F462887

General Info

Members Datasets Scaffolds Average Seq Length
553 200 1106 329

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0325648|Ga0395905_0325648_346_1254
Length 302
Sequence LGADSVRALALSAIEAGQSLRQRVEAQGFGAAVDLKAALAEGRVLPPVDHPDDAHVLVAGTGLTHLGSAEGRDKMHKDLADPAKMTDSMKMFRMGLEGGRPAPGREGVQPEWFYKGDGSTVIAPGAPLPSPSFALDAGEEPEIAGLYVNGPDGTPHRIGFALGNEFSDHVTERQNYLYLAHSKLRASAIGPELLVGDLPPDVRGTSRIIRGGEVVWEKPFLTGEANMSHTVANLEGHHFKYALFRRPGDVNIHYFGTATLSVSDGFKTLEGDIFEIAADAFGLPLSNPIGSVAAPWPVVKAL

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
26 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
39 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
41 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
42 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
45 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
67 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
77 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
78 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
83 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
90 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
91 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
97 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
113 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
121 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
149 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
150 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
151 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
171 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
172 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
173 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
174 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
175 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
179 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
180 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
182 2643221556 Massilia sp. Root1485 Isolate Unclassified
183 2643221638 Duganella sp. Root336D2 Isolate Unclassified
184 2643221684 Massilia sp. Root133 Isolate Unclassified
185 2738541297 Duganella sp. GV083 Isolate Unclassified
186 2738541357 Duganella sp. GV053 Isolate Unclassified
187 2738543003 Duganella sp. GV066 Isolate Unclassified
188 2738543026 Duganella sp. GV089 Isolate Unclassified
189 2738543029 Duganella sp. GV039 Isolate Unclassified
190 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
191 2821131069 Duganella sp. 1224 Isolate Unclassified
192 2842711865 Duganella sp. R-73148 Isolate Unclassified
193 2857553236 Duganella sp. R-74557 Isolate Unclassified
194 2857558681 Duganella sp. R-74565 Isolate Unclassified
195 2857564685 Duganella sp. R-74599 Isolate Unclassified
196 2904424332 Duganella sp. 1411 Isolate Rhizosphere
197 2919476304 Duganella sp. 3397 Isolate Unclassified
198 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
199 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
200 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.02
Metatranscriptomes 0.36
Isolates 3.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.84
Nodule 0.54
Rhizoplane 1.99
Rhizosphere 78.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0325648 3300037471 Bacteria 1427
2 JGI25158J39367_1003928 3300002739 Bacteria 2254
3 JGI25152J39213_1000026 3300002773 Bacteria 101759
4 JGI25150J39212_1000478 3300002774 Bacteria 16992
5 JGI25159J45721_1004244 3300002987 Bacteria 4823
6 JGI25159J45721_1009926 3300002987 Bacteria 2472
7 JGI25153J46596_10011364 3300003215 Bacteria 3939
8 JGI25161J50226_1000886 3300003374 Bacteria 10945
9 JGI25161J50226_1004983 3300003374 Bacteria 2678
10 Ga0007409J51694_1018609 3300003575 Bacteria 3124
11 Ga0055525_1000006 3300003759 Bacteria 642912
12 Ga0055529_1000032 3300003763 Bacteria 255895
13 Ga0055526_1000018 3300003771 Bacteria 198838
14 Ga0055526_1000445 3300003771 Bacteria 32889
15 Ga0055526_1001212 3300003771 Bacteria 18573
16 Ga0055526_1014640 3300003771 Bacteria 3208
17 Ga0055537_1000027 3300003773 Bacteria 102244
18 Ga0055537_1010865 3300003773 Bacteria 1888
19 Ga0055524_1000297 3300003775 Bacteria 47728
20 Ga0055524_1002730 3300003775 Bacteria 8915
21 Ga0055524_1002925 3300003775 Bacteria 8521
22 Ga0055524_1003992 3300003775 Bacteria 6961
23 Ga0055534_1000051 3300003784 Bacteria 92183
24 Ga0055534_1003639 3300003784 Bacteria 4779
25 Ga0055528_1000731 3300003790 Bacteria 23155
26 Ga0055530_10001347 3300003791 Bacteria 18338
27 Ga0055530_10038449 3300003791 Bacteria 1189
28 Ga0055531_10019181 3300003794 Bacteria 2782
29 Ga0055543_1000103 3300004625 Bacteria 73828
30 Ga0065165_1001082 3300005262 Bacteria 32470
31 Ga0065165_1001148 3300005262 Bacteria 30990
32 Ga0070661_100039302 3300005344 Bacteria 3448
33 Ga0070664_100051148 3300005564 Bacteria 3498
34 Ga0068856_100576147 3300005614 Bacteria 1147
35 Ga0068852_100257146 3300005616 Bacteria 1675
36 Ga0068865_100059923 3300006881 Bacteria 2664
37 Ga0079104_1011061 3300006946 Bacteria 2927
38 Ga0099826_10000001 3300006948 Bacteria 1155201
39 Ga0105244_10001201 3300009036 Bacteria 21301
40 Ga0105244_10003881 3300009036 Bacteria 10515
41 Ga0105245_10242721 3300009098 Bacteria 1747
42 Ga0105243_10011176 3300009148 Bacteria 6791
43 Ga0105241_10008838 3300009174 Bacteria 7405
44 Ga0105242_10043677 3300009176 Bacteria 3626
45 Ga0105239_10127305 3300010375 Bacteria 2831
