3300005438 Bacteria 1663
53 Ga0070701_10112782 3300005438 Bacteria 1521
54 Ga0070700_100051280 3300005441 Bacteria 2568
55 Ga0070700_100111477 3300005441 Bacteria 1819
56 Ga0070700_100715563 3300005441 Bacteria 798
57 Ga0070700_101971092 3300005441 Bacteria 506
58 Ga0070694_100058025 3300005444 Bacteria 2632
59 Ga0070663_100182455 3300005455 Bacteria 1629
60 Ga0070678_100110589 3300005456 Bacteria 2149
61 Ga0068867_100005133 3300005459 Bacteria 9252
62 Ga0070685_10066300 3300005466 Bacteria 2127
63 Ga0070686_100609991 3300005544 Bacteria 861
64 Ga0070695_100067019 3300005545 Bacteria 2341
65 Ga0070696_100703984 3300005546 Bacteria 824
66 Ga0070693_100996030 3300005547 Bacteria 634
67 Ga0070665_100000426 3300005548 Bacteria 61588
68 Ga0070665_100016620 3300005548 Bacteria 7373
69 Ga0070704_100339417 3300005549 Bacteria 1265
70 Ga0070702_100032620 3300005615 Bacteria 2859
71 Ga0070702_100228661 3300005615 Bacteria 1248
72 Ga0068859_100283262 3300005617 Bacteria 1750
73 Ga0068859_101275388 3300005617 Bacteria 809
74 Ga0068866_10078681 3300005718 Bacteria 1765
75 Ga0068861_100006910 3300005719 Bacteria 7753
76 Ga0068861_100704301 3300005719 Bacteria 939
77 Ga0068870_10060897 3300005840 Bacteria 2027
78 Ga0068858_100087721 3300005842 Bacteria 2894
79 Ga0068858_100279118 3300005842 Bacteria 1591
80 Ga0068860_100001559 3300005843 Bacteria 24688
81 Ga0068862_100018269 3300005844 Bacteria 5839
82 Ga0068862_100232682 3300005844 Bacteria 1672
83 Ga0068862_100835671 3300005844 Bacteria 902
84 Ga0081539_10052951 3300005985 Bacteria 2275
85 Ga0075365_10025358 3300006038 Bacteria 3752
86 Ga0075363_100176930 3300006048 Bacteria 1213
87 Ga0075363_100613147 3300006048 Bacteria 653
88 Ga0075364_10046386 3300006051 Bacteria 2829
89 Ga0075364_10116412 3300006051 Bacteria 1787
90 Ga0070716_100398343 3300006173 Bacteria 989
91 Ga0075366_10050179 3300006195 Bacteria 2477
92 Ga0075366_10326750 3300006195 Bacteria 940
93 Ga0068871_100684907 3300006358 Bacteria 938
94 Ga0068871_100978936 3300006358 Bacteria 787
95 Ga0075428_100015486 3300006844 Bacteria 8455
96 Ga0075428_100538086 3300006844 Unclassified 1249
97 Ga0075431_100072888 3300006847 Bacteria 3543
98 Ga0075431_100924156 3300006847 Bacteria 841
99 Ga0075433_10255655 3300006852 Bacteria 1554
100 Ga0075434_100152692 3300006871 Unclassified 2329
101 Ga0075434_101981006 3300006871 Bacteria 588
102 Ga0075429_100040836 3300006880 Bacteria 4039
103 Ga0075429_100360121 3300006880 Bacteria 1274
104 Ga0068865_100003673 3300006881 Bacteria 9217
105 Ga0075436_100000080 3300006914 Bacteria 55351
106 Ga0075436_100011138 3300006914 Bacteria 6167
107 Ga0097620_100283260 3300006931 Bacteria 1750
108 Ga0097620_101275417 3300006931 Bacteria 809
109 Ga0075435_100273660 3300007076 Bacteria 1441
110 Ga0075435_101069815 3300007076 Bacteria 705
111 Ga0105251_10002785 3300009011 Bacteria 13292
112 Ga0105244_10069296 3300009036 Bacteria 1761
113 Ga0105244_10095776 3300009036 Bacteria 1456
114 Ga0111539_10037006 3300009094 Bacteria 5897
115 Ga0111539_11445837 3300009094 Bacteria 797
116 Ga0105245_10386246 3300009098 Bacteria 1395
117 Ga0114129_10066031 3300009147 Bacteria 5047
118 Ga0114129_10496808 3300009147 Unclassified 1594
119 Ga0114129_11082380 3300009147 Bacteria 1005
120 Ga0114129_11481661 3300009147 Bacteria 834
121 Ga0105243_10276007 3300009148 Bacteria 1512
122 Ga0105243_10663225 3300009148 Bacteria 1012
123 Ga0105248_10178904 3300009177 Bacteria 2390
124 Ga0105238_11705139 3300009551 Bacteria 661
125 Ga0105249_10028331 3300009553 Bacteria 5056
126 Ga0105032_102131 3300009979 Bacteria 1787
127 Ga0105028_109473 3300009993 Bacteria 1021
128 Ga0157328_1011098 3300012478 Bacteria 634
129 Ga0157318_1018201 3300012482 Bacteria 600
130 Ga0157313_1020458 3300012503 Bacteria 670
131 Ga0157327_1007886 3300012512 Bacteria 940
132 Ga0157373_10184015 3300013100 Bacteria 1471
133 Ga0157371_10002186 3300013102 Bacteria 18979
134 Ga0157371_10020416 3300013102 Bacteria 4875
135 Ga0157370_10010646 3300013104 Bacteria 9681
136 Ga0157370_10112942 3300013104 Bacteria 2539
137 Ga0157378_10001811 3300013297 Bacteria 19191
138 Ga0163162_10017493 3300013306 Bacteria 7014
139 Ga0163162_10383025 3300013306 Bacteria 1540
140 Ga0163163_11825605 3300014325 Bacteria 668
141 Ga0157380_10017645 3300014326 Bacteria 5284
142 Ga0157380_10131540 3300014326 Bacteria 2136
143 Ga0157380_10712059 3300014326 Bacteria 1010
144 Ga0157380_11318696 3300014326 Bacteria 770
145 Ga0182008_10000096 3300014497 Bacteria 67450
146 Ga0182008_10001301 3300014497 Bacteria 17041
147 Ga0157377_11581326 3300014745 Bacteria 524
148 Ga0157379_10227952 3300014968 Bacteria 1688
149 Ga0157376_10578350 3300014969 Bacteria 1115
150 Ga0157376_11242481 3300014969 Bacteria 774
151 Ga0182006_1008250 3300015261 Bacteria 4725
