F462890

General Info

Members Datasets Scaffolds Average Seq Length
553 373 477 311

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0071258|Ga0436365_0071258_30247_31173
Length 308
Sequence VFNRLIMIDLEKHLPKKCAFDPKKIVVTPGRSVALAKDFETDYTGTYQAKKDAEADLATNVQRLADQQDLLYASDTYSVLILFQAMDAAGKDGTIKHVMSGINPQGCQVQSFKVPSAEELDHDYLWRTTRSLPRRGQIGIFNRSYYEEVLVTRVHPEILGHEHLPAKLDKKNIWKQRFDDINNFERYLTNNGTVILKFFLNVSKDEQKKRFLKRIEEKEKNWKFSASDIRERQFWPQYISAYEQVFTHTSTPWAPWFVIPADHKWFTRLCVSQMIVAALKSLELRYPTVPTSKAEELEKAKQELLSEK

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
3 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
4 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
5 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
6 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
7 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
8 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
9 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
10 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
11 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
12 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
13 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
14 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
15 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
16 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
17 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
18 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
19 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
20 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
21 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
22 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
23 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
24 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
25 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
26 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
27 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
28 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
29 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
30 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
31 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
32 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
33 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
34 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
35 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
36 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
37 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
38 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
39 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
40 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
41 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
42 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
43 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
44 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
45 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
46 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
47 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
48 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
49 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
50 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
51 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
52 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
53 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
54 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
55 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
56 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
57 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
58 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
59 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
60 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
61 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
62 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
63 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
64 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
65 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
66 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
67 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
68 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
69 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
70 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
71 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
73 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
74 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
78 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
79 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
80 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
81 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
82 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
86 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
87 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
88 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
89 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
90 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
91 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
92 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
93 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
94 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
95 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
96 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
114 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
115 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
123 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
124 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
125 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
126 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
127 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
128 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
149 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
150 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
151 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
152 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
155 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
157 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
203 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
204 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
205 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
206 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
207 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
208 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
209 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
210 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
211 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
212 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
213 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
221 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
222 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
227 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
230 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
245 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
246 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
273 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
274 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
282 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
333 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
337 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
340 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
341 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