46 Ga0157371_10000014 3300013102 Bacteria 347490
47 Ga0157378_10427726 3300013297 Bacteria 1310
48 Ga0182006_1000040 3300015261 Bacteria 209209
49 Ga0182005_1000051 3300015265 Bacteria 114808
50 Ga0213872_10000040 3300021361 Bacteria 122419
51 Ga0209436_101815 3300025208 Bacteria 6923
52 Ga0209436_103379 3300025208 Bacteria 4274
53 Ga0209563_100022 3300025230 Bacteria 643318
54 Ga0207425_1000017 3300025245 Bacteria 423851
55 Ga0207425_1000085 3300025245 Bacteria 95577
56 Ga0207425_1000326 3300025245 Bacteria 33697
57 Ga0207425_1000347 3300025245 Bacteria 32216
58 Ga0209646_1000051 3300025246 Bacteria 296525
59 Ga0209677_103912 3300025253 Bacteria 4549
60 Ga0209148_1000678 3300025254 Bacteria 28482
61 Ga0209129_1000162 3300025258 Bacteria 101248
62 Ga0209565_1000017 3300025263 Bacteria 462438
63 Ga0209565_1000452 3300025263 Bacteria 31667
64 Ga0209565_1006037 3300025263 Bacteria 3452
65 Ga0209455_1000043 3300025272 Bacteria 413928
66 Ga0209673_1000007 3300025273 Bacteria 634477
67 Ga0209130_1000078 3300025284 Bacteria 169374
68 Ga0209130_1000188 3300025284 Bacteria 86963
69 Ga0209675_1000009 3300025291 Bacteria 562872
70 Ga0209675_1005478 3300025291 Bacteria 5307
71 Ga0209675_1010389 3300025291 Bacteria 3183
72 Ga0209025_1001273 3300025294 Bacteria 34682
73 Ga0209564_1000011 3300025295 Bacteria 822327
74 Ga0209564_1000036 3300025295 Bacteria 423455
75 Ga0209564_1000055 3300025295 Bacteria 343782
76 Ga0209564_1000068 3300025295 Bacteria 311171
77 Ga0209564_1000343 3300025295 Bacteria 89036
78 Ga0209564_1002854 3300025295 Bacteria 12705
79 Ga0209564_1004142 3300025295 Bacteria 9092
80 Ga0209758_1000250 3300025297 Bacteria 109992
81 Ga0209758_1001409 3300025297 Bacteria 28501
82 Ga0209050_1000316 3300025298 Bacteria 98257
83 Ga0209050_1000612 3300025298 Bacteria 56207
84 Ga0209050_1001484 3300025298 Bacteria 24939
85 Ga0209256_1000167 3300025299 Bacteria 133419
86 Ga0209256_1000184 3300025299 Bacteria 121336
87 Ga0209256_1000841 3300025299 Bacteria 38507
88 Ga0209256_1003010 3300025299 Bacteria 12470
89 Ga0207426_1024022 3300025302 Bacteria 2073
90 Ga0209257_1000123 3300025304 Bacteria 219092
91 Ga0207655_1004932 3300025728 Bacteria 9259
92 Ga0207655_1008847 3300025728 Bacteria 6329
93 Ga0207705_10082021 3300025909 Bacteria 2351
94 Ga0207654_10007226 3300025911 Bacteria 5595
95 Ga0207657_10221869 3300025919 Bacteria 1514
96 Ga0207690_10121924 3300025932 Bacteria 1895
97 Ga0207706_10036350 3300025933 Bacteria 4374
98 Ga0207709_10015451 3300025935 Bacteria 4233
99 Ga0207678_10041031 3300026067 Bacteria 4012
100 Ga0207698_10151323 3300026142 Bacteria 2014
101 Ga0209282_1000001 3300027666 Bacteria 2450367
102 Ga0316181_1078105 3300030744 Bacteria 2866
103 Ga0307408_100000092 3300031548 Bacteria 98953
104 Ga0307408_100001578 3300031548 Bacteria 16829
105 Ga0307408_100003582 3300031548 Bacteria 10582
106 Ga0307408_100005970 3300031548 Bacteria 8110
107 Ga0307408_100009216 3300031548 Bacteria 6508
108 Ga0307518_10094823 3300031838 Bacteria 2143
109 Ga0395899_0000293 3300037312 Bacteria 64438
110 Ga0395899_0090053 3300037312 Bacteria 2224
111 Ga0395900_0000202 3300037418 Bacteria 93773
112 Ga0395900_0028193 3300037418 Bacteria 5751
113 Ga0395900_0217451 3300037418 Bacteria 1927
114 Ga0395900_0297742 3300037418 Bacteria 1600
115 Ga0395898_0029352 3300037466 Bacteria 5510
116 Ga0395898_0227117 3300037466 Bacteria 1780
117 Ga0395898_0227397 3300037466 Bacteria 1779
118 Ga0395905_0222002 3300037471 Bacteria 1768
119 Ga0395901_0000019 3300038443 Bacteria 317063
120 Ga0395901_0150596 3300038443 Bacteria 2444
121 Ga0395901_0258533 3300038443 Bacteria 1813
122 Ga0395901_0369125 3300038443 Bacteria 1478
123 Ga0436360_1167795 3300039438 Bacteria 1521
124 Ga0436360_1230647 3300039438 Bacteria 2999
125 Ga0436361_0748526 3300039447 Bacteria 34472
126 Ga0436361_1063317 3300039447 Bacteria 2281
127 Ga0439465_0071441 3300041413 Bacteria 1164
128 Ga0439448_0015869 3300042005 Bacteria 2286
129 Ga0466972_0000072 3300044658 Bacteria 98587
130 Ga0466972_0005351 3300044658 Bacteria 6429
131 Ga0466965_0046623 3300044683 Bacteria 2145
132 Ga0466965_0051607 3300044683 Bacteria 2040
133 Ga0466966_0045728 3300044684 Bacteria 2797
134 Ga0466966_0049500 3300044684 Bacteria 2677
135 Ga0466966_0096352 3300044684 Bacteria 1832
136 Ga0466966_0155619 3300044684 Bacteria 1392
137 Ga0466963_0075452 3300044694 Bacteria 2275
138 Ga0466964_0007753 3300044706 Bacteria 4017
139 Ga0466964_0030463 3300044706 Bacteria 2135
140 Ga0466964_0060121 3300044706 Bacteria 1579
141 Ga0466964_0088628 3300044706 Bacteria 1342
142 Ga0466968_0000207 3300044735 Bacteria 18092
143 Ga0466968_0007718 3300044735 Bacteria 4097
144 Ga0466957_0014693 3300044842 Bacteria 4561
145 Ga0466957_0036871 3300044842 Bacteria 2941
146 Ga0466957_0099124 3300044842 Bacteria 1834
147 Ga0466960_0070500 3300044901 Bacteria 1739
148 Ga0466959_0039802 3300045049 Bacteria 3474
149 Ga0466958_0023150 3300045836 Bacteria 3643
150 Ga0466967_0028983 3300045976 Bacteria 4628
151 Ga0495617_000003 3300046452 Bacteria 541914
152 Ga0495617_000208 3300046452 Bacteria 36937
153 Ga0495617_008747 3300046452 Bacteria 3485
154 Ga0495627_000008 3300046453 Bacteria 572150
155 Ga0495590_0000001 3300046457 Bacteria 762984
156 Ga0495590_0001769 3300046457 Bacteria 9174
157 Ga0495590_0020432 3300046457 Bacteria 2353
158 Ga0495590_0080098 3300046457 Bacteria 1150
159 Ga0495638_0000017 3300046460 Bacteria 391117