152 Ga0182006_1110862 3300015261 Bacteria 963
153 Ga0182007_10000048 3300015262 Bacteria 103024
154 Ga0182005_1003480 3300015265 Bacteria 5327
155 Ga0183360_10001 3300015689 Bacteria 3943671
156 Ga0183361_11453 3300016635 Bacteria 1217
157 Ga0163161_10030249 3300017792 Bacteria 3852
158 Ga0163161_10541904 3300017792 Bacteria 953
159 Ga0163161_10609356 3300017792 Bacteria 901
160 Ga0207425_1000111 3300025245 Bacteria 77375
161 Ga0207425_1026892 3300025245 Bacteria 1177
162 Ga0209129_1000087 3300025258 Bacteria 179582
163 Ga0209565_1000005 3300025263 Bacteria 947317
164 Ga0209565_1000031 3300025263 Bacteria 320341
165 Ga0209673_1000011 3300025273 Bacteria 586604
166 Ga0209673_1000164 3300025273 Bacteria 138082
167 Ga0209673_1004282 3300025273 Bacteria 7731
168 Ga0209673_1064512 3300025273 Bacteria 898
169 Ga0209130_1002494 3300025284 Bacteria 9108
170 Ga0209130_1005265 3300025284 Bacteria 4553
171 Ga0209675_1000004 3300025291 Bacteria 947166
172 Ga0209675_1000015 3300025291 Bacteria 403517
173 Ga0209675_1006953 3300025291 Bacteria 4437
174 Ga0209675_1015895 3300025291 Bacteria 2215
175 Ga0209676_1000027 3300025292 Bacteria 560222
176 Ga0209676_1000110 3300025292 Bacteria 214083
177 Ga0209676_1001028 3300025292 Bacteria 32470
178 Ga0209676_1001231 3300025292 Bacteria 27052
179 Ga0209676_1005673 3300025292 Bacteria 6424
180 Ga0209676_1016472 3300025292 Bacteria 2666
181 Ga0209025_1000013 3300025294 Bacteria 871757
182 Ga0209025_1003537 3300025294 Bacteria 14653
183 Ga0209025_1007002 3300025294 Bacteria 8559
184 Ga0209025_1042768 3300025294 Bacteria 1919
185 Ga0209025_1048110 3300025294 Bacteria 1732
186 Ga0209025_1116044 3300025294 Bacteria 810
187 Ga0209564_1000018 3300025295 Bacteria 586913
188 Ga0209564_1000037 3300025295 Bacteria 414794
189 Ga0209564_1008868 3300025295 Bacteria 4891
190 Ga0209758_1000014 3300025297 Bacteria 871757
191 Ga0209758_1037036 3300025297 Bacteria 1892
192 Ga0209050_1000417 3300025298 Bacteria 78631
193 Ga0209050_1001410 3300025298 Bacteria 26010
194 Ga0209050_1002473 3300025298 Bacteria 15717
195 Ga0209050_1015285 3300025298 Bacteria 3236
196 Ga0209256_1000021 3300025299 Bacteria 537097
197 Ga0209256_1002158 3300025299 Bacteria 16970
198 Ga0209256_1002613 3300025299 Bacteria 14247
199 Ga0209256_1008601 3300025299 Bacteria 4688
200 Ga0209256_1015165 3300025299 Bacteria 2715
201 Ga0209051_1001882 3300025303 Bacteria 16414
202 Ga0209051_1039697 3300025303 Bacteria 1696
203 Ga0209257_1000129 3300025304 Bacteria 214155
204 Ga0209257_1000274 3300025304 Bacteria 117076
205 Ga0209257_1000670 3300025304 Bacteria 53641
206 Ga0209257_1001580 3300025304 Bacteria 26249
207 Ga0209257_1003605 3300025304 Bacteria 13052
208 Ga0207655_1050978 3300025728 Bacteria 1677
209 Ga0207713_1037920 3300025735 Bacteria 2050
210 Ga0207682_10037813 3300025893 Bacteria 1956
211 Ga0207645_10372596 3300025907 Bacteria 957
212 Ga0207643_10025859 3300025908 Bacteria 3247
213 Ga0207662_10062619 3300025918 Bacteria 2236
214 Ga0207662_10125440 3300025918 Bacteria 1614
215 Ga0207681_10129166 3300025923 Bacteria 1866
216 Ga0207681_10500011 3300025923 Bacteria 995
217 Ga0207659_10155795 3300025926 Bacteria 1788
218 Ga0207687_11544644 3300025927 Bacteria 570
219 Ga0207709_10001341 3300025935 Bacteria 17363
220 Ga0207670_10848363 3300025936 Bacteria 763
221 Ga0207669_10067732 3300025937 Bacteria 2226
222 Ga0207704_10021633 3300025938 Bacteria 3429
223 Ga0207704_11851762 3300025938 Bacteria 519
224 Ga0207691_10394107 3300025940 Bacteria 1181
225 Ga0207711_10525154 3300025941 Unclassified 1104
226 Ga0207689_10023675 3300025942 Bacteria 5150
227 Ga0207651_10074768 3300025960 Bacteria 2414
228 Ga0207651_10108211 3300025960 Bacteria 2080
229 Ga0207651_10647467 3300025960 Bacteria 927
230 Ga0207712_10066694 3300025961 Bacteria 2573
231 Ga0207668_10171005 3300025972 Bacteria 1704
232 Ga0207668_10226106 3300025972 Bacteria 1506
233 Ga0207668_10276307 3300025972 Bacteria 1375
234 Ga0207658_10219884 3300025986 Bacteria 1597
235 Ga0207658_10557962 3300025986 Bacteria 1025
236 Ga0207703_10057752 3300026035 Bacteria 3165
237 Ga0207703_10209043 3300026035 Bacteria 1739
238 Ga0207678_10096767 3300026067 Bacteria 2523
239 Ga0207708_10044954 3300026075 Bacteria 3365
240 Ga0207708_11440849 3300026075 Bacteria 605
241 Ga0207648_10000419 3300026089 Bacteria 46680
242 Ga0207676_11025538 3300026095 Bacteria 814
243 Ga0207675_100004240 3300026118 Bacteria 13863
244 Ga0207675_100746718 3300026118 Bacteria 990
245 Ga0207675_101334667 3300026118 Bacteria 738
246 Ga0207683_10107322 3300026121 Bacteria 2498
247 Ga0209969_1025153 3300027360 Bacteria 897
248 Ga0209981_1017637 3300027378 Bacteria 1009
249 Ga0209996_1012267 3300027395 Bacteria 1150
250 Ga0210000_1057197 3300027462 Bacteria 629
251 Ga0209995_1030699 3300027471 Bacteria 899