342 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
343 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
344 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
347 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
348 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
349 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
350 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
351 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
352 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
353 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
354 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
355 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
356 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
357 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
358 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
359 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
360 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
361 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
362 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
363 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
364 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
365 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
366 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
367 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
368 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
369 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
370 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
371 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
372 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
373 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.08
Metatranscriptomes 0.18
Isolates 13.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.66
Nodule 9.04
Rhizoplane 2.89
Rhizosphere 62.03
Stem 0
Stem Tuber 0
Unclassified 13.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006709 3300001979 Bacteria 4742
2 JGI24737J22298_10003551 3300001990 Bacteria 5497
3 JGI24735J21928_10002003 3300002067 Bacteria 7162
4 JGI25406J46586_10001020 3300003203 Bacteria 13105
5 JGI25153J46596_10002778 3300003215 Bacteria 9952
6 JGI25160J50197_1000533 3300003354 Bacteria 21926
7 JGI25160J50197_1002209 3300003354 Bacteria 9141
8 JGI25404J52841_10001069 3300003659 Bacteria 4581
9 Ga0055531_10020435 3300003794 Bacteria 2619
10 Ga0065165_1013254 3300005262 Bacteria 3291
11 Ga0065165_1028932 3300005262 Bacteria 1781
12 Ga0070658_10205998 3300005327 Bacteria 1661
13 Ga0070683_100040356 3300005329 Bacteria 4291
14 Ga0070660_100014201 3300005339 Bacteria 5735
15 Ga0070691_10035300 3300005341 Bacteria 2354
16 Ga0070668_100016753 3300005347 Bacteria 5479
17 Ga0070674_100014129 3300005356 Bacteria 4957
18 Ga0070659_100037670 3300005366 Bacteria 3771
19 Ga0070667_100144466 3300005367 Bacteria 2085
20 Ga0070709_10000436 3300005434 Bacteria 25236
21 Ga0070709_10049752 3300005434 Bacteria 2622
22 Ga0070714_100003380 3300005435 Bacteria 11890
23 Ga0070714_100010313 3300005435 Bacteria 7382
24 Ga0070714_100176424 3300005435 Bacteria 1942
25 Ga0070713_100058619 3300005436 Bacteria 3211
26 Ga0070713_100123343 3300005436 Bacteria 2275
27 Ga0070713_100161083 3300005436 Bacteria 2003
28 Ga0070710_10000185 3300005437 Bacteria 28883
29 Ga0070710_10019877 3300005437 Bacteria 3477
30 Ga0070711_100010096 3300005439 Bacteria 5833
31 Ga0070711_100422353 3300005439 Bacteria 1087
32 Ga0070708_100066670 3300005445 Bacteria 3231
33 Ga0070663_100023102 3300005455 Bacteria 4164
34 Ga0070663_100071212 3300005455 Bacteria 2530
35 Ga0070662_100051353 3300005457 Bacteria 2977
36 Ga0070706_100005970 3300005467 Bacteria 11519
37 Ga0070706_100086416 3300005467 Bacteria 2906
38 Ga0070698_100004001 3300005471 Bacteria 16220
39 Ga0070698_100432596 3300005471 Unclassified 1251
40 Ga0070684_100012564 3300005535 Bacteria 6793
41 Ga0070684_100166145 3300005535 Bacteria 2003
42 Ga0070697_100001763 3300005536 Bacteria 16519
43 Ga0070697_100024850 3300005536 Bacteria 4771
44 Ga0068853_100001758 3300005539 Bacteria 15905
45 Ga0068853_100092747 3300005539 Bacteria 2657
46 Ga0068855_100026556 3300005563 Bacteria 6927
47 Ga0068855_100077337 3300005563 Bacteria 3861
48 Ga0068855_100136041 3300005563 Bacteria 2804
49 Ga0068855_100378746 3300005563 Bacteria 1554
50 Ga0070664_100193429 3300005564 Bacteria 1813
51 Ga0068857_100007124 3300005577 Bacteria 9629
52 Ga0068857_100015483 3300005577 Bacteria 6661
53 Ga0068857_100107693 3300005577 Bacteria 2503
54 Ga0068854_100000633 3300005578 Bacteria 20845
55 Ga0068854_100013479 3300005578 Bacteria 5367
56 Ga0068856_100064055 3300005614 Bacteria 3632
57 Ga0068856_100154913 3300005614 Bacteria 2301
58 Ga0068856_100198830 3300005614 Bacteria 2019
59 Ga0068852_100073403 3300005616 Bacteria 3010
60 Ga0068852_100360752 3300005616 Bacteria 1421
61 Ga0068851_10025843 3300005834 Bacteria 2882
62 Ga0068863_100355602 3300005841 Bacteria 1427
63 Ga0081455_10002021 3300005937 Bacteria 24257
64 Ga0081455_10006159 3300005937 Bacteria 12940
65 Ga0081455_10167492 3300005937 Bacteria 1677
66 Ga0081455_10194988 3300005937 Bacteria 1522
67 Ga0081540_1000230 3300005983 Bacteria 58518
68 Ga0081540_1031188 3300005983 Bacteria 2936
69 Ga0081540_1034736 3300005983 Bacteria 2713
70 Ga0081540_1066001 3300005983 Bacteria 1698
71 Ga0081539_10000486 3300005985 Bacteria 84009
72 Ga0070717_10006340 3300006028 Bacteria 8699
73 Ga0070717_10029690 3300006028 Bacteria 4389
74 Ga0070717_10035714 3300006028 Bacteria 4026
75 Ga0075365_10031406 3300006038 Bacteria 3407
76 Ga0075368_10003112 3300006042 Bacteria 5506
77 Ga0075363_100099373 3300006048 Bacteria 1609
78 Ga0070715_10000321 3300006163 Bacteria 11851
79 Ga0070715_10040004 3300006163 Bacteria 1957
80 Ga0070715_10141409 3300006163 Bacteria 1169
81 Ga0070716_100017887 3300006173 Bacteria 3684
82 Ga0070712_100008583 3300006175 Bacteria 6429
83 Ga0070712_100252001 3300006175 Bacteria 1411
84 Ga0075362_10099735 3300006177 Bacteria 1357
85 Ga0075367_10133189 3300006178 Bacteria 1537
86 Ga0075370_10062053 3300006353 Bacteria 2129
87 Ga0075434_100469735 3300006871 Bacteria 1279
88 Ga0068865_100055387 3300006881 Bacteria 2759
89 Ga0075436_100079811 3300006914 Bacteria 2267
90 Ga0099825_1040287 3300006941 Bacteria 1393
91 Ga0099824_1004900 3300006942 Bacteria 19056
92 Ga0099822_1000677 3300006943 Bacteria 34391
93 Ga0099823_1029021 3300006944 Bacteria 4714
94 Ga0075435_100066288 3300007076 Bacteria 2937
95 Ga0099794_10042238 3300007265 Bacteria 2173
96 Ga0099795_10016301 3300007788 Bacteria 2348
97 Ga0105240_10029651 3300009093 Bacteria 7123
98 Ga0105240_10039948 3300009093 Bacteria 6006
99 Ga0105240_10126184 3300009093 Bacteria 3075
100 Ga0105245_10105749 3300009098 Bacteria 2611
101 Ga0105245_10403177 3300009098 Bacteria 1367
102 Ga0105241_10008806 3300009174 Bacteria 7416
103 Ga0105241_10041591 3300009174 Bacteria 3473
104 Ga0105241_10201266 3300009174 Bacteria 1663
105 Ga0105242_10147006 3300009176 Bacteria 2051
106 Ga0105242_10711525 3300009176 Bacteria 984
107 Ga0105248_10105398 3300009177 Bacteria 3179
108 Ga0105237_10003348 3300009545 Bacteria 19080
109 Ga0105237_10015745 3300009545 Bacteria 7863
110 Ga0105237_10049568 3300009545 Bacteria 4220
111 Ga0105237_10052038 3300009545 Bacteria 4112
112 Ga0105237_10445820 3300009545 Bacteria 1300
113 Ga0105237_10732449 3300009545 Bacteria 995
114 Ga0105238_10016948 3300009551 Bacteria 7393
115 Ga0105238_10019638 3300009551 Bacteria 6881
116 Ga0105238_10032229 3300009551 Bacteria 5333
117 Ga0105249_10239458 3300009553 Bacteria 1793
118 Ga0099796_10007077 3300010159 Bacteria 2913
119 Ga0105239_10015813 3300010375 Bacteria 8350
120 Ga0105239_10162378 3300010375 Bacteria 2497
121 Ga0105239_10321226 3300010375 Bacteria 1745