160 Ga0495638_0005173 3300046460 Bacteria 9756
161 Ga0495638_0017751 3300046460 Bacteria 4738
162 Ga0495638_0020287 3300046460 Bacteria 4391
163 Ga0495638_0021299 3300046460 Bacteria 4274
164 Ga0495638_0023355 3300046460 Bacteria 4045
165 Ga0495638_0101706 3300046460 Bacteria 1718
166 Ga0495653_0000002 3300046463 Bacteria 507262
167 Ga0495653_0019967 3300046463 Bacteria 5431
168 Ga0495653_0042554 3300046463 Bacteria 3536
169 Ga0495650_0000001 3300046471 Bacteria 1085492
170 Ga0495650_0000072 3300046471 Bacteria 257886
171 Ga0495650_0000267 3300046471 Bacteria 100234
172 Ga0495650_0000344 3300046471 Bacteria 83050
173 Ga0495650_0000427 3300046471 Bacteria 68283
174 Ga0495650_0001400 3300046471 Bacteria 23592
175 Ga0495650_0012501 3300046471 Bacteria 4563
176 Ga0495582_0046530 3300046473 Bacteria 2389
177 Ga0495605_0000065 3300046474 Bacteria 139441
178 Ga0495605_0000103 3300046474 Bacteria 105879
179 Ga0495605_0002266 3300046474 Bacteria 12011
180 Ga0495605_0006806 3300046474 Bacteria 6530
181 Ga0495605_0027182 3300046474 Bacteria 2966
182 Ga0495605_0033785 3300046474 Bacteria 2594
183 Ga0495605_0041364 3300046474 Bacteria 2296
184 Ga0495605_0061233 3300046474 Bacteria 1802
185 Ga0495605_0070653 3300046474 Bacteria 1650
186 Ga0495584_0000009 3300046491 Bacteria 236318
187 Ga0495584_0000057 3300046491 Bacteria 81182
188 Ga0495584_0000182 3300046491 Bacteria 44393
189 Ga0495584_0000904 3300046491 Bacteria 18948
190 Ga0495584_0001765 3300046491 Bacteria 12597
191 Ga0495584_0002700 3300046491 Bacteria 9971
192 Ga0495584_0004270 3300046491 Bacteria 7702
193 Ga0495584_0008823 3300046491 Bacteria 5212
194 Ga0495584_0015054 3300046491 Bacteria 3942
195 Ga0495584_0028660 3300046491 Bacteria 2822
196 Ga0495585_0000077 3300046492 Bacteria 100338
197 Ga0495585_0000094 3300046492 Bacteria 94735
198 Ga0495585_0000154 3300046492 Bacteria 73681
199 Ga0495585_0000940 3300046492 Bacteria 24573
200 Ga0495585_0001952 3300046492 Bacteria 15409
201 Ga0495585_0002583 3300046492 Bacteria 12807
202 Ga0495585_0007860 3300046492 Bacteria 6488
203 Ga0495585_0024507 3300046492 Bacteria 3459
204 Ga0495585_0057018 3300046492 Bacteria 2156
205 Ga0495585_0082081 3300046492 Bacteria 1745
206 Ga0495596_0000961 3300046500 Bacteria 17168
207 Ga0495596_0009123 3300046500 Bacteria 4379
208 Ga0495596_0012041 3300046500 Bacteria 3712
209 Ga0495596_0037712 3300046500 Bacteria 1910
210 Ga0495596_0038677 3300046500 Bacteria 1885
211 Ga0495596_0062218 3300046500 Bacteria 1453
212 Ga0495607_0002416 3300046501 Bacteria 15240
213 Ga0495607_0002798 3300046501 Bacteria 13876
214 Ga0495607_0010564 3300046501 Bacteria 6199
215 Ga0495607_0011987 3300046501 Bacteria 5738
216 Ga0495607_0012148 3300046501 Bacteria 5693
217 Ga0495607_0028843 3300046501 Bacteria 3418
218 Ga0495607_0038103 3300046501 Bacteria 2882
219 Ga0495607_0054462 3300046501 Bacteria 2305
220 Ga0495607_0060614 3300046501 Bacteria 2153
221 Ga0495607_0065407 3300046501 Bacteria 2050
222 Ga0495607_0087401 3300046501 Bacteria 1696
223 Ga0495583_0000008 3300046506 Bacteria 411092
224 Ga0495583_0000050 3300046506 Bacteria 213627
225 Ga0495583_0000064 3300046506 Bacteria 192380
226 Ga0495583_0000067 3300046506 Bacteria 189381
227 Ga0495583_0000250 3300046506 Bacteria 88815
228 Ga0495583_0000253 3300046506 Bacteria 88398
229 Ga0495583_0000485 3300046506 Bacteria 58196
230 Ga0495583_0002249 3300046506 Bacteria 16985
231 Ga0495583_0019755 3300046506 Bacteria 3508
232 Ga0495583_0025861 3300046506 Bacteria 2923
233 Ga0495583_0030893 3300046506 Bacteria 2603
234 Ga0495583_0048389 3300046506 Bacteria 1951
235 Ga0495583_0091100 3300046506 Bacteria 1312
236 Ga0495606_0000001 3300046507 Bacteria 592123
237 Ga0495606_0000030 3300046507 Bacteria 249484
238 Ga0495606_0000282 3300046507 Bacteria 88450
239 Ga0495606_0018842 3300046507 Bacteria 5161
240 Ga0495606_0030636 3300046507 Bacteria 3755
241 Ga0495606_0035060 3300046507 Bacteria 3435
242 Ga0495606_0045077 3300046507 Bacteria 2926
243 Ga0495606_0050770 3300046507 Bacteria 2710
244 Ga0495606_0057289 3300046507 Bacteria 2510
245 Ga0495606_0057510 3300046507 Bacteria 2504
246 Ga0495606_0093851 3300046507 Bacteria 1840
247 Ga0495606_0133882 3300046507 Bacteria 1470
248 Ga0495610_0000003 3300046512 Bacteria 1203910
249 Ga0495610_0001826 3300046512 Bacteria 18503
250 Ga0495610_0005555 3300046512 Bacteria 8922
251 Ga0495610_0011630 3300046512 Bacteria 5363
252 Ga0495610_0020310 3300046512 Bacteria 3690
253 Ga0495610_0112087 3300046512 Bacteria 1207
254 Ga0495616_0000924 3300046513 Bacteria 21120
255 Ga0495616_0001100 3300046513 Bacteria 19247
256 Ga0495616_0002444 3300046513 Bacteria 12326
257 Ga0495616_0005518 3300046513 Bacteria 7773
258 Ga0495616_0011725 3300046513 Bacteria 5009
259 Ga0495616_0012575 3300046513 Bacteria 4798
260 Ga0495616_0013364 3300046513 Bacteria 4632
261 Ga0495616_0021407 3300046513 Bacteria 3502
262 Ga0495616_0040240 3300046513 Bacteria 2389
263 Ga0495616_0053341 3300046513 Bacteria 2009
264 Ga0495616_0092110 3300046513 Bacteria 1433
265 Ga0495620_0019918 3300046515 Bacteria 3286
266 Ga0495631_0000214 3300046518 Bacteria 39867
267 Ga0495631_0012700 3300046518 Bacteria 4105
268 Ga0495631_0019176 3300046518 Bacteria 3210
269 Ga0495631_0051537 3300046518 Bacteria 1798
270 Ga0495631_0057036 3300046518 Bacteria 1700
271 Ga0495631_0062284 3300046518 Bacteria 1616