252 Ga0209968_1018613 3300027526 Bacteria 1114
253 Ga0209982_1002284 3300027552 Bacteria 2685
254 Ga0209983_1019290 3300027665 Bacteria 1417
255 Ga0209588_1099186 3300027671 Bacteria 937
256 Ga0209971_1003169 3300027682 Bacteria 3923
257 Ga0209966_1002105 3300027695 Bacteria 3324
258 Ga0209998_10116260 3300027717 Bacteria 671
259 Ga0209974_10027381 3300027876 Bacteria 1885
260 Ga0207428_10075254 3300027907 Bacteria 2646
261 Ga0207428_10095871 3300027907 Bacteria 2298
262 Ga0268266_10000741 3300028379 Bacteria 43685
263 Ga0268266_10059786 3300028379 Bacteria 3283
264 Ga0268265_10019602 3300028380 Bacteria 4705
265 Ga0268265_10096628 3300028380 Bacteria 2375
266 Ga0268265_10397887 3300028380 Bacteria 1272
267 Ga0268265_12647744 3300028380 Bacteria 507
268 Ga0268264_10002884 3300028381 Bacteria 14955
269 Ga0307515_10093168 3300028794 Bacteria 3739
270 Ga0316176_1013813 3300030732 Bacteria 3135
271 Ga0316176_1040133 3300030732 Bacteria 1165
272 Ga0316181_1005833 3300030744 Bacteria 3389
273 Ga0316182_1061642 3300030745 Bacteria 870
274 Ga0265330_10084253 3300031235 Bacteria 1368
275 Ga0265316_10333791 3300031344 Bacteria 1100
276 Ga0307513_10151000 3300031456 Bacteria 2232
277 Ga0307408_100360066 3300031548 Bacteria 1237
278 Ga0307408_101008178 3300031548 Bacteria 768
279 Ga0307408_101078557 3300031548 Bacteria 744
280 Ga0307408_101344831 3300031548 Bacteria 671
281 Ga0307408_102213959 3300031548 Bacteria 531
282 Ga0307508_10066109 3300031616 Bacteria 3184
283 Ga0307405_10229291 3300031731 Bacteria 1368
284 Ga0307405_10318632 3300031731 Bacteria 1187
285 Ga0307405_10338901 3300031731 Bacteria 1155
286 Ga0307405_10497702 3300031731 Bacteria 976
287 Ga0307405_10783784 3300031731 Bacteria 797
288 Ga0307405_11353224 3300031731 Bacteria 621
289 Ga0307413_10042618 3300031824 Bacteria 2669
290 Ga0307413_10151902 3300031824 Bacteria 1615
291 Ga0307413_10569113 3300031824 Bacteria 922
292 Ga0307413_10896730 3300031824 Bacteria 753
293 Ga0307413_11082303 3300031824 Bacteria 691
294 Ga0307413_11397568 3300031824 Bacteria 615
295 Ga0307410_11277569 3300031852 Bacteria 641
296 Ga0307406_10089496 3300031901 Bacteria 2068
297 Ga0307406_10578196 3300031901 Bacteria 923
298 Ga0307407_10540640 3300031903 Bacteria 860
299 Ga0307412_10055820 3300031911 Bacteria 2629
300 Ga0307412_10070447 3300031911 Bacteria 2383
301 Ga0307412_10093932 3300031911 Bacteria 2105
302 Ga0307412_10904203 3300031911 Bacteria 774
303 Ga0307412_11195568 3300031911 Bacteria 680
304 Ga0307409_100793194 3300031995 Bacteria 954
305 Ga0307409_101205923 3300031995 Bacteria 780
306 Ga0307409_101248142 3300031995 Bacteria 767
307 Ga0307409_101995134 3300031995 Bacteria 610
308 Ga0307416_100168763 3300032002 Bacteria 2034
309 Ga0307416_100201334 3300032002 Bacteria 1889
310 Ga0307416_101201320 3300032002 Bacteria 864
311 Ga0307416_101280090 3300032002 Bacteria 839
312 Ga0307416_103273529 3300032002 Bacteria 542
313 Ga0307416_103373793 3300032002 Bacteria 534
314 Ga0307414_10008172 3300032004 Bacteria 5917
315 Ga0307414_10010308 3300032004 Bacteria 5415
316 Ga0307414_10024671 3300032004 Bacteria 3838
317 Ga0307414_10034606 3300032004 Bacteria 3352
318 Ga0307414_10044477 3300032004 Bacteria 3033
319 Ga0307414_10057247 3300032004 Bacteria 2739
320 Ga0307414_10094649 3300032004 Bacteria 2230
321 Ga0307414_10097637 3300032004 Bacteria 2201
322 Ga0307414_10236817 3300032004 Bacteria 1508
323 Ga0307414_10526910 3300032004 Bacteria 1049
324 Ga0307414_10714026 3300032004 Bacteria 908
325 Ga0307414_11621869 3300032004 Bacteria 603
326 Ga0307411_10010665 3300032005 Bacteria 4912
327 Ga0307411_10012920 3300032005 Bacteria 4581
328 Ga0307411_10315419 3300032005 Bacteria 1260
329 Ga0307411_10327677 3300032005 Bacteria 1239
330 Ga0307411_10377285 3300032005 Bacteria 1165
331 Ga0373946_0438101 3300035171 Bacteria 664
332 Ga0373961_0000811 3300035241 Bacteria 10650
333 Ga0373924_0257993 3300035410 Bacteria 772
334 Ga0373935_0000870 3300035692 Bacteria 16289
335 Ga0373935_0712215 3300035692 Bacteria 738
336 Ga0373925_0011924 3300037068 Bacteria 6290
337 Ga0237819_00040 3300038705 Bacteria 45528
338 Ga0400488_58698 3300038741 Bacteria 2800
339 Ga0400486_30163 3300038742 Bacteria 9678
340 Ga0400483_151922 3300039062 Bacteria 3455
341 Ga0400489_75675 3300039093 Bacteria 7837
342 Ga0400487_48277 3300039110 Bacteria 1769
343 Ga0237816_01328 3300039145 Bacteria 1999
344 Ga0439436_0009624 3300041404 Bacteria 2963
345 Ga0439436_0093051 3300041404 Bacteria 839
346 Ga0439439_0018976 3300041406 Bacteria 1703
347 Ga0439439_0034156 3300041406 Bacteria 1304
348 Ga0439439_0274738 3300041406 Bacteria 504
349 Ga0439453_0063592 3300041408 Bacteria 769
350 Ga0439466_0207546 3300041411 Bacteria 595
351 Ga0439465_0005832 3300041413 Bacteria 3921
352 Ga0439465_0008429 3300041413 Bacteria 3254