122 Ga0105239_10413389 3300010375 Bacteria 1528
123 Ga0105246_10009364 3300011119 Bacteria 6034
124 Ga0157370_10100844 3300013104 Bacteria 2704
125 Ga0157369_10021807 3300013105 Bacteria 7163
126 Ga0157374_10062424 3300013296 Bacteria 3492
127 Ga0163162_10106506 3300013306 Bacteria 2899
128 Ga0163162_10260400 3300013306 Bacteria 1866
129 Ga0157375_10211523 3300013308 Bacteria 2097
130 Ga0163163_10010811 3300014325 Bacteria 8241
131 Ga0163163_10092838 3300014325 Bacteria 3034
132 Ga0157379_10078760 3300014968 Bacteria 2952
133 Ga0157376_10031017 3300014969 Bacteria 4275
134 Ga0214544_1000026 3300021320 Bacteria 161530
135 Ga0214542_1000025 3300021321 Bacteria 183588
136 Ga0214545_1000014 3300021324 Bacteria 183588
137 Ga0214543_1000034 3300021327 Bacteria 183712
138 Ga0213872_10103402 3300021361 Bacteria 1268
139 Ga0213872_10115042 3300021361 Bacteria 1192
140 Ga0213876_10002224 3300021384 Bacteria 11441
141 Ga0213871_10006514 3300021441 Bacteria 2472
142 Ga0209563_102222 3300025230 Bacteria 4501
143 Ga0207425_1010607 3300025245 Bacteria 2235
144 Ga0209677_105036 3300025253 Bacteria 3582
145 Ga0209455_1016254 3300025272 Bacteria 1603
146 Ga0209673_1027897 3300025273 Bacteria 1828
147 Ga0209564_1011304 3300025295 Bacteria 4012
148 Ga0209758_1000141 3300025297 Bacteria 172481
149 Ga0209758_1000324 3300025297 Bacteria 91475
150 Ga0209758_1002338 3300025297 Bacteria 19567
151 Ga0209758_1002921 3300025297 Bacteria 16464
152 Ga0209758_1003483 3300025297 Bacteria 14255
153 Ga0209256_1015260 3300025299 Bacteria 2698
154 Ga0209256_1044612 3300025299 Bacteria 1106
155 Ga0207426_1000437 3300025302 Bacteria 67439
156 Ga0207426_1016072 3300025302 Bacteria 2697
157 Ga0209257_1003859 3300025304 Bacteria 12250
158 Ga0209257_1019294 3300025304 Bacteria 2575
159 Ga0207656_10038810 3300025321 Bacteria 2011
160 Ga0207692_10000719 3300025898 Bacteria 11649
161 Ga0207692_10017847 3300025898 Bacteria 3172
162 Ga0207647_10001257 3300025904 Bacteria 19505
163 Ga0207647_10008566 3300025904 Bacteria 7322
164 Ga0207685_10009002 3300025905 Bacteria 2879
165 Ga0207685_10036427 3300025905 Bacteria 1804
166 Ga0207699_10000426 3300025906 Bacteria 21558
167 Ga0207699_10052535 3300025906 Bacteria 2412
168 Ga0207684_10003261 3300025910 Bacteria 15920
169 Ga0207684_10171142 3300025910 Bacteria 1872
170 Ga0207654_10001372 3300025911 Bacteria 12920
171 Ga0207654_10107436 3300025911 Bacteria 1730
172 Ga0207707_10000455 3300025912 Bacteria 42610
173 Ga0207707_10319363 3300025912 Bacteria 1341
174 Ga0207695_10000062 3300025913 Bacteria 351979
175 Ga0207695_10003366 3300025913 Bacteria 22590
176 Ga0207695_10030279 3300025913 Bacteria 5961
177 Ga0207695_10047053 3300025913 Bacteria 4568
178 Ga0207671_10001897 3300025914 Bacteria 23245
179 Ga0207671_10032098 3300025914 Bacteria 3909
180 Ga0207671_10145531 3300025914 Bacteria 1828
181 Ga0207693_10004222 3300025915 Bacteria 12183
182 Ga0207693_10005504 3300025915 Bacteria 10546
183 Ga0207693_10016557 3300025915 Bacteria 5891
184 Ga0207693_10125936 3300025915 Bacteria 2014
185 Ga0207693_10240893 3300025915 Bacteria 1420
186 Ga0207663_10000926 3300025916 Bacteria 13406
187 Ga0207663_10001359 3300025916 Bacteria 11334
188 Ga0207663_10159739 3300025916 Bacteria 1590
189 Ga0207657_10000702 3300025919 Bacteria 35592
190 Ga0207657_10304560 3300025919 Bacteria 1262
191 Ga0207649_10088230 3300025920 Bacteria 2025
192 Ga0207652_10001402 3300025921 Bacteria 21379
193 Ga0207646_10034753 3300025922 Bacteria 4556
194 Ga0207694_10005693 3300025924 Bacteria 9554
195 Ga0207694_10119798 3300025924 Bacteria 2100
196 Ga0207700_10005415 3300025928 Bacteria 7632
197 Ga0207700_10066701 3300025928 Bacteria 2752
198 Ga0207700_10127779 3300025928 Bacteria 2070
199 Ga0207700_10146739 3300025928 Bacteria 1945
200 Ga0207664_10006153 3300025929 Bacteria 8229
201 Ga0207664_10011452 3300025929 Bacteria 6307
202 Ga0207664_10196170 3300025929 Bacteria 1740
203 Ga0207644_10090551 3300025931 Bacteria 2279
204 Ga0207690_10145342 3300025932 Bacteria 1753
205 Ga0207690_10218299 3300025932 Bacteria 1458
206 Ga0207706_10057662 3300025933 Bacteria 3421
207 Ga0207669_10097679 3300025937 Bacteria 1932
208 Ga0207704_10213066 3300025938 Bacteria 1423
209 Ga0207704_10377561 3300025938 Bacteria 1112
210 Ga0207665_10000715 3300025939 Bacteria 22506
211 Ga0207665_10005437 3300025939 Bacteria 8507
212 Ga0207661_10005882 3300025944 Bacteria 8659
213 Ga0207679_10198728 3300025945 Bacteria 1673
214 Ga0207667_10006124 3300025949 Bacteria 14614
215 Ga0207667_10040718 3300025949 Bacteria 4946
216 Ga0207640_10080173 3300025981 Bacteria 2227
217 Ga0207640_10249652 3300025981 Bacteria 1376
218 Ga0207658_10021213 3300025986 Bacteria 4506
219 Ga0207703_10057297 3300026035 Bacteria 3176
220 Ga0207639_10013450 3300026041 Bacteria 5729
221 Ga0207639_10042343 3300026041 Bacteria 3412
222 Ga0207678_10022639 3300026067 Bacteria 5502
223 Ga0207678_10046072 3300026067 Bacteria 3771
224 Ga0207702_10000429 3300026078 Bacteria 48259
225 Ga0207641_10389524 3300026088 Bacteria 1336
226 Ga0207674_10003755 3300026116 Bacteria 18527
227 Ga0207674_10027923 3300026116 Bacteria 5963
228 Ga0207674_10034349 3300026116 Bacteria 5303
229 Ga0207698_10024834 3300026142 Bacteria 4212
230 Ga0207698_10101359 3300026142 Bacteria 2387
231 Ga0207698_10290297 3300026142 Bacteria 1517
232 Ga0209389_1000004 3300027296 Bacteria 263759
233 Ga0209389_1000023 3300027296 Bacteria 150730
234 Ga0209589_1000006 3300027357 Bacteria 436292
235 Ga0209589_1000010 3300027357 Bacteria 237657
236 Ga0209489_100007 3300027361 Bacteria 436292
237 Ga0209489_100011 3300027361 Bacteria 244710
238 Ga0209489_100777 3300027361 Bacteria 63061
239 Ga0209700_100008 3300027363 Bacteria 436292
240 Ga0209700_100013 3300027363 Bacteria 341906
241 Ga0265319_1005298 3300028563 Bacteria 6207
242 Ga0265334_10010675 3300028573 Bacteria 3875
243 Ga0265323_10001506 3300028653 Bacteria 11377
244 Ga0265336_10000930 3300028666 Bacteria 14828
245 Ga0265338_10000013 3300028800 Bacteria 379065
246 Ga0265324_10021904 3300029957 Bacteria 2289
247 Ga0307511_10083278 3300030521 Bacteria 2229
248 Ga0265762_1021935 3300030760 Bacteria 1179
249 Ga0307509_10054331 3300031507 Bacteria 4265
250 Ga0307508_10029755 3300031616 Bacteria 4936
251 Ga0307508_10148387 3300031616 Bacteria 1949
252 Ga0307508_10166762 3300031616 Bacteria 1806
253 Ga0265314_10021837 3300031711 Bacteria 4912
254 Ga0265342_10001358 3300031712 Bacteria 22902
255 Ga0307416_100203286 3300032002 Bacteria 1882
256 Ga0307411_10292134 3300032005 Bacteria 1303
257 Ga0307507_10051796 3300033179 Bacteria 3945
258 Ga0373934_0002715 3300035086 Bacteria 6489
259 Ga0373923_0000955 3300035111 Bacteria 7770
260 Ga0373936_0014202 3300035113 Bacteria 3042
261 Ga0373945_0005086 3300035116 Bacteria 4194
262 Ga0373954_0000156 3300035118 Bacteria 24327
263 Ga0373956_0000252 3300035119 Bacteria 21307
264 Ga0373957_0000344 3300035120 Bacteria 11777
265 Ga0373943_0026565 3300035170 Bacteria 2713
266 Ga0373955_0000229 3300035172 Bacteria 23386
267 Ga0373924_0000488 3300035410 Bacteria 12126
268 Ga0373935_0016489 3300035692 Bacteria 4470
269 Ga0373935_0264447 3300035692 Bacteria 1207
270 Ga0373927_0052411 3300035695 Bacteria 2639
271 Ga0373927_0127396 3300035695 Bacteria 1662
272 Ga0373933_0000628 3300035724 Bacteria 22042
273 Ga0373947_0021919 3300035725 Bacteria 3702
274 Ga0373947_0074742 3300035725 Bacteria 2086
275 Ga0373937_0018482 3300036401 Bacteria 6227
276 Ga0373937_0271894 3300036401 Bacteria 1599
277 Ga0373925_0004202 3300037068 Bacteria 10930
278 Ga0373925_0061780 3300037068 Bacteria 2815
279 Ga0395900_0013738 3300037418 Bacteria 8266
280 Ga0395898_0006919 3300037466 Bacteria 12054
281 Ga0395898_0074927 3300037466 Bacteria 3269
282 Ga0395905_0260893 3300037471 Bacteria 1618