272 Ga0495632_0000151 3300046519 Bacteria 71855
273 Ga0495632_0003007 3300046519 Bacteria 12305
274 Ga0495632_0026713 3300046519 Bacteria 3034
275 Ga0495632_0051765 3300046519 Bacteria 2020
276 Ga0495632_0058582 3300046519 Bacteria 1876
277 Ga0495637_0000042 3300046520 Bacteria 114979
278 Ga0495643_0000028 3300046522 Bacteria 262886
279 Ga0495643_0000285 3300046522 Bacteria 72233
280 Ga0495643_0002751 3300046522 Bacteria 13492
281 Ga0495643_0015685 3300046522 Bacteria 4469
282 Ga0495643_0015776 3300046522 Bacteria 4456
283 Ga0495643_0052974 3300046522 Bacteria 2177
284 Ga0495644_0002436 3300046523 Bacteria 7425
285 Ga0495644_0002963 3300046523 Bacteria 6734
286 Ga0495644_0004943 3300046523 Bacteria 5233
287 Ga0495644_0010462 3300046523 Bacteria 3576
288 Ga0495644_0018077 3300046523 Bacteria 2692
289 Ga0495648_0000001 3300046524 Bacteria 696872
290 Ga0495648_0000079 3300046524 Bacteria 126099
291 Ga0495648_0001359 3300046524 Bacteria 24164
292 Ga0495648_0002750 3300046524 Bacteria 15879
293 Ga0495648_0003215 3300046524 Bacteria 14496
294 Ga0495648_0014566 3300046524 Bacteria 5748
295 Ga0495648_0014982 3300046524 Bacteria 5647
296 Ga0495648_0022727 3300046524 Bacteria 4309
297 Ga0495648_0028372 3300046524 Bacteria 3729
298 Ga0495648_0042340 3300046524 Bacteria 2866
299 Ga0495648_0055139 3300046524 Bacteria 2397
300 Ga0495663_0006483 3300046525 Bacteria 3231
301 Ga0495666_0011013 3300046526 Bacteria 4511
302 Ga0495642_0003301 3300046528 Bacteria 6376
303 Ga0495642_0005123 3300046528 Bacteria 5044
304 Ga0495642_0005946 3300046528 Bacteria 4682
305 Ga0495642_0023913 3300046528 Bacteria 2415
306 Ga0495642_0037924 3300046528 Bacteria 1951
307 Ga0495642_0088514 3300046528 Bacteria 1309
308 Ga0495652_0028471 3300046529 Bacteria 4915
309 Ga0495654_0000037 3300046530 Bacteria 188218
310 Ga0495654_0040533 3300046530 Bacteria 2320
311 Ga0495654_0060273 3300046530 Bacteria 1824
312 Ga0495665_0024664 3300046531 Bacteria 3230
313 Ga0495665_0044440 3300046531 Bacteria 2360
314 Ga0495587_0121870 3300046536 Bacteria 1493
315 Ga0495609_0000026 3300046538 Bacteria 251973
316 Ga0495609_0000241 3300046538 Bacteria 52185
317 Ga0495609_0001046 3300046538 Bacteria 19408
318 Ga0495609_0001294 3300046538 Bacteria 17071
319 Ga0495609_0001330 3300046538 Bacteria 16776
320 Ga0495609_0001851 3300046538 Bacteria 13510
321 Ga0495609_0007727 3300046538 Bacteria 5329
322 Ga0495609_0018057 3300046538 Bacteria 3272
323 Ga0495609_0036406 3300046538 Bacteria 2222
324 Ga0495609_0041751 3300046538 Bacteria 2060
325 Ga0495609_0062144 3300046538 Bacteria 1649
326 Ga0495597_0000056 3300046542 Bacteria 95149
327 Ga0495597_0000705 3300046542 Bacteria 26750
328 Ga0495597_0000864 3300046542 Bacteria 23742
329 Ga0495597_0001532 3300046542 Bacteria 16422
330 Ga0495597_0006593 3300046542 Bacteria 5987
331 Ga0495597_0006628 3300046542 Bacteria 5968
332 Ga0495597_0007484 3300046542 Bacteria 5539
333 Ga0495597_0016163 3300046542 Bacteria 3528
334 Ga0495597_0046928 3300046542 Bacteria 1913
335 Ga0495622_0000131 3300046557 Bacteria 64280
336 Ga0495633_0000055 3300046558 Bacteria 151013
337 Ga0495633_0000106 3300046558 Bacteria 113381
338 Ga0495633_0001613 3300046558 Bacteria 17048
339 Ga0495633_0003359 3300046558 Bacteria 10734
340 Ga0495633_0017106 3300046558 Bacteria 3717
341 Ga0495633_0029947 3300046558 Bacteria 2646
342 Ga0495633_0095094 3300046558 Bacteria 1384
343 Ga0495656_0005067 3300046615 Bacteria 4542
344 Ga0495656_0040201 3300046615 Bacteria 1948
345 Ga0495656_0042855 3300046615 Bacteria 1897
346 Ga0495656_0074243 3300046615 Bacteria 1518
347 Ga0495656_0078987 3300046615 Bacteria 1480
348 Ga0495668_0000018 3300046616 Bacteria 417480
349 Ga0495668_0000190 3300046616 Bacteria 91473
350 Ga0495668_0001065 3300046616 Bacteria 29015
351 Ga0495668_0001873 3300046616 Bacteria 18839
352 Ga0495668_0002041 3300046616 Bacteria 17578
353 Ga0495668_0002146 3300046616 Bacteria 16984
354 Ga0495668_0006520 3300046616 Bacteria 7632
355 Ga0495668_0035836 3300046616 Bacteria 2780
356 Ga0495668_0041656 3300046616 Bacteria 2557
357 Ga0495668_0193873 3300046616 Bacteria 1113
358 Ga0495634_0071936 3300046642 Bacteria 2275
359 Ga0495611_0000151 3300046648 Bacteria 49625
360 Ga0495611_0002359 3300046648 Bacteria 8694
361 Ga0495611_0011731 3300046648 Bacteria 3717
362 Ga0495625_0000035 3300046660 Bacteria 224323
363 Ga0495625_0000391 3300046660 Bacteria 66888
364 Ga0495625_0002897 3300046660 Bacteria 17926
365 Ga0495625_0004167 3300046660 Bacteria 13781
366 Ga0495625_0007248 3300046660 Bacteria 9703
367 Ga0495625_0007938 3300046660 Bacteria 9122
368 Ga0495625_0020170 3300046660 Bacteria 5151
369 Ga0495625_0091623 3300046660 Bacteria 2101
370 Ga0495661_0000152 3300046665 Bacteria 81192
371 Ga0495661_0000715 3300046665 Bacteria 32660
372 Ga0495661_0008169 3300046665 Bacteria 7257
373 Ga0495661_0039547 3300046665 Bacteria 2930
374 Ga0495661_0040312 3300046665 Bacteria 2897
375 Ga0495661_0041699 3300046665 Bacteria 2837
376 Ga0495661_0051554 3300046665 Bacteria 2484
377 Ga0495661_0186036 3300046665 Bacteria 1097
378 Ga0495588_0000139 3300046674 Bacteria 109955
379 Ga0495599_0193189 3300046678 Bacteria 1252
380 Ga0495623_0039508 3300046679 Bacteria 3015
381 Ga0495623_0093049 3300046679 Bacteria 1846
382 Ga0495646_0050462 3300046680 Bacteria 2522
383 Ga0495669_0008861 3300046684 Bacteria 4239
384 Ga0495669_0024761 3300046684 Bacteria 2614