353 Ga0439465_0013607 3300041413 Bacteria 2534
354 Ga0439465_0329133 3300041413 Bacteria 575
355 Ga0451787_065104 3300041441 Bacteria 1318
356 Ga0451791_0906637 3300041451 Bacteria 579
357 Ga0451793_0670350 3300041452 Bacteria 1676
358 Ga0451797_0158336 3300041453 Bacteria 772
359 Ga0451795_0787166 3300041456 Bacteria 776
360 Ga0451795_1518945 3300041456 Bacteria 702
361 Ga0451802_2076607 3300041460 Bacteria 892
362 Ga0451804_1029255 3300041463 Bacteria 1278
363 Ga0451807_0199166 3300041486 Unclassified 1161
364 Ga0451807_2137752 3300041486 Bacteria 781
365 Ga0451807_2709952 3300041486 Bacteria 3601
366 Ga0451837_1410386 3300041494 Bacteria 527
367 Ga0451841_0417243 3300041498 Bacteria 556
368 Ga0451841_0652781 3300041498 Bacteria 683
369 Ga0451849_0218415 3300041505 Bacteria 855
370 Ga0451849_0443800 3300041505 Bacteria 818
371 Ga0451843_0941578 3300041509 Bacteria 642
372 Ga0451843_1288714 3300041509 Bacteria 1290
373 Ga0451855_1858647 3300041511 Bacteria 593
374 Ga0451853_1337486 3300041512 Bacteria 643
375 Ga0439431_0120939 3300041997 Bacteria 730
376 Ga0439433_0015296 3300041999 Bacteria 1694
377 Ga0439433_0026976 3300041999 Bacteria 1301
378 Ga0439441_009870 3300042001 Bacteria 1590
379 Ga0439443_003655 3300042003 Bacteria 1958
380 Ga0439445_0007424 3300042004 Bacteria 2542
381 Ga0439432_006888 3300042006 Bacteria 4047
382 Ga0439432_013892 3300042006 Bacteria 2730
383 Ga0439432_032834 3300042006 Bacteria 1672
384 Ga0439432_083027 3300042006 Bacteria 969
385 Ga0439432_152561 3300042006 Bacteria 678
386 Ga0439449_0000004 3300042007 Bacteria 82454
387 Ga0439449_0004225 3300042007 Bacteria 5551
388 Ga0439449_0011914 3300042007 Bacteria 3269
389 Ga0439449_0019204 3300042007 Bacteria 2562
390 Ga0439449_0023109 3300042007 Bacteria 2327
391 Ga0439449_0042411 3300042007 Bacteria 1690
392 Ga0439449_0158662 3300042007 Bacteria 844
393 Ga0439452_006295 3300042010 Bacteria 3726
394 Ga0439456_055061 3300042013 Bacteria 871
395 Ga0439457_028763 3300042014 Bacteria 1231
396 Ga0439462_0038859 3300042015 Bacteria 1268
397 Ga0439462_0142312 3300042015 Bacteria 672
398 Ga0450913_000155 3300042117 Bacteria 2172
399 Ga0450905_039642 3300042142 Bacteria 746
400 Ga0439446_0319122 3300042156 Bacteria 548
401 Ga0439434_0237040 3300042435 Bacteria 622
402 Ga0439435_0022550 3300042436 Bacteria 1644
403 Ga0439444_0004861 3300042437 Bacteria 1969
404 Ga0439460_0006933 3300042461 Bacteria 2822
405 Ga0450901_013957 3300042533 Bacteria 843
406 Ga0451577_0002652 3300042876 Bacteria 20952
407 Ga0451577_0075623 3300042876 Bacteria 3003
408 Ga0453684_0000316 3300044712 Bacteria 204457
409 Ga0453684_0193639 3300044712 Bacteria 2376
410 Ga0451576_0000128 3300045051 Bacteria 192071
411 Ga0451576_0145340 3300045051 Bacteria 2472
412 Ga0451576_1427909 3300045051 Bacteria 720
413 Ga0466967_0965632 3300045976 Bacteria 848
414 Ga0495627_008906 3300046453 Bacteria 3718
415 Ga0495590_0124383 3300046457 Bacteria 925
416 Ga0495591_023418 3300046458 Bacteria 1979
417 Ga0495638_0000881 3300046460 Bacteria 30946
418 Ga0495638_0032950 3300046460 Bacteria 3316
419 Ga0495638_0134946 3300046460 Bacteria 1446
420 Ga0495639_0170148 3300046475 Bacteria 1057
421 Ga0495584_0104222 3300046491 Bacteria 1434
422 Ga0495610_0003046 3300046512 Bacteria 13417
423 Ga0495610_0108996 3300046512 Bacteria 1229
424 Ga0495616_0037555 3300046513 Bacteria 2491
425 Ga0495628_0093103 3300046516 Bacteria 2331
426 Ga0495631_0001525 3300046518 Bacteria 13955
427 Ga0495632_0385726 3300046519 Bacteria 613
428 Ga0495663_0110065 3300046525 Bacteria 914
429 Ga0495640_0025999 3300046533 Bacteria 4238
430 Ga0495586_0010802 3300046535 Bacteria 4855
431 Ga0495609_0174390 3300046538 Bacteria 907
432 Ga0495633_0026731 3300046558 Bacteria 2828
433 Ga0495633_0043387 3300046558 Bacteria 2134
434 Ga0495633_0113725 3300046558 Bacteria 1255
435 Ga0495656_0001001 3300046615 Bacteria 9129
436 Ga0495625_0058167 3300046660 Bacteria 2747
437 Ga0495625_0653762 3300046660 Bacteria 625
438 Ga0495635_0082917 3300046663 Bacteria 2194
439 Ga0495647_0458191 3300046681 Bacteria 591
440 Ga0495669_0101260 3300046684 Bacteria 1338
441 Ga0495670_0022391 3300046691 Bacteria 3120
442 Ga0495660_0026745 3300046810 Bacteria 3268
443 Ga0495604_0052433 3300047317 Bacteria 3159
444 Ga0495636_0048228 3300047318 Bacteria 1779
445 Ga0495672_0000090 3300047320 Bacteria 148367
446 Ga0495672_0068871 3300047320 Bacteria 2010
447 Ga0495681_0101983 3300047470 Bacteria 1253
448 Ga0495686_0016694 3300047472 Bacteria 4970
449 Ga0495686_0104192 3300047472 Bacteria 1708
450 Ga0496104_0425145 3300048907 Bacteria 1240
451 Ga0496110_0224170 3300048913 Bacteria 1710
452 Ga0496111_0981890 3300048914 Bacteria 606
453 Ga0496114_0000013 3300048917 Bacteria 317623
454 Ga0496116_0021188 3300048919 Bacteria 4908