283 Ga0395901_0148768 3300038443 Bacteria 2461
284 Ga0395901_0436585 3300038443 Bacteria 1341
285 Ga0436365_0071258 3300039437 Bacteria 37638
286 Ga0436360_1149121 3300039438 Bacteria 2197
287 Ga0436360_1271610 3300039438 Bacteria 3608
288 Ga0436361_0495771 3300039447 Bacteria 3441
289 Ga0436361_0773810 3300039447 Bacteria 2260
290 Ga0436361_1131574 3300039447 Bacteria 5692
291 Ga0436361_1147180 3300039447 Bacteria 3179
292 Ga0436363_0098383 3300039450 Bacteria 1297
293 Ga0436363_1257411 3300039450 Bacteria 5137
294 Ga0436362_0580199 3300039453 Bacteria 1413
295 Ga0436362_0728549 3300039453 Bacteria 1429
296 Ga0436362_1135817 3300039453 Bacteria 4695
297 Ga0466965_0098100 3300044683 Bacteria 1496
298 Ga0466965_0104730 3300044683 Bacteria 1449
299 Ga0466966_0000551 3300044684 Bacteria 23873
300 Ga0466966_0074919 3300044684 Bacteria 2115
301 Ga0466961_0000020 3300044693 Bacteria 107610
302 Ga0466971_0024092 3300044719 Bacteria 2715
303 Ga0466970_0126581 3300044765 Bacteria 1401
304 Ga0466957_0218622 3300044842 Bacteria 1257
305 Ga0466960_0194608 3300044901 Bacteria 1105
306 Ga0466959_0006412 3300045049 Bacteria 8144
307 Ga0466959_0014189 3300045049 Bacteria 5782
308 Ga0466959_0321690 3300045049 Bacteria 1057
309 Ga0466967_0022753 3300045976 Bacteria 5123
310 Ga0466967_0365319 3300045976 Bacteria 1399
311 Ga0495592_0003818 3300046454 Bacteria 10889
312 Ga0495592_0081969 3300046454 Bacteria 2332
313 Ga0495603_0016609 3300046455 Bacteria 4453
314 Ga0495629_0001098 3300046459 Bacteria 21450
315 Ga0495629_0036408 3300046459 Bacteria 3473
316 Ga0495629_0058344 3300046459 Bacteria 2698
317 Ga0495638_0049572 3300046460 Bacteria 2625
318 Ga0495641_0008205 3300046461 Bacteria 6404
319 Ga0495651_0002766 3300046462 Bacteria 13608
320 Ga0495653_0000562 3300046463 Bacteria 28426
321 Ga0495580_0012017 3300046472 Bacteria 6670
322 Ga0495582_0024510 3300046473 Bacteria 3301
323 Ga0495639_0008402 3300046475 Bacteria 4426
324 Ga0495639_0101701 3300046475 Bacteria 1358
325 Ga0495662_0008344 3300046476 Bacteria 5094
326 Ga0495664_0022905 3300046477 Bacteria 3623
327 Ga0495594_0000831 3300046499 Bacteria 15930
328 Ga0495594_0050218 3300046499 Bacteria 2294
329 Ga0495606_0079227 3300046507 Bacteria 2047
330 Ga0495608_0005591 3300046511 Bacteria 8974
331 Ga0495608_0074694 3300046511 Bacteria 2209
332 Ga0495618_0038803 3300046514 Bacteria 2994
333 Ga0495618_0063873 3300046514 Bacteria 2339
334 Ga0495618_0176557 3300046514 Bacteria 1358
335 Ga0495628_0011937 3300046516 Bacteria 7327
336 Ga0495631_0060711 3300046518 Bacteria 1640
337 Ga0495632_0076653 3300046519 Bacteria 1599
338 Ga0495648_0000696 3300046524 Bacteria 35871
339 Ga0495648_0149975 3300046524 Bacteria 1217
340 Ga0495666_0050872 3300046526 Bacteria 1991
341 Ga0495652_0045167 3300046529 Bacteria 3790
342 Ga0495665_0003517 3300046531 Bacteria 8506
343 Ga0495640_0015895 3300046533 Bacteria 5645
344 Ga0495587_0003932 3300046536 Bacteria 9864
345 Ga0495645_0057916 3300046543 Bacteria 2811
346 Ga0495622_0017670 3300046557 Bacteria 3320
347 Ga0495622_0024449 3300046557 Bacteria 2821
348 Ga0495622_0077958 3300046557 Bacteria 1526
349 Ga0495667_0001588 3300046559 Bacteria 15076
350 Ga0495667_0011912 3300046559 Bacteria 5892
351 Ga0495667_0020781 3300046559 Bacteria 4430
352 Ga0495634_0005172 3300046642 Bacteria 10078
353 Ga0495634_0101506 3300046642 Bacteria 1858
354 Ga0495611_0059288 3300046648 Bacteria 1737
355 Ga0495635_0000346 3300046663 Bacteria 29602
356 Ga0495635_0044111 3300046663 Bacteria 3076
357 Ga0495661_0093931 3300046665 Bacteria 1701
358 Ga0495657_0010298 3300046675 Bacteria 7041
359 Ga0495657_0010455 3300046675 Bacteria 6983
360 Ga0495599_0000522 3300046678 Bacteria 22066
361 Ga0495623_0019156 3300046679 Bacteria 4422
362 Ga0495623_0032894 3300046679 Bacteria 3331
363 Ga0495646_0000537 3300046680 Bacteria 20375
364 Ga0495613_0010578 3300046689 Bacteria 6844
365 Ga0495624_0001229 3300046690 Bacteria 20218
366 Ga0495624_0033977 3300046690 Bacteria 3302
367 Ga0495649_0034276 3300046694 Bacteria 2793
368 Ga0495600_0009591 3300046809 Bacteria 5985
369 Ga0495600_0026941 3300046809 Bacteria 3713
370 Ga0495581_0003621 3300047315 Bacteria 8899
371 Ga0495604_0004007 3300047317 Bacteria 11715
372 Ga0495674_0001945 3300047319 Bacteria 20360
373 Ga0495674_0004134 3300047319 Bacteria 14015
374 Ga0495674_0263980 3300047319 Bacteria 1414
375 Ga0495672_0038853 3300047320 Bacteria 2899
376 Ga0495676_0027297 3300047321 Bacteria 4897
377 Ga0495680_0002197 3300047322 Bacteria 20191
378 Ga0495683_0046360 3300047323 Bacteria 2181
379 Ga0495687_039594 3300047443 Bacteria 2084
380 Ga0495675_0001020 3300047444 Bacteria 17009
381 Ga0495684_0001669 3300047471 Bacteria 17830
382 Ga0495686_0204940 3300047472 Bacteria 1130
383 Ga0495686_0258496 3300047472 Bacteria 976
384 Ga0495593_0000190 3300047673 Bacteria 32323
385 Ga0495593_0004528 3300047673 Bacteria 8257
386 Ga0495593_0037979 3300047673 Bacteria 2602
387 Ga0495602_0042570 3300048088 Bacteria 4136
388 Ga0495614_0148795 3300048089 Bacteria 1044
389 Ga0496100_0225016 3300048903 Bacteria 1378
390 Ga0496101_0066922 3300048904 Bacteria 2622
391 Ga0496102_0019492 3300048905 Bacteria 5974
392 Ga0496103_0024423 3300048906 Bacteria 3649
393 Ga0496104_0002128 3300048907 Bacteria 17188
394 Ga0496104_0049007 3300048907 Bacteria 3983
395 Ga0496104_0146661 3300048907 Bacteria 2266
396 Ga0496105_0006684 3300048908 Bacteria 8877
397 Ga0496108_0032439 3300048911 Bacteria 4338
398 Ga0496112_0017832 3300048915 Bacteria 6681
399 Ga0496112_0019008 3300048915 Bacteria 6477
400 Ga0496113_0014472 3300048916 Bacteria 5384
401 Ga0496114_0140311 3300048917 Bacteria 2092
402 Ga0496115_0072067 3300048918 Bacteria 2803
403 Ga0496115_0094807 3300048918 Bacteria 2442
404 Ga0496115_0194625 3300048918 Bacteria 1675
405 Ga0496116_0112175 3300048919 Bacteria 1599
406 Ga0496117_0061870 3300048920 Bacteria 2570
407 Ga0496117_0118290 3300048920 Bacteria 1634
408 Ga0496118_0025184 3300048921 Bacteria 5111
409 Ga0496118_0070834 3300048921 Bacteria 2514
410 Ga0496119_0027998 3300048922 Bacteria 3858
411 Ga0496119_0073004 3300048922 Bacteria 2002
412 Ga0496119_0106914 3300048922 Bacteria 1561
413 Ga0496121_0000099 3300048924 Bacteria 200160
414 Ga0496121_0162394 3300048924 Bacteria 1632
415 Ga0496124_0005312 3300048927 Bacteria 14556
416 Ga0496124_0016688 3300048927 Bacteria 6967
417 Ga0496124_0144029 3300048927 Bacteria 1877
418 Ga0496125_0041977 3300048928 Bacteria 3903
419 Ga0496125_0056916 3300048928 Bacteria 3171
420 Ga0496125_0094316 3300048928 Bacteria 2230
421 Ga0496125_0151566 3300048928 Bacteria 1591
422 Ga0496126_0006667 3300048929 Bacteria 12838
423 Ga0496126_0026280 3300048929 Bacteria 5584
424 Ga0496126_0069077 3300048929 Bacteria 3152
425 Ga0496126_0144913 3300048929 Bacteria 2041
426 Ga0496126_0184069 3300048929 Bacteria 1772
427 Ga0495682_0002189 3300049460 Bacteria 9458
428 Ga0501042_0118769 3300049578 Bacteria 1903
429 Ga0501047_0161556 3300049581 Bacteria 2112
430 Ga0501073_0297899 3300049589 Bacteria 1113
431 nmdc:mga03683_29390_c1 3300050489 Bacteria 2191
432 nmdc:mga03n38_7163_c1 3300050490 Bacteria 3928
433 nmdc:mga00v17_86902_c1 3300050491 Bacteria 1960
434 nmdc:mga00v17_9842_c1 3300050491 Bacteria 5195
435 nmdc:mga0yw44_92712_c1 3300050492 Bacteria 1912
436 nmdc:mga0k408_10484_c1 3300050493 Bacteria 5013
437 nmdc:mga06z11_164267_c1 3300050494 Bacteria 1271
438 nmdc:mga07m45_208829_c1 3300050496 Bacteria 1136
439 nmdc:mga0n895_464107_c1 3300050512 Bacteria 1278
440 nmdc:mga0rr50_55226_c1 3300050513 Bacteria 2962
441 nmdc:mga0sz30_19857_c1 3300050516 Bacteria 2705
442 Ga0495601_0013705 3300053077 Bacteria 4877
443 Ga0500635_0068354 3300053080 Bacteria 1255
444 Ga0495595_0000170 3300053084 Bacteria 25705
445 Ga0495619_0000803 3300053085 Bacteria 20555