385 Ga0495669_0034607 3300046684 Bacteria 2227
386 Ga0495669_0059457 3300046684 Bacteria 1726
387 Ga0495670_0000513 3300046691 Bacteria 18250
388 Ga0495670_0031688 3300046691 Bacteria 2627
389 Ga0495670_0054252 3300046691 Bacteria 2007
390 Ga0495670_0062515 3300046691 Bacteria 1873
391 Ga0495670_0088109 3300046691 Bacteria 1586
392 Ga0495671_0000010 3300046692 Bacteria 368641
393 Ga0495671_0003853 3300046692 Bacteria 9116
394 Ga0495671_0004731 3300046692 Bacteria 8044
395 Ga0495671_0020732 3300046692 Bacteria 3461
396 Ga0495671_0037809 3300046692 Bacteria 2440
397 Ga0495649_0011975 3300046694 Bacteria 5066
398 Ga0495649_0015437 3300046694 Bacteria 4347
399 Ga0495649_0016169 3300046694 Bacteria 4233
400 Ga0495589_0000045 3300046794 Bacteria 123922
401 Ga0495589_0000100 3300046794 Bacteria 83307
402 Ga0495589_0000101 3300046794 Bacteria 82583
403 Ga0495589_0014427 3300046794 Bacteria 4069
404 Ga0495589_0023533 3300046794 Bacteria 3138
405 Ga0495589_0029595 3300046794 Bacteria 2761
406 Ga0495660_0000027 3300046810 Bacteria 254331
407 Ga0495660_0000335 3300046810 Bacteria 41632
408 Ga0495660_0000555 3300046810 Bacteria 30632
409 Ga0495660_0007649 3300046810 Bacteria 6346
410 Ga0495660_0015261 3300046810 Bacteria 4438
411 Ga0495660_0015437 3300046810 Bacteria 4412
412 Ga0495660_0020381 3300046810 Bacteria 3800
413 Ga0495660_0021709 3300046810 Bacteria 3672
414 Ga0495660_0031740 3300046810 Bacteria 2969
415 Ga0495660_0054308 3300046810 Bacteria 2170
416 Ga0495660_0097256 3300046810 Bacteria 1520
417 Ga0495581_0092627 3300047315 Bacteria 1754
418 Ga0495604_0060169 3300047317 Bacteria 2909
419 Ga0495636_0000169 3300047318 Bacteria 26280
420 Ga0495636_0042664 3300047318 Bacteria 1885
421 Ga0495672_0000127 3300047320 Bacteria 117475
422 Ga0495672_0002015 3300047320 Bacteria 19155
423 Ga0495672_0002441 3300047320 Bacteria 17100
424 Ga0495672_0002622 3300047320 Bacteria 16258
425 Ga0495672_0020028 3300047320 Bacteria 4395
426 Ga0495672_0043110 3300047320 Bacteria 2715
427 Ga0495676_0083159 3300047321 Bacteria 2420
428 Ga0495683_0000064 3300047323 Bacteria 112558
429 Ga0495683_0000498 3300047323 Bacteria 30337
430 Ga0495683_0015275 3300047323 Bacteria 3997
431 Ga0495683_0034198 3300047323 Bacteria 2585
432 Ga0495683_0036509 3300047323 Bacteria 2493
433 Ga0495683_0041784 3300047323 Bacteria 2313
434 Ga0495683_0044945 3300047323 Bacteria 2220
435 Ga0495687_000037 3300047443 Bacteria 252363
436 Ga0495687_000062 3300047443 Bacteria 176135
437 Ga0495687_000122 3300047443 Bacteria 119372
438 Ga0495687_001241 3300047443 Bacteria 24342
439 Ga0495687_001859 3300047443 Bacteria 18393
440 Ga0495687_002590 3300047443 Bacteria 14240
441 Ga0495687_011036 3300047443 Bacteria 4891
442 Ga0495687_076340 3300047443 Bacteria 1326
443 Ga0495675_0017159 3300047444 Bacteria 4584
444 Ga0495675_0062981 3300047444 Bacteria 2347
445 Ga0495677_0000014 3300047445 Bacteria 136236
446 Ga0495677_0002033 3300047445 Bacteria 8070
447 Ga0495677_0002363 3300047445 Bacteria 7413
448 Ga0495677_0006994 3300047445 Bacteria 4229
449 Ga0495677_0019243 3300047445 Bacteria 2476
450 Ga0495677_0033972 3300047445 Bacteria 1860
451 Ga0495679_000603 3300047446 Bacteria 24373
452 Ga0495679_006022 3300047446 Bacteria 5298
453 Ga0495679_006467 3300047446 Bacteria 5038
454 Ga0495679_041789 3300047446 Bacteria 1417
455 Ga0495685_000011 3300047447 Bacteria 83484
456 Ga0495685_000262 3300047447 Bacteria 18174
457 Ga0495685_001458 3300047447 Bacteria 7246
458 Ga0495685_014337 3300047447 Bacteria 2692
459 Ga0495673_0000003 3300047469 Bacteria 1491337
460 Ga0495673_0000016 3300047469 Bacteria 580643
461 Ga0495673_0004771 3300047469 Bacteria 8395
462 Ga0495673_0006851 3300047469 Bacteria 6644
463 Ga0495681_0000021 3300047470 Bacteria 166534
464 Ga0495681_0012652 3300047470 Bacteria 4944
465 Ga0495681_0029160 3300047470 Bacteria 2828
466 Ga0495681_0043803 3300047470 Bacteria 2155
467 Ga0495681_0050544 3300047470 Bacteria 1959
468 Ga0495681_0066072 3300047470 Bacteria 1651
469 Ga0495681_0067202 3300047470 Bacteria 1634
470 Ga0495686_0000047 3300047472 Bacteria 280086
471 Ga0495686_0022915 3300047472 Bacteria 4126
472 Ga0495686_0087568 3300047472 Bacteria 1894
473 Ga0495686_0195479 3300047472 Bacteria 1163
474 Ga0495602_0030671 3300048088 Bacteria 5096
475 Ga0495626_0000222 3300048091 Bacteria 67304
476 Ga0495626_0001089 3300048091 Bacteria 23065
477 Ga0495626_0004011 3300048091 Bacteria 9188
478 Ga0495626_0004015 3300048091 Bacteria 9180
479 Ga0495626_0007268 3300048091 Bacteria 6178
480 Ga0495626_0011693 3300048091 Bacteria 4631
481 Ga0495626_0015368 3300048091 Bacteria 3922
482 Ga0495626_0017751 3300048091 Bacteria 3587
483 Ga0495626_0035868 3300048091 Bacteria 2366
484 Ga0495626_0046256 3300048091 Bacteria 2028
485 Ga0496102_0518472 3300048905 Bacteria 1114
486 Ga0496105_0334932 3300048908 Bacteria 1211
487 Ga0496106_0058992 3300048909 Bacteria 2906
488 Ga0496106_0319677 3300048909 Bacteria 1246
489 Ga0496110_0000026 3300048913 Bacteria 71385
490 Ga0496110_0212265 3300048913 Bacteria 1760
491 Ga0496111_0033724 3300048914 Bacteria 3653
492 Ga0496113_0063902 3300048916 Bacteria 2782
493 Ga0496113_0234278 3300048916 Bacteria 1464
494 Ga0496114_0022834 3300048917 Bacteria 5099
495 Ga0496115_0120610 3300048918 Bacteria 2158
496 Ga0496116_0089325 3300048919 Bacteria 1880
497 Ga0496116_0149534 3300048919 Bacteria 1300
498 Ga0496119_0167686 3300048922 Bacteria 1162