455 Ga0496116_0119316 3300048919 Bacteria 1530
456 Ga0496117_0000617 3300048920 Bacteria 57555
457 Ga0496117_0003428 3300048920 Bacteria 18442
458 Ga0496117_0008591 3300048920 Bacteria 9679
459 Ga0496117_0057014 3300048920 Bacteria 2716
460 Ga0496118_0000404 3300048921 Bacteria 72202
461 Ga0496118_0000737 3300048921 Bacteria 52822
462 Ga0496118_0044462 3300048921 Bacteria 3477
463 Ga0496118_0049885 3300048921 Bacteria 3218
464 Ga0496118_0079564 3300048921 Bacteria 2312
465 Ga0496119_0000329 3300048922 Bacteria 66425
466 Ga0496120_0000147 3300048923 Bacteria 117881
467 Ga0496121_0002594 3300048924 Bacteria 27284
468 Ga0496121_0074522 3300048924 Bacteria 2714
469 Ga0496121_0135493 3300048924 Bacteria 1835
470 Ga0496122_0420970 3300048925 Bacteria 671
471 Ga0496122_0452535 3300048925 Bacteria 636
472 Ga0496123_0113760 3300048926 Bacteria 1540
473 Ga0496123_0361682 3300048926 Bacteria 671
474 Ga0496124_0000680 3300048927 Bacteria 55821
475 Ga0496124_0006616 3300048927 Bacteria 12584
476 Ga0496124_0117367 3300048927 Bacteria 2131
477 Ga0496124_0216655 3300048927 Bacteria 1443
478 Ga0496124_0250764 3300048927 Bacteria 1309
479 Ga0496124_0847527 3300048927 Bacteria 560
480 Ga0496125_0026103 3300048928 Bacteria 5334
481 Ga0496125_0026456 3300048928 Bacteria 5287
482 Ga0496125_0085664 3300048928 Bacteria 2386
483 Ga0496125_0120654 3300048928 Bacteria 1871
484 Ga0496125_0199951 3300048928 Bacteria 1309
485 Ga0496126_0000967 3300048929 Bacteria 49289
486 Ga0496126_0011304 3300048929 Bacteria 9261
487 Ga0501290_002699 3300049513 Bacteria 2277
488 Ga0501031_0016530 3300049568 Bacteria 4793
489 Ga0501032_0364104 3300049569 Bacteria 930
490 Ga0501033_0024972 3300049570 Bacteria 4503
491 Ga0501034_0000552 3300049571 Bacteria 59397
492 Ga0501034_0193975 3300049571 Bacteria 1992
493 Ga0501036_0142199 3300049572 Bacteria 2024
494 Ga0501037_0046698 3300049573 Bacteria 3176
495 Ga0501038_0015316 3300049574 Bacteria 6971
496 Ga0501039_0027266 3300049575 Bacteria 4392
497 Ga0501040_0962210 3300049576 Bacteria 619
498 Ga0501043_0001713 3300049579 Bacteria 18952
499 Ga0501043_0120368 3300049579 Bacteria 2058
500 Ga0501047_0163739 3300049581 Bacteria 2095
501 Ga0501067_0003235 3300049583 Bacteria 8968
502 Ga0501068_0013166 3300049584 Bacteria 4703
503 Ga0501070_0037650 3300049586 Bacteria 4038
504 Ga0501071_0182798 3300049587 Bacteria 1571
505 Ga0501072_0351258 3300049588 Bacteria 1171
506 Ga0501075_0001709 3300049591 Bacteria 14423
507 Ga0501076_0874263 3300049592 Bacteria 741
508 Ga0501076_0945664 3300049592 Bacteria 710
509 Ga0501077_0000027 3300049593 Bacteria 75456
510 Ga0501202_070303 3300049652 Bacteria 806
511 Ga0501216_055228 3300049660 Bacteria 789
512 Ga0501227_244124 3300049665 Bacteria 512
513 Ga0501242_026322 3300049674 Bacteria 769
514 Ga0501243_031548 3300049675 Bacteria 906
515 Ga0501221_126955 3300049704 Bacteria 657
516 Ga0501225_0002344 3300049705 Bacteria 5843
517 Ga0501225_0369284 3300049705 Bacteria 500
518 Ga0501079_0756017 3300049741 Bacteria 765
519 Ga0501080_0004080 3300049742 Bacteria 12938
520 Ga0501080_0255110 3300049742 Bacteria 1599
521 Ga0501081_0018085 3300049743 Bacteria 4677
522 Ga0501263_082043 3300049760 Bacteria 534
523 Ga0501265_034996 3300049762 Bacteria 738
524 Ga0501275_000326 3300049772 Bacteria 5419
525 Ga0501283_013123 3300049779 Bacteria 1252
526 Ga0501035_0061152 3300049822 Bacteria 3352
527 Ga0501044_0147113 3300049823 Bacteria 2340
528 Ga0501045_0233189 3300049824 Bacteria 1370
529 nmdc:mga00v17_107765_c1 3300050491 Bacteria 1765
530 nmdc:mga0yw44_181472_c1 3300050492 Bacteria 1385
531 nmdc:mga0k408_86383_c1 3300050493 Bacteria 1841
532 nmdc:mga05p37_194609_c1 3300050507 Bacteria 2459
533 nmdc:mga05p37_300249_c1 3300050507 Bacteria 1908
534 nmdc:mga05p37_385218_c1 3300050507 Bacteria 1641
535 nmdc:mga05p37_404497_c1 3300050507 Unclassified 1593
536 nmdc:mga09592_359249_c1 3300050508 Bacteria 1261
537 nmdc:mga09592_380982_c1 3300050508 Bacteria 1220
538 nmdc:mga0qj67_153139_c1 3300050509 Bacteria 1871
539 nmdc:mga0qj67_334250_c1 3300050509 Bacteria 1226
540 nmdc:mga0qj67_828319_c1 3300050509 Bacteria 732
541 nmdc:mga06r32_1584980_c1 3300050510 Bacteria 594
542 nmdc:mga06r32_257641_c1 3300050510 Bacteria 1732
543 nmdc:mga06r32_655568_c1 3300050510 Bacteria 1018
544 nmdc:mga08y16_1433197_c1 3300050511 Bacteria 653
545 nmdc:mga08y16_15097_c1 3300050511 Bacteria 8121
546 nmdc:mga08y16_885874_c1 3300050511 Bacteria 880
547 nmdc:mga0n895_212888_c1 3300050512 Bacteria 1963
548 nmdc:mga08x19_186_c1 3300050514 Bacteria 49520
549 nmdc:mga08x19_5414_c1 3300050514 Bacteria 7550
550 nmdc:mga0a205_398937_c1 3300050515 Bacteria 1239
551 Ga0495601_0262205 3300053077 Bacteria 1128
552 Ga0501082_0001428 3300060353 Bacteria 20984
553 Ga0501082_0768563 3300060353 Bacteria 843
554 Ga0307416_100342918