446 Ga0495619_0148561 3300053085 Bacteria 1616
447 Ga0500583_0021439 3300053092 Bacteria 2687
448 Ga0500651_0239843 3300053093 Bacteria 1058
449 Ga0500566_0000008 3300053094 Bacteria 143641
450 Ga0500566_0000066 3300053094 Bacteria 50309
451 Ga0500640_002483 3300053095 Bacteria 6119
452 Ga0500641_0034493 3300053096 Bacteria 2014
453 Ga0500572_000027 3300053111 Bacteria 45288
454 Ga0500607_125280 3300053121 Bacteria 1235
455 Ga0500614_017341 3300053123 Bacteria 1626
456 Ga0500658_0019785 3300053134 Bacteria 2536
457 Ga0500559_0000823 3300053136 Bacteria 20133
458 Ga0500559_0001270 3300053136 Bacteria 14757
459 Ga0500559_0003471 3300053136 Bacteria 7737
460 Ga0500559_0036941 3300053136 Bacteria 2115
461 Ga0500573_0052799 3300053140 Bacteria 2336
462 Ga0500577_0038557 3300053142 Bacteria 1726
463 Ga0500603_000033 3300053150 Bacteria 33766
464 Ga0500616_0000166 3300053153 Bacteria 110141
465 Ga0500622_0039045 3300053156 Bacteria 2475
466 Ga0500630_000238 3300053159 Bacteria 21843
467 Ga0500634_0046057 3300053161 Bacteria 2358
468 Ga0500638_068760 3300053162 Bacteria 1694
469 Ga0500639_000010 3300053163 Bacteria 136747
470 Ga0500639_009289 3300053163 Bacteria 5139
471 Ga0500639_102584 3300053163 Bacteria 1405
472 Ga0500636_0000803 3300053177 Bacteria 16935
473 Ga0500636_0000847 3300053177 Bacteria 16470
474 Ga0500636_0050907 3300053177 Bacteria 2434
475 Ga0500636_0058941 3300053177 Bacteria 2244
476 Ga0500645_025104 3300053730 Bacteria 1819
477 Ga0500609_008496 3300053731 Bacteria 1386

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_100001763 Ga0070697_1000017632 258
2 3300025910 Ga0207684_10171142 Ga0207684_101711422 264
3 3300005536 Ga0070697_100024850 Ga0070697_1000248505 272
4 3300005467 Ga0070706_100005970 Ga0070706_1000059701 288
5 3300005471 Ga0070698_100432596 Ga0070698_1004325961 288
6 3300025910 Ga0207684_10003261 Ga0207684_100032611 288
7 3300005435 Ga0070714_100176424 Ga0070714_1001764242 289
8 3300005439 Ga0070711_100422353 Ga0070711_1004223531 289
9 3300005445 Ga0070708_100066670 Ga0070708_1000666703 289
10 3300005471 Ga0070698_100004001 Ga0070698_1000040015 289
11 3300006028 Ga0070717_10029690 Ga0070717_100296903 289
12 3300006163 Ga0070715_10141409 Ga0070715_101414091 289
13 3300006175 Ga0070712_100252001 Ga0070712_1002520011 289
14 3300009545 Ga0105237_10445820 Ga0105237_104458202 289
15 3300021361 Ga0213872_10115042 Ga0213872_101150421 289
16 3300021384 Ga0213876_10002224 Ga0213876_100022247 289
17 3300021441 Ga0213871_10006514 Ga0213871_100065142 289
18 3300025915 Ga0207693_10125936 Ga0207693_101259362 289
19 3300025915 Ga0207693_10240893 Ga0207693_102408932 289
20 3300025916 Ga0207663_10159739 Ga0207663_101597392 289
21 3300025922 Ga0207646_10034753 Ga0207646_100347533 289
22 3300025928 Ga0207700_10005415 Ga0207700_100054158 289
23 3300025929 Ga0207664_10196170 Ga0207664_101961702 289
24 3300039437 Ga0436365_0071258 Ga0436365_0071258_30247_31173 289
25 3300039438 Ga0436360_1149121 Ga0436360_1149121_882_1790 289
26 3300039438 Ga0436360_1271610 Ga0436360_1271610_2199_3107 289
27 3300039447 Ga0436361_0495771 Ga0436361_0495771_2268_3176 289
28 3300039447 Ga0436361_0773810 Ga0436361_0773810_701_1609 289
29 3300039447 Ga0436361_1147180 Ga0436361_1147180_400_1308 289
30 3300039453 Ga0436362_0580199 Ga0436362_0580199_266_1192 289
31 3300039453 Ga0436362_1135817 Ga0436362_1135817_1007_1915 289
32 3300048929 Ga0496126_0184069 Ga0496126_0184069_12_953 295
33 3300025928 Ga0207700_10066701 Ga0207700_100667012 298
34 3300039453 Ga0436362_0728549 Ga0436362_0728549_374_1315 299
35 3300044684 Ga0466966_0074919 Ga0466966_0074919_77_1108 299
36 3300045049 Ga0466959_0014189 Ga0466959_0014189_2850_3881 299
37 3300048915 Ga0496112_0019008 Ga0496112_0019008_3683_4603 300
38 iso_pu_bacteria 2874628541 2874630518 300
39 iso_pu_bacteria 2893066018 2893071041 300
40 iso_pu_bacteria 2919073203 2919077047 300
41 3300030521 Ga0307511_10083278 Ga0307511_100832783 301
42 3300031507 Ga0307509_10054331 Ga0307509_100543313 301
43 iso_pu_bacteria 2876808645 2876810633 301
44 iso_pu_bacteria 2879110137 2879117928 301
45 iso_pu_bacteria 2888388044 2888388970 301
46 iso_pu_bacteria 2922361189 2922362696 301
47 iso_pu_bacteria 8006984368 8006989253 301
48 3300046557 Ga0495622_0077958 Ga0495622_0077958_196_1155 302
49 3300048922 Ga0496119_0106914 Ga0496119_0106914_488_1459 302
50 3300050516 nmdc:mga0sz30_19857_c1 nmdc:mga0sz30_19857_c1_707_1693 302
51 3300053094 Ga0500566_0000066 Ga0500566_0000066_41426_42385 302
52 3300053134 Ga0500658_0019785 Ga0500658_0019785_1512_2483 302
53 3300053136 Ga0500559_0001270 Ga0500559_0001270_11067_12038 302
54 3300053177 Ga0500636_0000803 Ga0500636_0000803_13861_14820 302
55 iso_pu_bacteria 2508501128 2509147171 302
56 iso_pu_bacteria 2824704595 2824706494 302
57 iso_pu_bacteria 2824753945 2824756958 302
58 iso_pu_bacteria 2824763712 2824769754 302
59 iso_pu_bacteria 2904711408 2904719078 302
60 iso_pu_bacteria 8006964411 8006971302 302
61 iso_pu_bacteria 8056681323 8056686288 302
62 3300003659 JGI25404J52841_10001069 JGI25404J52841_100010692 303
63 3300005327 Ga0070658_10205998 Ga0070658_102059981 303
64 3300005563 Ga0068855_100136041 Ga0068855_1001360413 303
65 3300005983 Ga0081540_1000230 Ga0081540_100023075 303
66 3300038443 Ga0395901_0436585 Ga0395901_0436585_285_1232 303
67 3300047320 Ga0495672_0038853 Ga0495672_0038853_308_1243 303
68 3300049578 Ga0501042_0118769 Ga0501042_0118769_529_1461 303
69 3300049581 Ga0501047_0161556 Ga0501047_0161556_1063_2010 303
70 iso_pu_bacteria 2513237095 2513649550 303
71 iso_pu_bacteria 2513237102 2513700060 303
72 iso_pu_bacteria 2513237104 2513719259 303
73 iso_pu_bacteria 2513237139 2513874540 303
74 iso_pu_bacteria 2513237141 2513894488 303
75 iso_pu_bacteria 2513237161 2514015558 303
76 iso_pu_bacteria 2517093001 2517100468 303
77 iso_pu_bacteria 2524023205 2524437329 303
78 iso_pu_bacteria 2617270735 2617350646 303
79 iso_pu_bacteria 2744054633 2745076804 303
80 iso_pu_bacteria 2802429603 2805916535 303
81 iso_pu_bacteria 2816332527 2818238020 303
82 iso_pu_bacteria 2824617872 2824618976 303
83 iso_pu_bacteria 2824626560 2824627504 303
84 iso_pu_bacteria 2824635225 2824638829 303
85 iso_pu_bacteria 2824644064 2824649014 303
86 iso_pu_bacteria 2824671348 2824676950 303
87 iso_pu_bacteria 2824679649 2824682055 303
88 iso_pu_bacteria 2824687955 2824693639 303
89 iso_pu_bacteria 2824696289 2824698726 303
90 iso_pu_bacteria 2824714736 2824716480 303
91 iso_pu_bacteria 2824723954 2824726426 303
92 iso_pu_bacteria 2824753945 2824756134 303
93 iso_pu_bacteria 2824763712 2824765866 303
94 iso_pu_bacteria 2824773399 2824778491 303
95 iso_pu_bacteria 2838122688 2838127778 303
96 iso_pu_bacteria 2841941048 2841943071 303
97 iso_pu_bacteria 2841949485 2841956092 303
98 iso_pu_bacteria 2841957949 2841960336 303
99 iso_pu_bacteria 2841966195 2841968287 303
100 iso_pu_bacteria 2841974524 2841976499 303
101 iso_pu_bacteria 2841983080 2841987875 303
102 iso_pu_bacteria 2842038055 2842042826 303
103 iso_pu_bacteria 2842045827 2842050867 303
104 iso_pu_bacteria 2847930680 2847938452 303
105 iso_pu_bacteria 2847939898 2847944350 303
106 iso_pu_bacteria 2857509624 2857512069 303
107 iso_pu_bacteria 2874612657 2874618415 303
108 iso_pu_bacteria 2874620515 2874623545 303
109 iso_pu_bacteria 2876761206 2876767780 303
110 iso_pu_bacteria 2879083081 2879088691 303
111 iso_pu_bacteria 2881364244 2881370566 303
112 iso_pu_bacteria 2885366525 2885367044 303
113 iso_pu_bacteria 2885409591 2885416534 303
114 iso_pu_bacteria 2888378607 2888381663 303
115 iso_pu_bacteria 2903727486 2903735008 303
116 iso_pu_bacteria 2904666416 2904667651 303
117 iso_pu_bacteria 2904711408 2904715528 303
118 iso_pu_bacteria 2906602504 2906604125 303
119 iso_pu_bacteria 2906626472 2906633022 303