499 Ga0496121_0009608 3300048924 Bacteria 11081
500 Ga0496121_0226897 3300048924 Bacteria 1311
501 Ga0496122_0037249 3300048925 Bacteria 3918
502 Ga0496122_0044295 3300048925 Bacteria 3474
503 Ga0496122_0093488 3300048925 Bacteria 2039
504 Ga0496123_0003516 3300048926 Bacteria 17450
505 Ga0496123_0005149 3300048926 Bacteria 13318
506 Ga0496124_0005355 3300048927 Bacteria 14485
507 Ga0496124_0019908 3300048927 Bacteria 6223
508 Ga0496124_0063664 3300048927 Bacteria 3080
509 Ga0496124_0072048 3300048927 Bacteria 2862
510 Ga0496124_0121706 3300048927 Bacteria 2084
511 Ga0496124_0136485 3300048927 Bacteria 1941
512 Ga0496124_0137183 3300048927 Bacteria 1935
513 Ga0496126_0004427 3300048929 Bacteria 16812
514 Ga0495678_000002 3300049459 Bacteria 999613
515 Ga0495678_000029 3300049459 Bacteria 219803
516 Ga0495678_000045 3300049459 Bacteria 171880
517 Ga0495678_004461 3300049459 Bacteria 8085
518 Ga0495678_005099 3300049459 Bacteria 7379
519 Ga0495678_006315 3300049459 Bacteria 6323
520 Ga0495678_014701 3300049459 Bacteria 3629
521 Ga0495682_0000062 3300049460 Bacteria 100699
522 Ga0495682_0000082 3300049460 Bacteria 83453
523 Ga0495682_0000490 3300049460 Bacteria 27359
524 Ga0495682_0002339 3300049460 Bacteria 9010
525 Ga0501249_002364 3300049679 Bacteria 3809
526 Ga0501234_008639 3300049707 Bacteria 1587
527 Ga0501269_001065 3300049766 Bacteria 3839
528 Ga0501279_003371 3300049775 Bacteria 2084
529 Ga0501035_0003225 3300049822 Bacteria 15630
530 nmdc:mga03683_33274_c1 3300050489 Bacteria 2078
531 Ga0500618_000068 3300053125 Bacteria 88668
532 Ga0500586_005470 3300053145 Bacteria 3216
533 Ga0587068_005599 3300059641 Bacteria 1722
534 2643789483 2643221554 Bacteria 6603920
535 2643801496 2643221556 Bacteria 7251154
536 2644216060 2643221638 Bacteria 6579467
537 2644471442 2643221684 Bacteria 7145183
538 2738829887 2738541297 Bacteria 6549566
539 2739153683 2738541357 Bacteria 6549408
540 2739195603 2738543003 Bacteria 6549560
541 2739322079 2738543026 Bacteria 6549408
542 2739340320 2738543029 Bacteria 6549249
543 2809142135 2808606418 Bacteria 6724496
544 2821131834 2821131069 Bacteria 6108407
545 2842715521 2842711865 Bacteria 7155354
546 2857555918 2857553236 Bacteria 6166726
547 2857559135 2857558681 Bacteria 6617694
548 2857566934 2857564685 Bacteria 6290584
549 2904425717 2904424332 Bacteria 7633521
550 2919478251 2919476304 Bacteria 5888696
551 2932415453 2932410948 Bacteria 6312192
552 2932421386 2932416698 Bacteria 6315112
553 8047677200 8047673197 Bacteria 7395230
554 Ga0395905_0325648
555 JGI25158J39367_1003928
556 JGI25152J39213_1000026
557 JGI25150J39212_1000478
558 JGI25159J45721_1004244
559 JGI25159J45721_1009926
560 JGI25153J46596_10011364
561 JGI25161J50226_1000886
562 JGI25161J50226_1004983
563 Ga0007409J51694_1018609
564 Ga0055525_1000006
565 Ga0055529_1000032
566 Ga0055526_1000018
567 Ga0055526_1000445
568 Ga0055526_1001212
569 Ga0055526_1014640
570 Ga0055537_1000027
571 Ga0055537_1010865
572 Ga0055524_1000297
573 Ga0055524_1002730
574 Ga0055524_1002925
575 Ga0055524_1003992
576 Ga0055534_1000051
577 Ga0055534_1003639
578 Ga0055528_1000731
579 Ga0055530_10001347
580 Ga0055530_10038449
581 Ga0055531_10019181
582 Ga0055543_1000103
583 Ga0065165_1001082
584 Ga0065165_1001148
585 Ga0070661_100039302
586 Ga0070664_100051148
587 Ga0068856_100576147
588 Ga0068852_100257146
589 Ga0068865_100059923
590 Ga0079104_1011061
591 Ga0099826_10000001
592 Ga0105244_10001201
593 Ga0105244_10003881
594 Ga0105245_10242721
595 Ga0105243_10011176
596 Ga0105241_10008838
597 Ga0105242_10043677
598 Ga0105239_10127305
599 Ga0157371_10000014
600 Ga0157378_10427726
601 Ga0182006_1000040
602 Ga0182005_1000051
603 Ga0213872_10000040
604 Ga0209436_101815
605 Ga0209436_103379
606 Ga0209563_100022
607 Ga0207425_1000017
608 Ga0207425_1000085
609 Ga0207425_1000326
610 Ga0207425_1000347
611 Ga0209646_1000051
612 Ga0209677_103912
613 Ga0209148_1000678
614 Ga0209129_1000162
615 Ga0209565_1000017
616 Ga0209565_1000452
617 Ga0209565_1006037
618 Ga0209455_1000043
619 Ga0209673_1000007
620 Ga0209130_1000078
621 Ga0209130_1000188
622 Ga0209675_1000009
623 Ga0209675_1005478
624 Ga0209675_1010389
625 Ga0209025_1001273
626 Ga0209564_1000011
627 Ga0209564_1000036
628 Ga0209564_1000055
629 Ga0209564_1000068
630 Ga0209564_1000343
631 Ga0209564_1002854
632 Ga0209564_1004142
633 Ga0209758_1000250
634 Ga0209758_1001409
635 Ga0209050_1000316
636 Ga0209050_1000612
637 Ga0209050_1001484
638 Ga0209256_1000167
639 Ga0209256_1000184
640 Ga0209256_1000841
641 Ga0209256_1003010
642 Ga0207426_1024022
643 Ga0209257_1000123
644 Ga0207655_1004932
645 Ga0207655_1008847
646 Ga0207705_10082021
647 Ga0207654_10007226
648 Ga0207657_10221869
649 Ga0207690_10121924
650 Ga0207706_10036350
651 Ga0207709_10015451
652 Ga0207678_10041031
653 Ga0207698_10151323
654 Ga0209282_1000001
655 Ga0316181_1078105
656 Ga0307408_100000092
657 Ga0307408_100001578
658 Ga0307408_100003582
659 Ga0307408_100005970
660 Ga0307408_100009216
661 Ga0307518_10094823
662 Ga0395899_0000293
663 Ga0395899_0090053
664 Ga0395900_0000202
665 Ga0395900_0028193
666 Ga0395900_0217451
667 Ga0395900_0297742
668 Ga0395898_0029352
669 Ga0395898_0227117
670 Ga0395898_0227397
671 Ga0395905_0222002
672 Ga0395901_0000019
673 Ga0395901_0150596
674 Ga0395901_0258533
675 Ga0395901_0369125
676 Ga0436360_1167795
677 Ga0436360_1230647
678 Ga0436361_0748526