555 SwRhRL2b_contig_145288
556 JGI25152J39213_1000866
557 JGI25150J39212_1005456
558 JGI25159J45721_1041898
559 JGI25159J45721_1047796
560 JGI25151J46595_10000351
561 JGI25151J46595_10070536
562 JGI25151J46595_10070674
563 JGI25153J46596_10000219
564 rootH1_10228024
565 Ga0055526_1000428
566 Ga0055537_1000017
567 Ga0055537_1001080
568 Ga0055524_1000280
569 Ga0055524_1031360
570 Ga0055536_1004171
571 Ga0055536_1004653
572 Ga0055534_1000163
573 Ga0055534_1000267
574 Ga0055534_1018274
575 Ga0055528_1000182
576 Ga0055528_1000204
577 Ga0055530_10001486
578 Ga0055530_10004170
579 Ga0055530_10031900
580 Ga0055531_10019722
581 Ga0055531_10031196
582 Ga0055531_10047038
583 Ga0065704_10070357
584 Ga0065707_10102372
585 Ga0065707_10299350
586 Ga0070676_10182928
587 Ga0070676_10828839
588 Ga0070677_10406146
589 Ga0068869_100063267
590 Ga0068868_100276504
591 Ga0070689_100097433
592 Ga0070689_101370967
593 Ga0070691_10452015
594 Ga0070668_100101467
595 Ga0070668_100308055
596 Ga0070669_100284429
597 Ga0070669_100522997
598 Ga0070675_100030112
599 Ga0070674_100004643
600 Ga0070674_101538441
601 Ga0070673_100134417
602 Ga0070673_100814779
603 Ga0070667_100049436
604 Ga0070667_100293756
605 Ga0070701_10092027
606 Ga0070701_10112782
607 Ga0070700_100051280
608 Ga0070700_100111477
609 Ga0070700_100715563
610 Ga0070700_101971092
611 Ga0070694_100058025
612 Ga0070663_100182455
613 Ga0070678_100110589
614 Ga0068867_100005133
615 Ga0070685_10066300
616 Ga0070686_100609991
617 Ga0070695_100067019
618 Ga0070696_100703984
619 Ga0070693_100996030
620 Ga0070665_100000426
621 Ga0070665_100016620
622 Ga0070704_100339417
623 Ga0070702_100032620
624 Ga0070702_100228661
625 Ga0068859_100283262
626 Ga0068859_101275388
627 Ga0068866_10078681
628 Ga0068861_100006910
629 Ga0068861_100704301
630 Ga0068870_10060897
631 Ga0068858_100087721
632 Ga0068858_100279118
633 Ga0068860_100001559
634 Ga0068862_100018269
635 Ga0068862_100232682
636 Ga0068862_100835671
637 Ga0081539_10052951
638 Ga0075365_10025358
639 Ga0075363_100176930
640 Ga0075363_100613147
641 Ga0075364_10046386
642 Ga0075364_10116412
643 Ga0070716_100398343
644 Ga0075366_10050179
645 Ga0075366_10326750
646 Ga0068871_100684907
647 Ga0068871_100978936
648 Ga0075428_100015486
649 Ga0075428_100538086
650 Ga0075431_100072888
651 Ga0075431_100924156
652 Ga0075433_10255655
653 Ga0075434_100152692
654 Ga0075434_101981006
655 Ga0075429_100040836
656 Ga0075429_100360121
657 Ga0068865_100003673
658 Ga0075436_100000080
659 Ga0075436_100011138
660 Ga0097620_100283260
661 Ga0097620_101275417
662 Ga0075435_100273660
663 Ga0075435_101069815
664 Ga0105251_10002785
665 Ga0105244_10069296
666 Ga0105244_10095776
667 Ga0111539_10037006
668 Ga0111539_11445837
669 Ga0105245_10386246
670 Ga0114129_10066031
671 Ga0114129_10496808
672 Ga0114129_11082380
673 Ga0114129_11481661
674 Ga0105243_10276007
675 Ga0105243_10663225
676 Ga0105248_10178904
677 Ga0105238_11705139
678 Ga0105249_10028331
679 Ga0105032_102131
680 Ga0105028_109473
681 Ga0157328_1011098
682 Ga0157318_1018201
683 Ga0157313_1020458
684 Ga0157327_1007886
685 Ga0157373_10184015
686 Ga0157371_10002186
687 Ga0157371_10020416
688 Ga0157370_10010646
689 Ga0157370_10112942
690 Ga0157378_10001811
691 Ga0163162_10017493
692 Ga0163162_10383025
693 Ga0163163_11825605
694 Ga0157380_10017645
695 Ga0157380_10131540
696 Ga0157380_10712059
697 Ga0157380_11318696
698 Ga0182008_10000096
699 Ga0182008_10001301
700 Ga0157377_11581326
701 Ga0157379_10227952
702 Ga0157376_10578350
703 Ga0157376_11242481
704 Ga0182006_1008250
705 Ga0182006_1110862
706 Ga0182007_10000048
707 Ga0182005_1003480
708 Ga0183360_10001
709 Ga0183361_11453
710 Ga0163161_10030249
711 Ga0163161_10541904
712 Ga0163161_10609356
713 Ga0207425_1000111
714 Ga0207425_1026892
715 Ga0209129_1000087
716 Ga0209565_1000005
717 Ga0209565_1000031
718 Ga0209673_1000011
719 Ga0209673_1000164
720 Ga0209673_1004282
721 Ga0209673_1064512
722 Ga0209130_1002494
723 Ga0209130_1005265
724 Ga0209675_1000004
725 Ga0209675_1000015
726 Ga0209675_1006953
727 Ga0209675_1015895
728 Ga0209676_1000027
729 Ga0209676_1000110
730 Ga0209676_1001028
731 Ga0209676_1001231
732 Ga0209676_1005673
733 Ga0209676_1016472
734 Ga0209025_1000013
735 Ga0209025_1003537
736 Ga0209025_1007002
737 Ga0209025_1042768
738 Ga0209025_1048110
739 Ga0209025_1116044
740 Ga0209564_1000018
741 Ga0209564_1000037
742 Ga0209564_1008868
743 Ga0209758_1000014
744 Ga0209758_1037036
745 Ga0209050_1000417
746 Ga0209050_1001410
747 Ga0209050_1002473
748 Ga0209050_1015285
749 Ga0209256_1000021
750 Ga0209256_1002158
751 Ga0209256_1002613
752 Ga0209256_1008601
753 Ga0209256_1015165
754 Ga0209051_1001882
755 Ga0209051_1039697
756 Ga0209257_1000129
757 Ga0209257_1000274
758 Ga0209257_1000670
759 Ga0209257_1001580
760 Ga0209257_1003605