120 iso_pu_bacteria 2906643746 2906648243 303
121 iso_pu_bacteria 2922393267 2922393763 303
122 iso_pu_bacteria 3005483717 3005485383 303
123 iso_pu_bacteria 3005506211 3005507245 303
124 iso_pu_bacteria 3005587118 3005594605 303
125 iso_pu_bacteria 3005594810 3005596684 303
126 iso_pu_bacteria 3005718088 3005719804 303
127 iso_pu_bacteria 8016622563 8016629178 303
128 iso_pu_bacteria 8019547302 8019548107 303
129 iso_pu_bacteria 8056967851 8056969882 303
130 3300003215 JGI25153J46596_10002778 JGI25153J46596_100027786 304
131 3300003354 JGI25160J50197_1000533 JGI25160J50197_100053317 304
132 3300003354 JGI25160J50197_1002209 JGI25160J50197_100220911 304
133 3300005262 Ga0065165_1028932 Ga0065165_10289322 304
134 3300005434 Ga0070709_10000436 Ga0070709_100004365 304
135 3300005435 Ga0070714_100010313 Ga0070714_1000103137 304
136 3300005436 Ga0070713_100161083 Ga0070713_1001610832 304
137 3300005437 Ga0070710_10000185 Ga0070710_1000018513 304
138 3300006038 Ga0075365_10031406 Ga0075365_100314062 304
139 3300006163 Ga0070715_10040004 Ga0070715_100400042 304
140 3300006173 Ga0070716_100017887 Ga0070716_1000178874 304
141 3300006175 Ga0070712_100008583 Ga0070712_1000085835 304
142 3300006178 Ga0075367_10133189 Ga0075367_101331892 304
143 3300009553 Ga0105249_10239458 Ga0105249_102394582 304
144 3300025273 Ga0209673_1027897 Ga0209673_10278971 304
145 3300025295 Ga0209564_1011304 Ga0209564_10113043 304
146 3300025297 Ga0209758_1002338 Ga0209758_100233814 304
147 3300025299 Ga0209256_1044612 Ga0209256_10446122 304
148 3300025302 Ga0207426_1000437 Ga0207426_100043723 304
149 3300025302 Ga0207426_1016072 Ga0207426_10160722 304
150 3300025898 Ga0207692_10000719 Ga0207692_100007198 304
151 3300025905 Ga0207685_10036427 Ga0207685_100364272 304
152 3300025906 Ga0207699_10000426 Ga0207699_1000042610 304
153 3300025915 Ga0207693_10016557 Ga0207693_100165573 304
154 3300025916 Ga0207663_10001359 Ga0207663_100013599 304
155 3300025928 Ga0207700_10127779 Ga0207700_101277792 304
156 3300025929 Ga0207664_10006153 Ga0207664_100061533 304
157 3300025939 Ga0207665_10005437 Ga0207665_100054377 304
158 3300035725 Ga0373947_0074742 Ga0373947_0074742_1002_1931 304
159 3300047472 Ga0495686_0204940 Ga0495686_0204940_109_1050 304
160 3300048928 Ga0496125_0056916 Ga0496125_0056916_1341_2258 304
161 3300048929 Ga0496126_0069077 Ga0496126_0069077_24_1115 304
162 3300049589 Ga0501073_0297899 Ga0501073_0297899_18_953 304
163 3300050491 nmdc:mga00v17_86902_c1 nmdc:mga00v17_86902_c1_736_1653 304
164 3300050492 nmdc:mga0yw44_92712_c1 nmdc:mga0yw44_92712_c1_562_1479 304
165 3300050496 nmdc:mga07m45_208829_c1 nmdc:mga07m45_208829_c1_72_989 304
166 3300053093 Ga0500651_0239843 Ga0500651_0239843_14_937 304
167 3300053156 Ga0500622_0039045 Ga0500622_0039045_636_1556 304
168 3300053730 Ga0500645_025104 Ga0500645_025104_78_1001 304
169 3300005937 Ga0081455_10006159 Ga0081455_1000615914 305
170 3300005983 Ga0081540_1031188 Ga0081540_10311882 305
171 3300009098 Ga0105245_10403177 Ga0105245_104031772 305
172 3300025230 Ga0209563_102222 Ga0209563_1022222 305
173 3300025253 Ga0209677_105036 Ga0209677_1050362 305
174 3300025297 Ga0209758_1003483 Ga0209758_100348311 305
175 3300032002 Ga0307416_100203286 Ga0307416_1002032863 305
176 3300045976 Ga0466967_0365319 Ga0466967_0365319_209_1156 305
177 3300046459 Ga0495629_0036408 Ga0495629_0036408_1513_2430 305
178 3300046460 Ga0495638_0049572 Ga0495638_0049572_694_1614 305
179 3300046507 Ga0495606_0079227 Ga0495606_0079227_604_1521 305
180 3300046511 Ga0495608_0074694 Ga0495608_0074694_892_1809 305
181 3300046514 Ga0495618_0176557 Ga0495618_0176557_289_1206 305
182 3300046524 Ga0495648_0149975 Ga0495648_0149975_62_979 305
183 3300046529 Ga0495652_0045167 Ga0495652_0045167_2206_3123 305
184 3300046533 Ga0495640_0015895 Ga0495640_0015895_2451_3368 305
185 3300046557 Ga0495622_0017670 Ga0495622_0017670_2199_3116 305
186 3300046559 Ga0495667_0020781 Ga0495667_0020781_3214_4131 305
187 3300046642 Ga0495634_0101506 Ga0495634_0101506_666_1583 305
188 3300046648 Ga0495611_0059288 Ga0495611_0059288_493_1413 305
189 3300046663 Ga0495635_0044111 Ga0495635_0044111_1265_2182 305
190 3300046675 Ga0495657_0010455 Ga0495657_0010455_2513_3430 305
191 3300046690 Ga0495624_0033977 Ga0495624_0033977_1511_2428 305
192 3300046694 Ga0495649_0034276 Ga0495649_0034276_1805_2722 305
193 3300046809 Ga0495600_0026941 Ga0495600_0026941_2587_3504 305
194 3300047319 Ga0495674_0263980 Ga0495674_0263980_205_1122 305
195 3300047673 Ga0495593_0037979 Ga0495593_0037979_960_1877 305
196 3300048088 Ga0495602_0042570 Ga0495602_0042570_1626_2543 305
197 3300048089 Ga0495614_0148795 Ga0495614_0148795_34_951 305
198 3300048904 Ga0496101_0066922 Ga0496101_0066922_953_1870 305
199 3300048907 Ga0496104_0002128 Ga0496104_0002128_782_1699 305
200 3300048908 Ga0496105_0006684 Ga0496105_0006684_5458_6375 305
201 3300048917 Ga0496114_0140311 Ga0496114_0140311_359_1276 305
202 3300048918 Ga0496115_0194625 Ga0496115_0194625_667_1584 305
203 3300048922 Ga0496119_0027998 Ga0496119_0027998_1239_2156 305
204 3300048924 Ga0496121_0162394 Ga0496121_0162394_23_940 305
205 3300048927 Ga0496124_0144029 Ga0496124_0144029_698_1615 305
206 3300048929 Ga0496126_0026280 Ga0496126_0026280_2295_3212 305
207 3300049460 Ga0495682_0002189 Ga0495682_0002189_1009_1926 305
208 3300053085 Ga0495619_0148561 Ga0495619_0148561_235_1152 305
209 3300053092 Ga0500583_0021439 Ga0500583_0021439_636_1565 305
210 3300053096 Ga0500641_0034493 Ga0500641_0034493_358_1284 305
211 3300053142 Ga0500577_0038557 Ga0500577_0038557_768_1688 305
212 3300053161 Ga0500634_0046057 Ga0500634_0046057_810_1730 305
213 3300053162 Ga0500638_068760 Ga0500638_068760_22_945 305
214 3300053163 Ga0500639_102584 Ga0500639_102584_106_1023 305
215 3300053177 Ga0500636_0000847 Ga0500636_0000847_4719_5642 305
216 3300053731 Ga0500609_008496 Ga0500609_008496_319_1248 305
217 3300005356 Ga0070674_100014129 Ga0070674_1000141294 306
218 3300005937 Ga0081455_10194988 Ga0081455_101949881 306
219 3300005983 Ga0081540_1034736 Ga0081540_10347364 306
220 3300006871 Ga0075434_100469735 Ga0075434_1004697352 306
221 3300006881 Ga0068865_100055387 Ga0068865_1000553872 306
222 3300007076 Ga0075435_100066288 Ga0075435_1000662882 306
223 3300007788 Ga0099795_10016301 Ga0099795_100163012 306
224 3300009176 Ga0105242_10147006 Ga0105242_101470062 306
225 3300009545 Ga0105237_10732449 Ga0105237_107324491 306
226 3300010159 Ga0099796_10007077 Ga0099796_100070773 306
227 3300013306 Ga0163162_10260400 Ga0163162_102604002 306
228 3300025297 Ga0209758_1002921 Ga0209758_10029212 306
229 3300025937 Ga0207669_10097679 Ga0207669_100976792 306
230 3300025938 Ga0207704_10213066 Ga0207704_102130662 306
231 3300028563 Ga0265319_1005298 Ga0265319_10052986 306
232 3300028573 Ga0265334_10010675 Ga0265334_100106752 306
233 3300028653 Ga0265323_10001506 Ga0265323_100015063 306
234 3300028666 Ga0265336_10000930 Ga0265336_100009308 306
235 3300028800 Ga0265338_10000013 Ga0265338_10000013333 306
236 3300029957 Ga0265324_10021904 Ga0265324_100219042 306
237 3300030760 Ga0265762_1021935 Ga0265762_10219351 306
238 3300031616 Ga0307508_10029755 Ga0307508_100297553 306
239 3300037471 Ga0395905_0260893 Ga0395905_0260893_519_1439 306
240 3300044765 Ga0466970_0126581 Ga0466970_0126581_91_1017 306
241 3300045049 Ga0466959_0321690 Ga0466959_0321690_95_1042 306
242 3300046518 Ga0495631_0060711 Ga0495631_0060711_99_1034 306
243 3300048928 Ga0496125_0041977 Ga0496125_0041977_540_1466 306
244 3300050512 nmdc:mga0n895_464107_c1 nmdc:mga0n895_464107_c1_258_1193 306
245 3300050513 nmdc:mga0rr50_55226_c1 nmdc:mga0rr50_55226_c1_1878_2813 306
246 3300001979 JGI24740J21852_10006709 JGI24740J21852_100067093 307
247 3300001990 JGI24737J22298_10003551 JGI24737J22298_100035516 307