679 Ga0436361_1063317
680 Ga0439465_0071441
681 Ga0439448_0015869
682 Ga0466972_0000072
683 Ga0466972_0005351
684 Ga0466965_0046623
685 Ga0466965_0051607
686 Ga0466966_0045728
687 Ga0466966_0049500
688 Ga0466966_0096352
689 Ga0466966_0155619
690 Ga0466963_0075452
691 Ga0466964_0007753
692 Ga0466964_0030463
693 Ga0466964_0060121
694 Ga0466964_0088628
695 Ga0466968_0000207
696 Ga0466968_0007718
697 Ga0466957_0014693
698 Ga0466957_0036871
699 Ga0466957_0099124
700 Ga0466960_0070500
701 Ga0466959_0039802
702 Ga0466958_0023150
703 Ga0466967_0028983
704 Ga0495617_000003
705 Ga0495617_000208
706 Ga0495617_008747
707 Ga0495627_000008
708 Ga0495590_0000001
709 Ga0495590_0001769
710 Ga0495590_0020432
711 Ga0495590_0080098
712 Ga0495638_0000017
713 Ga0495638_0005173
714 Ga0495638_0017751
715 Ga0495638_0020287
716 Ga0495638_0021299
717 Ga0495638_0023355
718 Ga0495638_0101706
719 Ga0495653_0000002
720 Ga0495653_0019967
721 Ga0495653_0042554
722 Ga0495650_0000001
723 Ga0495650_0000072
724 Ga0495650_0000267
725 Ga0495650_0000344
726 Ga0495650_0000427
727 Ga0495650_0001400
728 Ga0495650_0012501
729 Ga0495582_0046530
730 Ga0495605_0000065
731 Ga0495605_0000103
732 Ga0495605_0002266
733 Ga0495605_0006806
734 Ga0495605_0027182
735 Ga0495605_0033785
736 Ga0495605_0041364
737 Ga0495605_0061233
738 Ga0495605_0070653
739 Ga0495584_0000009
740 Ga0495584_0000057
741 Ga0495584_0000182
742 Ga0495584_0000904
743 Ga0495584_0001765
744 Ga0495584_0002700
745 Ga0495584_0004270
746 Ga0495584_0008823
747 Ga0495584_0015054
748 Ga0495584_0028660
749 Ga0495585_0000077
750 Ga0495585_0000094
751 Ga0495585_0000154
752 Ga0495585_0000940
753 Ga0495585_0001952
754 Ga0495585_0002583
755 Ga0495585_0007860
756 Ga0495585_0024507
757 Ga0495585_0057018
758 Ga0495585_0082081
759 Ga0495596_0000961
760 Ga0495596_0009123
761 Ga0495596_0012041
762 Ga0495596_0037712
763 Ga0495596_0038677
764 Ga0495596_0062218
765 Ga0495607_0002416
766 Ga0495607_0002798
767 Ga0495607_0010564
768 Ga0495607_0011987
769 Ga0495607_0012148
770 Ga0495607_0028843
771 Ga0495607_0038103
772 Ga0495607_0054462
773 Ga0495607_0060614
774 Ga0495607_0065407
775 Ga0495607_0087401
776 Ga0495583_0000008
777 Ga0495583_0000050
778 Ga0495583_0000064
779 Ga0495583_0000067
780 Ga0495583_0000250
781 Ga0495583_0000253
782 Ga0495583_0000485
783 Ga0495583_0002249
784 Ga0495583_0019755
785 Ga0495583_0025861
786 Ga0495583_0030893
787 Ga0495583_0048389
788 Ga0495583_0091100
789 Ga0495606_0000001
790 Ga0495606_0000030
791 Ga0495606_0000282
792 Ga0495606_0018842
793 Ga0495606_0030636
794 Ga0495606_0035060
795 Ga0495606_0045077
796 Ga0495606_0050770
797 Ga0495606_0057289
798 Ga0495606_0057510
799 Ga0495606_0093851
800 Ga0495606_0133882
801 Ga0495610_0000003
802 Ga0495610_0001826
803 Ga0495610_0005555
804 Ga0495610_0011630
805 Ga0495610_0020310
806 Ga0495610_0112087
807 Ga0495616_0000924
808 Ga0495616_0001100
809 Ga0495616_0002444
810 Ga0495616_0005518
811 Ga0495616_0011725
812 Ga0495616_0012575
813 Ga0495616_0013364
814 Ga0495616_0021407
815 Ga0495616_0040240
816 Ga0495616_0053341
817 Ga0495616_0092110
818 Ga0495620_0019918
819 Ga0495631_0000214
820 Ga0495631_0012700
821 Ga0495631_0019176
822 Ga0495631_0051537
823 Ga0495631_0057036
824 Ga0495631_0062284
825 Ga0495632_0000151
826 Ga0495632_0003007
827 Ga0495632_0026713
828 Ga0495632_0051765
829 Ga0495632_0058582
830 Ga0495637_0000042
831 Ga0495643_0000028
832 Ga0495643_0000285
833 Ga0495643_0002751
834 Ga0495643_0015685
835 Ga0495643_0015776
836 Ga0495643_0052974
837 Ga0495644_0002436
838 Ga0495644_0002963
839 Ga0495644_0004943
840 Ga0495644_0010462
841 Ga0495644_0018077
842 Ga0495648_0000001
843 Ga0495648_0000079
844 Ga0495648_0001359
845 Ga0495648_0002750
846 Ga0495648_0003215
847 Ga0495648_0014566
848 Ga0495648_0014982
849 Ga0495648_0022727
850 Ga0495648_0028372
851 Ga0495648_0042340
852 Ga0495648_0055139
853 Ga0495663_0006483
854 Ga0495666_0011013
855 Ga0495642_0003301
856 Ga0495642_0005123
857 Ga0495642_0005946
858 Ga0495642_0023913
859 Ga0495642_0037924
860 Ga0495642_0088514
861 Ga0495652_0028471
862 Ga0495654_0000037
863 Ga0495654_0040533
864 Ga0495654_0060273
865 Ga0495665_0024664
866 Ga0495665_0044440
867 Ga0495587_0121870
868 Ga0495609_0000026
869 Ga0495609_0000241
870 Ga0495609_0001046
871 Ga0495609_0001294
872 Ga0495609_0001330
873 Ga0495609_0001851
874 Ga0495609_0007727
875 Ga0495609_0018057
876 Ga0495609_0036406
877 Ga0495609_0041751
878 Ga0495609_0062144
879 Ga0495597_0000056
880 Ga0495597_0000705
881 Ga0495597_0000864
882 Ga0495597_0001532
883 Ga0495597_0006593
884 Ga0495597_0006628
885 Ga0495597_0007484
886 Ga0495597_0016163
887 Ga0495597_0046928
888 Ga0495622_0000131
889 Ga0495633_0000055
890 Ga0495633_0000106
891 Ga0495633_0001613
892 Ga0495633_0003359
893 Ga0495633_0017106
894 Ga0495633_0029947
895 Ga0495633_0095094
896 Ga0495656_0005067
897 Ga0495656_0040201
898 Ga0495656_0042855
899 Ga0495656_0074243
900 Ga0495656_0078987
901 Ga0495668_0000018
902 Ga0495668_0000190
903 Ga0495668_0001065
904 Ga0495668_0001873
905 Ga0495668_0002041
906 Ga0495668_0002146
907 Ga0495668_0006520
908 Ga0495668_0035836
909 Ga0495668_0041656
910 Ga0495668_0193873
911 Ga0495634_0071936
912 Ga0495611_0000151
913 Ga0495611_0002359
914 Ga0495611_0011731
915 Ga0495625_0000035
916 Ga0495625_0000391
917 Ga0495625_0002897
918 Ga0495625_0004167
919 Ga0495625_0007248
920 Ga0495625_0007938
921 Ga0495625_0020170
922 Ga0495625_0091623