761 Ga0207655_1050978
762 Ga0207713_1037920
763 Ga0207682_10037813
764 Ga0207645_10372596
765 Ga0207643_10025859
766 Ga0207662_10062619
767 Ga0207662_10125440
768 Ga0207681_10129166
769 Ga0207681_10500011
770 Ga0207659_10155795
771 Ga0207687_11544644
772 Ga0207709_10001341
773 Ga0207670_10848363
774 Ga0207669_10067732
775 Ga0207704_10021633
776 Ga0207704_11851762
777 Ga0207691_10394107
778 Ga0207711_10525154
779 Ga0207689_10023675
780 Ga0207651_10074768
781 Ga0207651_10108211
782 Ga0207651_10647467
783 Ga0207712_10066694
784 Ga0207668_10171005
785 Ga0207668_10226106
786 Ga0207668_10276307
787 Ga0207658_10219884
788 Ga0207658_10557962
789 Ga0207703_10057752
790 Ga0207703_10209043
791 Ga0207678_10096767
792 Ga0207708_10044954
793 Ga0207708_11440849
794 Ga0207648_10000419
795 Ga0207676_11025538
796 Ga0207675_100004240
797 Ga0207675_100746718
798 Ga0207675_101334667
799 Ga0207683_10107322
800 Ga0209969_1025153
801 Ga0209981_1017637
802 Ga0209996_1012267
803 Ga0210000_1057197
804 Ga0209995_1030699
805 Ga0209968_1018613
806 Ga0209982_1002284
807 Ga0209983_1019290
808 Ga0209588_1099186
809 Ga0209971_1003169
810 Ga0209966_1002105
811 Ga0209998_10116260
812 Ga0209974_10027381
813 Ga0207428_10075254
814 Ga0207428_10095871
815 Ga0268266_10000741
816 Ga0268266_10059786
817 Ga0268265_10019602
818 Ga0268265_10096628
819 Ga0268265_10397887
820 Ga0268265_12647744
821 Ga0268264_10002884
822 Ga0307515_10093168
823 Ga0316176_1013813
824 Ga0316176_1040133
825 Ga0316181_1005833
826 Ga0316182_1061642
827 Ga0265330_10084253
828 Ga0265316_10333791
829 Ga0307513_10151000
830 Ga0307408_100360066
831 Ga0307408_101008178
832 Ga0307408_101078557
833 Ga0307408_101344831
834 Ga0307408_102213959
835 Ga0307508_10066109
836 Ga0307405_10229291
837 Ga0307405_10318632
838 Ga0307405_10338901
839 Ga0307405_10497702
840 Ga0307405_10783784
841 Ga0307405_11353224
842 Ga0307413_10042618
843 Ga0307413_10151902
844 Ga0307413_10569113
845 Ga0307413_10896730
846 Ga0307413_11082303
847 Ga0307413_11397568
848 Ga0307410_11277569
849 Ga0307406_10089496
850 Ga0307406_10578196
851 Ga0307407_10540640
852 Ga0307412_10055820
853 Ga0307412_10070447
854 Ga0307412_10093932
855 Ga0307412_10904203
856 Ga0307412_11195568
857 Ga0307409_100793194
858 Ga0307409_101205923
859 Ga0307409_101248142
860 Ga0307409_101995134
861 Ga0307416_100168763
862 Ga0307416_100201334
863 Ga0307416_101201320
864 Ga0307416_101280090
865 Ga0307416_103273529
866 Ga0307416_103373793
867 Ga0307414_10008172
868 Ga0307414_10010308
869 Ga0307414_10024671
870 Ga0307414_10034606
871 Ga0307414_10044477
872 Ga0307414_10057247
873 Ga0307414_10094649
874 Ga0307414_10097637
875 Ga0307414_10236817
876 Ga0307414_10526910
877 Ga0307414_10714026
878 Ga0307414_11621869
879 Ga0307411_10010665
880 Ga0307411_10012920
881 Ga0307411_10315419
882 Ga0307411_10327677
883 Ga0307411_10377285
884 Ga0373946_0438101
885 Ga0373961_0000811
886 Ga0373924_0257993
887 Ga0373935_0000870
888 Ga0373935_0712215
889 Ga0373925_0011924
890 Ga0237819_00040
891 Ga0400488_58698
892 Ga0400486_30163
893 Ga0400483_151922
894 Ga0400489_75675
895 Ga0400487_48277
896 Ga0237816_01328
897 Ga0439436_0009624
898 Ga0439436_0093051
899 Ga0439439_0018976
900 Ga0439439_0034156
901 Ga0439439_0274738
902 Ga0439453_0063592
903 Ga0439466_0207546
904 Ga0439465_0005832
905 Ga0439465_0008429
906 Ga0439465_0013607
907 Ga0439465_0329133
908 Ga0451787_065104
909 Ga0451791_0906637
910 Ga0451793_0670350
911 Ga0451797_0158336
912 Ga0451795_0787166
913 Ga0451795_1518945
914 Ga0451802_2076607
915 Ga0451804_1029255
916 Ga0451807_0199166
917 Ga0451807_2137752
918 Ga0451807_2709952
919 Ga0451837_1410386
920 Ga0451841_0417243
921 Ga0451841_0652781
922 Ga0451849_0218415
923 Ga0451849_0443800
924 Ga0451843_0941578
925 Ga0451843_1288714
926 Ga0451855_1858647
927 Ga0451853_1337486
928 Ga0439431_0120939
929 Ga0439433_0015296
930 Ga0439433_0026976
931 Ga0439441_009870
932 Ga0439443_003655
933 Ga0439445_0007424
934 Ga0439432_006888
935 Ga0439432_013892
936 Ga0439432_032834
937 Ga0439432_083027
938 Ga0439432_152561
939 Ga0439449_0000004
940 Ga0439449_0004225
941 Ga0439449_0011914
942 Ga0439449_0019204
943 Ga0439449_0023109
944 Ga0439449_0042411
945 Ga0439449_0158662
946 Ga0439452_006295
947 Ga0439456_055061
948 Ga0439457_028763
949 Ga0439462_0038859
950 Ga0439462_0142312
951 Ga0450913_000155
952 Ga0450905_039642
953 Ga0439446_0319122
954 Ga0439434_0237040
955 Ga0439435_0022550
956 Ga0439444_0004861
957 Ga0439460_0006933
958 Ga0450901_013957
959 Ga0451577_0002652
960 Ga0451577_0075623
961 Ga0453684_0000316
962 Ga0453684_0193639
963 Ga0451576_0000128
964 Ga0451576_0145340
965 Ga0451576_1427909
966 Ga0466967_0965632
967 Ga0495627_008906
968 Ga0495590_0124383
969 Ga0495591_023418
970 Ga0495638_0000881
971 Ga0495638_0032950
972 Ga0495638_0134946
973 Ga0495639_0170148