248 3300002067 JGI24735J21928_10002003 JGI24735J21928_100020032 307
249 3300003203 JGI25406J46586_10001020 JGI25406J46586_100010202 307
250 3300003794 Ga0055531_10020435 Ga0055531_100204351 307
251 3300005262 Ga0065165_1013254 Ga0065165_10132541 307
252 3300005329 Ga0070683_100040356 Ga0070683_1000403562 307
253 3300005339 Ga0070660_100014201 Ga0070660_1000142013 307
254 3300005341 Ga0070691_10035300 Ga0070691_100353003 307
255 3300005347 Ga0070668_100016753 Ga0070668_1000167534 307
256 3300005366 Ga0070659_100037670 Ga0070659_1000376704 307
257 3300005367 Ga0070667_100144466 Ga0070667_1001444662 307
258 3300005434 Ga0070709_10049752 Ga0070709_100497523 307
259 3300005435 Ga0070714_100003380 Ga0070714_10000338012 307
260 3300005436 Ga0070713_100058619 Ga0070713_1000586193 307
261 3300005436 Ga0070713_100123343 Ga0070713_1001233432 307
262 3300005437 Ga0070710_10019877 Ga0070710_100198772 307
263 3300005439 Ga0070711_100010096 Ga0070711_1000100966 307
264 3300005455 Ga0070663_100023102 Ga0070663_1000231022 307
265 3300005455 Ga0070663_100071212 Ga0070663_1000712123 307
266 3300005457 Ga0070662_100051353 Ga0070662_1000513532 307
267 3300005467 Ga0070706_100086416 Ga0070706_1000864163 307
268 3300005535 Ga0070684_100012564 Ga0070684_1000125643 307
269 3300005535 Ga0070684_100166145 Ga0070684_1001661452 307
270 3300005539 Ga0068853_100001758 Ga0068853_10000175814 307
271 3300005539 Ga0068853_100092747 Ga0068853_1000927472 307
272 3300005563 Ga0068855_100026556 Ga0068855_1000265563 307
273 3300005563 Ga0068855_100077337 Ga0068855_1000773372 307
274 3300005563 Ga0068855_100378746 Ga0068855_1003787462 307
275 3300005564 Ga0070664_100193429 Ga0070664_1001934292 307
276 3300005577 Ga0068857_100007124 Ga0068857_10000712411 307
277 3300005577 Ga0068857_100015483 Ga0068857_1000154834 307
278 3300005577 Ga0068857_100107693 Ga0068857_1001076933 307
279 3300005578 Ga0068854_100000633 Ga0068854_10000063320 307
280 3300005578 Ga0068854_100013479 Ga0068854_1000134792 307
281 3300005614 Ga0068856_100064055 Ga0068856_1000640554 307
282 3300005614 Ga0068856_100154913 Ga0068856_1001549132 307
283 3300005614 Ga0068856_100198830 Ga0068856_1001988303 307
284 3300005616 Ga0068852_100073403 Ga0068852_1000734032 307
285 3300005616 Ga0068852_100360752 Ga0068852_1003607522 307
286 3300005834 Ga0068851_10025843 Ga0068851_100258432 307
287 3300005841 Ga0068863_100355602 Ga0068863_1003556022 307
288 3300005937 Ga0081455_10002021 Ga0081455_1000202112 307
289 3300005937 Ga0081455_10167492 Ga0081455_101674923 307
290 3300005983 Ga0081540_1066001 Ga0081540_10660011 307
291 3300005985 Ga0081539_10000486 Ga0081539_1000048644 307
292 3300006028 Ga0070717_10006340 Ga0070717_100063404 307
293 3300006028 Ga0070717_10035714 Ga0070717_100357142 307
294 3300006042 Ga0075368_10003112 Ga0075368_100031126 307
295 3300006048 Ga0075363_100099373 Ga0075363_1000993732 307
296 3300006163 Ga0070715_10000321 Ga0070715_1000032110 307
297 3300006177 Ga0075362_10099735 Ga0075362_100997351 307
298 3300006353 Ga0075370_10062053 Ga0075370_100620532 307
299 3300006914 Ga0075436_100079811 Ga0075436_1000798112 307
300 3300006941 Ga0099825_1040287 Ga0099825_10402871 307
301 3300006942 Ga0099824_1004900 Ga0099824_100490019 307
302 3300006943 Ga0099822_1000677 Ga0099822_100067712 307
303 3300006944 Ga0099823_1029021 Ga0099823_10290213 307
304 3300007265 Ga0099794_10042238 Ga0099794_100422382 307
305 3300009093 Ga0105240_10029651 Ga0105240_100296512 307
306 3300009093 Ga0105240_10039948 Ga0105240_100399481 307
307 3300009093 Ga0105240_10126184 Ga0105240_101261843 307
308 3300009098 Ga0105245_10105749 Ga0105245_101057493 307
309 3300009174 Ga0105241_10008806 Ga0105241_100088064 307
310 3300009174 Ga0105241_10041591 Ga0105241_100415913 307
311 3300009174 Ga0105241_10201266 Ga0105241_102012661 307
312 3300009176 Ga0105242_10711525 Ga0105242_107115251 307
313 3300009177 Ga0105248_10105398 Ga0105248_101053982 307
314 3300009545 Ga0105237_10003348 Ga0105237_100033481 307
315 3300009545 Ga0105237_10015745 Ga0105237_100157453 307
316 3300009545 Ga0105237_10049568 Ga0105237_100495683 307
317 3300009545 Ga0105237_10052038 Ga0105237_100520382 307
318 3300009551 Ga0105238_10016948 Ga0105238_100169482 307
319 3300009551 Ga0105238_10019638 Ga0105238_100196382 307
320 3300009551 Ga0105238_10032229 Ga0105238_100322293 307
321 3300010375 Ga0105239_10015813 Ga0105239_100158139 307
322 3300010375 Ga0105239_10162378 Ga0105239_101623782 307
323 3300010375 Ga0105239_10321226 Ga0105239_103212262 307
324 3300010375 Ga0105239_10413389 Ga0105239_104133892 307
325 3300011119 Ga0105246_10009364 Ga0105246_100093644 307
326 3300013104 Ga0157370_10100844 Ga0157370_101008443 307
327 3300013105 Ga0157369_10021807 Ga0157369_100218074 307
328 3300013296 Ga0157374_10062424 Ga0157374_100624243 307
329 3300013306 Ga0163162_10106506 Ga0163162_101065064 307
330 3300013308 Ga0157375_10211523 Ga0157375_102115232 307
331 3300014325 Ga0163163_10010811 Ga0163163_100108118 307
332 3300014325 Ga0163163_10092838 Ga0163163_100928382 307
333 3300014968 Ga0157379_10078760 Ga0157379_100787604 307
334 3300014969 Ga0157376_10031017 Ga0157376_100310176 307
335 3300021320 Ga0214544_1000026 Ga0214544_100002628 307
336 3300021321 Ga0214542_1000025 Ga0214542_1000025133 307
337 3300021324 Ga0214545_1000014 Ga0214545_100001445 307
338 3300021327 Ga0214543_1000034 Ga0214543_1000034132 307
339 3300021361 Ga0213872_10103402 Ga0213872_101034022 307
340 3300025245 Ga0207425_1010607 Ga0207425_10106072 307
341 3300025272 Ga0209455_1016254 Ga0209455_10162542 307
342 3300025297 Ga0209758_1000141 Ga0209758_100014134 307
343 3300025297 Ga0209758_1000324 Ga0209758_100032424 307
344 3300025299 Ga0209256_1015260 Ga0209256_10152601 307
345 3300025304 Ga0209257_1003859 Ga0209257_10038594 307
346 3300025304 Ga0209257_1019294 Ga0209257_10192942 307
347 3300025321 Ga0207656_10038810 Ga0207656_100388102 307
348 3300025898 Ga0207692_10017847 Ga0207692_100178473 307
349 3300025904 Ga0207647_10001257 Ga0207647_100012574 307
350 3300025904 Ga0207647_10008566 Ga0207647_100085665 307
351 3300025905 Ga0207685_10009002 Ga0207685_100090023 307
352 3300025906 Ga0207699_10052535 Ga0207699_100525352 307
353 3300025911 Ga0207654_10001372 Ga0207654_100013722 307
354 3300025911 Ga0207654_10107436 Ga0207654_101074361 307
355 3300025912 Ga0207707_10000455 Ga0207707_100004553 307
356 3300025912 Ga0207707_10319363 Ga0207707_103193632 307
357 3300025913 Ga0207695_10000062 Ga0207695_10000062147 307
358 3300025913 Ga0207695_10003366 Ga0207695_1000336622 307
359 3300025913 Ga0207695_10030279 Ga0207695_100302792 307
360 3300025913 Ga0207695_10047053 Ga0207695_100470535 307
361 3300025914 Ga0207671_10001897 Ga0207671_1000189722 307
362 3300025914 Ga0207671_10032098 Ga0207671_100320982 307
363 3300025914 Ga0207671_10145531 Ga0207671_101455312 307
364 3300025915 Ga0207693_10004222 Ga0207693_1000422213 307
365 3300025915 Ga0207693_10005504 Ga0207693_100055047 307
366 3300025916 Ga0207663_10000926 Ga0207663_100009263 307
367 3300025919 Ga0207657_10000702 Ga0207657_1000070216 307
368 3300025919 Ga0207657_10304560 Ga0207657_103045602 307
369 3300025920 Ga0207649_10088230 Ga0207649_100882303 307
370 3300025921 Ga0207652_10001402 Ga0207652_1000140220 307
371 3300025924 Ga0207694_10005693 Ga0207694_100056936 307
372 3300025924 Ga0207694_10119798 Ga0207694_101197982 307
373 3300025928 Ga0207700_10146739 Ga0207700_101467393 307
374 3300025929 Ga0207664_10011452 Ga0207664_100114528 307
375 3300025931 Ga0207644_10090551 Ga0207644_100905511 307
376 3300025932 Ga0207690_10145342 Ga0207690_101453422 307
377 3300025932 Ga0207690_10218299 Ga0207690_102182991 307
378 3300025933 Ga0207706_10057662 Ga0207706_100576622 307
379 3300025938 Ga0207704_10377561 Ga0207704_103775612 307