923 Ga0495661_0000152
924 Ga0495661_0000715
925 Ga0495661_0008169
926 Ga0495661_0039547
927 Ga0495661_0040312
928 Ga0495661_0041699
929 Ga0495661_0051554
930 Ga0495661_0186036
931 Ga0495588_0000139
932 Ga0495599_0193189
933 Ga0495623_0039508
934 Ga0495623_0093049
935 Ga0495646_0050462
936 Ga0495669_0008861
937 Ga0495669_0024761
938 Ga0495669_0034607
939 Ga0495669_0059457
940 Ga0495670_0000513
941 Ga0495670_0031688
942 Ga0495670_0054252
943 Ga0495670_0062515
944 Ga0495670_0088109
945 Ga0495671_0000010
946 Ga0495671_0003853
947 Ga0495671_0004731
948 Ga0495671_0020732
949 Ga0495671_0037809
950 Ga0495649_0011975
951 Ga0495649_0015437
952 Ga0495649_0016169
953 Ga0495589_0000045
954 Ga0495589_0000100
955 Ga0495589_0000101
956 Ga0495589_0014427
957 Ga0495589_0023533
958 Ga0495589_0029595
959 Ga0495660_0000027
960 Ga0495660_0000335
961 Ga0495660_0000555
962 Ga0495660_0007649
963 Ga0495660_0015261
964 Ga0495660_0015437
965 Ga0495660_0020381
966 Ga0495660_0021709
967 Ga0495660_0031740
968 Ga0495660_0054308
969 Ga0495660_0097256
970 Ga0495581_0092627
971 Ga0495604_0060169
972 Ga0495636_0000169
973 Ga0495636_0042664
974 Ga0495672_0000127
975 Ga0495672_0002015
976 Ga0495672_0002441
977 Ga0495672_0002622
978 Ga0495672_0020028
979 Ga0495672_0043110
980 Ga0495676_0083159
981 Ga0495683_0000064
982 Ga0495683_0000498
983 Ga0495683_0015275
984 Ga0495683_0034198
985 Ga0495683_0036509
986 Ga0495683_0041784
987 Ga0495683_0044945
988 Ga0495687_000037
989 Ga0495687_000062
990 Ga0495687_000122
991 Ga0495687_001241
992 Ga0495687_001859
993 Ga0495687_002590
994 Ga0495687_011036
995 Ga0495687_076340
996 Ga0495675_0017159
997 Ga0495675_0062981
998 Ga0495677_0000014
999 Ga0495677_0002033
1000 Ga0495677_0002363
1001 Ga0495677_0006994
1002 Ga0495677_0019243
1003 Ga0495677_0033972
1004 Ga0495679_000603
1005 Ga0495679_006022
1006 Ga0495679_006467
1007 Ga0495679_041789
1008 Ga0495685_000011
1009 Ga0495685_000262
1010 Ga0495685_001458
1011 Ga0495685_014337
1012 Ga0495673_0000003
1013 Ga0495673_0000016
1014 Ga0495673_0004771
1015 Ga0495673_0006851
1016 Ga0495681_0000021
1017 Ga0495681_0012652
1018 Ga0495681_0029160
1019 Ga0495681_0043803
1020 Ga0495681_0050544
1021 Ga0495681_0066072
1022 Ga0495681_0067202
1023 Ga0495686_0000047
1024 Ga0495686_0022915
1025 Ga0495686_0087568
1026 Ga0495686_0195479
1027 Ga0495602_0030671
1028 Ga0495626_0000222
1029 Ga0495626_0001089
1030 Ga0495626_0004011
1031 Ga0495626_0004015
1032 Ga0495626_0007268
1033 Ga0495626_0011693
1034 Ga0495626_0015368
1035 Ga0495626_0017751
1036 Ga0495626_0035868
1037 Ga0495626_0046256
1038 Ga0496102_0518472
1039 Ga0496105_0334932
1040 Ga0496106_0058992
1041 Ga0496106_0319677
1042 Ga0496110_0000026
1043 Ga0496110_0212265
1044 Ga0496111_0033724
1045 Ga0496113_0063902
1046 Ga0496113_0234278
1047 Ga0496114_0022834
1048 Ga0496115_0120610
1049 Ga0496116_0089325
1050 Ga0496116_0149534
1051 Ga0496119_0167686
1052 Ga0496121_0009608
1053 Ga0496121_0226897
1054 Ga0496122_0037249
1055 Ga0496122_0044295
1056 Ga0496122_0093488
1057 Ga0496123_0003516
1058 Ga0496123_0005149
1059 Ga0496124_0005355
1060 Ga0496124_0019908
1061 Ga0496124_0063664
1062 Ga0496124_0072048
1063 Ga0496124_0121706
1064 Ga0496124_0136485
1065 Ga0496124_0137183
1066 Ga0496126_0004427
1067 Ga0495678_000002
1068 Ga0495678_000029
1069 Ga0495678_000045
1070 Ga0495678_004461
1071 Ga0495678_005099
1072 Ga0495678_006315
1073 Ga0495678_014701
1074 Ga0495682_0000062
1075 Ga0495682_0000082
1076 Ga0495682_0000490
1077 Ga0495682_0002339
1078 Ga0501249_002364
1079 Ga0501234_008639
1080 Ga0501269_001065
1081 Ga0501279_003371
1082 Ga0501035_0003225
1083 nmdc:mga03683_33274_c1
1084 Ga0500618_000068
1085 Ga0500586_005470
1086 Ga0587068_005599
1087 2643789483
1088 2643801496
1089 2644216060
1090 2644471442
1091 2738829887
1092 2739153683
1093 2739195603
1094 2739322079
1095 2739340320
1096 2809142135
1097 2821131834
1098 2842715521
1099 2857555918
1100 2857559135
1101 2857566934
1102 2904425717
1103 2919478251
1104 2932415453
1105 2932421386
1106 8047677200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bqb-assembly1.cif.gz_X hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.7642 1 322
3bqb-assembly1.cif.gz_X hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.7619 1 322
1wzo-assembly1.cif.gz_A crystal structure of the hpce from thermus thermophilus hb8 0.756 1 320
3bqb-assembly1.cif.gz_A hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.7512 1 322
2q1d-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate 0.7507 1 322
ID Description Score Start End Superfamily
af_I1K703_28_109_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7997 229 254 2.60.40.10
af_Q54SH6_478_772_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7913 228 250 3.90.70.10
af_Q3TZL0_37_246_3.90.310.10 Alpha Beta;Alpha-Beta Complex;Viral Glycoprotein Gp70;ENV polyprotein, receptor-binding domain 0.7824 224 251 3.90.310.10
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7769 83 322 3.90.850.10
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7605 83 322 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A5F0LK97-F1-model_v4 FAH family protein 0.9715 1 71
AF-A0A435FF96-F1-model_v4 FAH family protein 0.9675 1 93
AF-A0A5F0LK97-F1-model_v4 FAH family protein 0.9584 1 71
AF-A0A5Q8CGY0-F1-model_v4 GguC protein 0.9531 140 330 GO:0003824
AF-A0A317I7K1-F1-model_v4 FAH family protein 0.952 136 320 GO:0003824

Map