974 Ga0495584_0104222
975 Ga0495610_0003046
976 Ga0495610_0108996
977 Ga0495616_0037555
978 Ga0495628_0093103
979 Ga0495631_0001525
980 Ga0495632_0385726
981 Ga0495663_0110065
982 Ga0495640_0025999
983 Ga0495586_0010802
984 Ga0495609_0174390
985 Ga0495633_0026731
986 Ga0495633_0043387
987 Ga0495633_0113725
988 Ga0495656_0001001
989 Ga0495625_0058167
990 Ga0495625_0653762
991 Ga0495635_0082917
992 Ga0495647_0458191
993 Ga0495669_0101260
994 Ga0495670_0022391
995 Ga0495660_0026745
996 Ga0495604_0052433
997 Ga0495636_0048228
998 Ga0495672_0000090
999 Ga0495672_0068871
1000 Ga0495681_0101983
1001 Ga0495686_0016694
1002 Ga0495686_0104192
1003 Ga0496104_0425145
1004 Ga0496110_0224170
1005 Ga0496111_0981890
1006 Ga0496114_0000013
1007 Ga0496116_0021188
1008 Ga0496116_0119316
1009 Ga0496117_0000617
1010 Ga0496117_0003428
1011 Ga0496117_0008591
1012 Ga0496117_0057014
1013 Ga0496118_0000404
1014 Ga0496118_0000737
1015 Ga0496118_0044462
1016 Ga0496118_0049885
1017 Ga0496118_0079564
1018 Ga0496119_0000329
1019 Ga0496120_0000147
1020 Ga0496121_0002594
1021 Ga0496121_0074522
1022 Ga0496121_0135493
1023 Ga0496122_0420970
1024 Ga0496122_0452535
1025 Ga0496123_0113760
1026 Ga0496123_0361682
1027 Ga0496124_0000680
1028 Ga0496124_0006616
1029 Ga0496124_0117367
1030 Ga0496124_0216655
1031 Ga0496124_0250764
1032 Ga0496124_0847527
1033 Ga0496125_0026103
1034 Ga0496125_0026456
1035 Ga0496125_0085664
1036 Ga0496125_0120654
1037 Ga0496125_0199951
1038 Ga0496126_0000967
1039 Ga0496126_0011304
1040 Ga0501290_002699
1041 Ga0501031_0016530
1042 Ga0501032_0364104
1043 Ga0501033_0024972
1044 Ga0501034_0000552
1045 Ga0501034_0193975
1046 Ga0501036_0142199
1047 Ga0501037_0046698
1048 Ga0501038_0015316
1049 Ga0501039_0027266
1050 Ga0501040_0962210
1051 Ga0501043_0001713
1052 Ga0501043_0120368
1053 Ga0501047_0163739
1054 Ga0501067_0003235
1055 Ga0501068_0013166
1056 Ga0501070_0037650
1057 Ga0501071_0182798
1058 Ga0501072_0351258
1059 Ga0501075_0001709
1060 Ga0501076_0874263
1061 Ga0501076_0945664
1062 Ga0501077_0000027
1063 Ga0501202_070303
1064 Ga0501216_055228
1065 Ga0501227_244124
1066 Ga0501242_026322
1067 Ga0501243_031548
1068 Ga0501221_126955
1069 Ga0501225_0002344
1070 Ga0501225_0369284
1071 Ga0501079_0756017
1072 Ga0501080_0004080
1073 Ga0501080_0255110
1074 Ga0501081_0018085
1075 Ga0501263_082043
1076 Ga0501265_034996
1077 Ga0501275_000326
1078 Ga0501283_013123
1079 Ga0501035_0061152
1080 Ga0501044_0147113
1081 Ga0501045_0233189
1082 nmdc:mga00v17_107765_c1
1083 nmdc:mga0yw44_181472_c1
1084 nmdc:mga0k408_86383_c1
1085 nmdc:mga05p37_194609_c1
1086 nmdc:mga05p37_300249_c1
1087 nmdc:mga05p37_385218_c1
1088 nmdc:mga05p37_404497_c1
1089 nmdc:mga09592_359249_c1
1090 nmdc:mga09592_380982_c1
1091 nmdc:mga0qj67_153139_c1
1092 nmdc:mga0qj67_334250_c1
1093 nmdc:mga0qj67_828319_c1
1094 nmdc:mga06r32_1584980_c1
1095 nmdc:mga06r32_257641_c1
1096 nmdc:mga06r32_655568_c1
1097 nmdc:mga08y16_1433197_c1
1098 nmdc:mga08y16_15097_c1
1099 nmdc:mga08y16_885874_c1
1100 nmdc:mga0n895_212888_c1
1101 nmdc:mga08x19_186_c1
1102 nmdc:mga08x19_5414_c1
1103 nmdc:mga0a205_398937_c1
1104 Ga0495601_0262205
1105 Ga0501082_0001428
1106 Ga0501082_0768563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00381

PTS-HPr

PTS HPr component phosphorylation site

22

103

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lfg-assembly2.cif.gz_B crystal structure of hpr-c-his from thermoanaerobacter tengcongensis 0.9751 1 85
1sph-assembly1.cif.gz_B refined structures of the active s83c and impaired s46d hprs: evidence that phosphorylation does not require a backbone conformational transition 0.9695 2 80
7ff5-assembly3.cif.gz_C the crystal structure of ruminiclostridium cellulolyticum phosphocarrier 0.969 1 81
3ihs-assembly2.cif.gz_B crystal structure of a phosphocarrier protein hpr from bacillus anthracis str. ames 0.9617 2 81
3ccd-assembly1.cif.gz_A 1.0 a structure of post-succinimide his15asp hpr 0.9609 1 81
ID Description Score Start End Superfamily
af_P69811_287_371_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9665 4 81 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9619 2 85 3.30.1340.10
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9592 1 83 3.30.1340.10
3ihsB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9517 2 81 3.30.1340.10
af_P32670_5_87_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9288 4 81 3.30.1340.10
ID Description Score Start End GO Terms
AF-A0A0G3LRK3-F1-model_v4 deleted 1.006 1 89
AF-A0A3R8U1J6-F1-model_v4 HPr family phosphocarrier protein 1.004 1 89 GO:0005737
GO:0009401
AF-A0A2N1GEX0-F1-model_v4 deleted 1.004 1 89
AF-A0A522Y6K4-F1-model_v4 HPr family phosphocarrier protein 1.004 1 89 GO:0005737
GO:0009401
AF-A0A4R5U1G3-F1-model_v4 HPr family phosphocarrier protein 1.002 1 89 GO:0005737
GO:0009401

Map