380 3300025939 Ga0207665_10000715 Ga0207665_100007155 307
381 3300025944 Ga0207661_10005882 Ga0207661_100058824 307
382 3300025945 Ga0207679_10198728 Ga0207679_101987282 307
383 3300025949 Ga0207667_10006124 Ga0207667_100061242 307
384 3300025949 Ga0207667_10040718 Ga0207667_100407184 307
385 3300025981 Ga0207640_10080173 Ga0207640_100801732 307
386 3300025981 Ga0207640_10249652 Ga0207640_102496522 307
387 3300025986 Ga0207658_10021213 Ga0207658_100212132 307
388 3300026035 Ga0207703_10057297 Ga0207703_100572973 307
389 3300026041 Ga0207639_10013450 Ga0207639_100134503 307
390 3300026041 Ga0207639_10042343 Ga0207639_100423432 307
391 3300026067 Ga0207678_10022639 Ga0207678_100226393 307
392 3300026067 Ga0207678_10046072 Ga0207678_100460722 307
393 3300026078 Ga0207702_10000429 Ga0207702_1000042928 307
394 3300026088 Ga0207641_10389524 Ga0207641_103895242 307
395 3300026116 Ga0207674_10003755 Ga0207674_100037557 307
396 3300026116 Ga0207674_10027923 Ga0207674_100279234 307
397 3300026116 Ga0207674_10034349 Ga0207674_100343494 307
398 3300026142 Ga0207698_10024834 Ga0207698_100248343 307
399 3300026142 Ga0207698_10101359 Ga0207698_101013593 307
400 3300026142 Ga0207698_10290297 Ga0207698_102902972 307
401 3300027296 Ga0209389_1000004 Ga0209389_1000004114 307
402 3300027296 Ga0209389_1000023 Ga0209389_1000023111 307
403 3300027357 Ga0209589_1000006 Ga0209589_1000006265 307
404 3300027357 Ga0209589_1000010 Ga0209589_100001047 307
405 3300027361 Ga0209489_100007 Ga0209489_100007265 307
406 3300027361 Ga0209489_100011 Ga0209489_100011188 307
407 3300027361 Ga0209489_100777 Ga0209489_10077740 307
408 3300027363 Ga0209700_100008 Ga0209700_100008265 307
409 3300027363 Ga0209700_100013 Ga0209700_100013200 307
410 3300031616 Ga0307508_10148387 Ga0307508_101483872 307
411 3300031616 Ga0307508_10166762 Ga0307508_101667621 307
412 3300031711 Ga0265314_10021837 Ga0265314_100218373 307
413 3300031712 Ga0265342_10001358 Ga0265342_1000135820 307
414 3300032005 Ga0307411_10292134 Ga0307411_102921341 307
415 3300033179 Ga0307507_10051796 Ga0307507_100517964 307
416 3300035086 Ga0373934_0002715 Ga0373934_0002715_3607_4563 307
417 3300035111 Ga0373923_0000955 Ga0373923_0000955_3622_4578 307
418 3300035113 Ga0373936_0014202 Ga0373936_0014202_1013_1966 307
419 3300035116 Ga0373945_0005086 Ga0373945_0005086_1574_2527 307
420 3300035118 Ga0373954_0000156 Ga0373954_0000156_10945_11901 307
421 3300035119 Ga0373956_0000252 Ga0373956_0000252_2061_3017 307
422 3300035120 Ga0373957_0000344 Ga0373957_0000344_8324_9280 307
423 3300035170 Ga0373943_0026565 Ga0373943_0026565_603_1556 307
424 3300035172 Ga0373955_0000229 Ga0373955_0000229_17900_18856 307
425 3300035410 Ga0373924_0000488 Ga0373924_0000488_8602_9558 307
426 3300035692 Ga0373935_0016489 Ga0373935_0016489_3365_4318 307
427 3300035692 Ga0373935_0264447 Ga0373935_0264447_201_1139 307
428 3300035695 Ga0373927_0052411 Ga0373927_0052411_174_1115 307
429 3300035695 Ga0373927_0127396 Ga0373927_0127396_453_1406 307
430 3300035724 Ga0373933_0000628 Ga0373933_0000628_16659_17615 307
431 3300035725 Ga0373947_0021919 Ga0373947_0021919_119_1072 307
432 3300036401 Ga0373937_0018482 Ga0373937_0018482_1224_2243 307
433 3300036401 Ga0373937_0271894 Ga0373937_0271894_612_1568 307
434 3300037068 Ga0373925_0004202 Ga0373925_0004202_2633_3586 307
435 3300037068 Ga0373925_0061780 Ga0373925_0061780_790_1731 307
436 3300037418 Ga0395900_0013738 Ga0395900_0013738_4401_5342 307
437 3300037466 Ga0395898_0006919 Ga0395898_0006919_5728_6669 307
438 3300037466 Ga0395898_0074927 Ga0395898_0074927_1025_1972 307
439 3300038443 Ga0395901_0148768 Ga0395901_0148768_800_1747 307
440 3300039447 Ga0436361_1131574 Ga0436361_1131574_1972_2922 307
441 3300039450 Ga0436363_0098383 Ga0436363_0098383_331_1257 307
442 3300039450 Ga0436363_1257411 Ga0436363_1257411_2131_3072 307
443 3300044683 Ga0466965_0098100 Ga0466965_0098100_506_1465 307
444 3300044683 Ga0466965_0104730 Ga0466965_0104730_102_1052 307
445 3300044684 Ga0466966_0000551 Ga0466966_0000551_13344_14303 307
446 3300044693 Ga0466961_0000020 Ga0466961_0000020_46907_47866 307
447 3300044719 Ga0466971_0024092 Ga0466971_0024092_1406_2368 307
448 3300044842 Ga0466957_0218622 Ga0466957_0218622_121_1044 307
449 3300044901 Ga0466960_0194608 Ga0466960_0194608_50_1000 307
450 3300045049 Ga0466959_0006412 Ga0466959_0006412_1684_2643 307
451 3300045976 Ga0466967_0022753 Ga0466967_0022753_973_1944 307
452 3300046454 Ga0495592_0003818 Ga0495592_0003818_2384_3340 307
453 3300046454 Ga0495592_0081969 Ga0495592_0081969_414_1367 307
454 3300046455 Ga0495603_0016609 Ga0495603_0016609_426_1379 307
455 3300046459 Ga0495629_0001098 Ga0495629_0001098_16733_17689 307
456 3300046459 Ga0495629_0058344 Ga0495629_0058344_377_1330 307
457 3300046461 Ga0495641_0008205 Ga0495641_0008205_5299_6252 307
458 3300046462 Ga0495651_0002766 Ga0495651_0002766_7179_8135 307
459 3300046463 Ga0495653_0000562 Ga0495653_0000562_3782_4738 307
460 3300046472 Ga0495580_0012017 Ga0495580_0012017_1660_2613 307
461 3300046473 Ga0495582_0024510 Ga0495582_0024510_154_1107 307
462 3300046475 Ga0495639_0008402 Ga0495639_0008402_3075_4028 307
463 3300046475 Ga0495639_0101701 Ga0495639_0101701_402_1340 307
464 3300046476 Ga0495662_0008344 Ga0495662_0008344_1802_2755 307
465 3300046477 Ga0495664_0022905 Ga0495664_0022905_2272_3225 307
466 3300046499 Ga0495594_0000831 Ga0495594_0000831_6534_7487 307
467 3300046499 Ga0495594_0050218 Ga0495594_0050218_1196_2134 307
468 3300046511 Ga0495608_0005591 Ga0495608_0005591_5474_6430 307
469 3300046514 Ga0495618_0038803 Ga0495618_0038803_156_1112 307
470 3300046514 Ga0495618_0063873 Ga0495618_0063873_1039_1992 307
471 3300046516 Ga0495628_0011937 Ga0495628_0011937_480_1436 307
472 3300046519 Ga0495632_0076653 Ga0495632_0076653_305_1234 307
473 3300046524 Ga0495648_0000696 Ga0495648_0000696_13660_14619 307
474 3300046526 Ga0495666_0050872 Ga0495666_0050872_1020_1973 307
475 3300046531 Ga0495665_0003517 Ga0495665_0003517_1964_2917 307
476 3300046536 Ga0495587_0003932 Ga0495587_0003932_3435_4391 307
477 3300046543 Ga0495645_0057916 Ga0495645_0057916_937_1893 307
478 3300046557 Ga0495622_0024449 Ga0495622_0024449_285_1238 307
479 3300046559 Ga0495667_0001588 Ga0495667_0001588_4556_5512 307
480 3300046559 Ga0495667_0011912 Ga0495667_0011912_3042_3995 307
481 3300046642 Ga0495634_0005172 Ga0495634_0005172_8361_9314 307
482 3300046663 Ga0495635_0000346 Ga0495635_0000346_1934_2890 307
483 3300046665 Ga0495661_0093931 Ga0495661_0093931_435_1370 307
484 3300046675 Ga0495657_0010298 Ga0495657_0010298_5474_6430 307
485 3300046678 Ga0495599_0000522 Ga0495599_0000522_3445_4401 307
486 3300046679 Ga0495623_0019156 Ga0495623_0019156_3435_4391 307
487 3300046679 Ga0495623_0032894 Ga0495623_0032894_1969_2988 307
488 3300046680 Ga0495646_0000537 Ga0495646_0000537_4530_5486 307
489 3300046689 Ga0495613_0010578 Ga0495613_0010578_1517_2470 307
490 3300046690 Ga0495624_0001229 Ga0495624_0001229_16931_17884 307
491 3300046809 Ga0495600_0009591 Ga0495600_0009591_3827_4783 307
492 3300047315 Ga0495581_0003621 Ga0495581_0003621_7487_8440 307
493 3300047317 Ga0495604_0004007 Ga0495604_0004007_10148_11104 307
494 3300047319 Ga0495674_0001945 Ga0495674_0001945_5074_6027 307
495 3300047319 Ga0495674_0004134 Ga0495674_0004134_4117_5073 307
496 3300047321 Ga0495676_0027297 Ga0495676_0027297_974_1927 307
497 3300047322 Ga0495680_0002197 Ga0495680_0002197_12299_13255 307
498 3300047323 Ga0495683_0046360 Ga0495683_0046360_1001_1930 307
499 3300047443 Ga0495687_039594 Ga0495687_039594_539_1468 307
500 3300047444 Ga0495675_0001020 Ga0495675_0001020_11478_12434 307
501 3300047471 Ga0495684_0001669 Ga0495684_0001669_12299_13255 307
502 3300047472 Ga0495686_0258496 Ga0495686_0258496_18_947 307
503 3300047673 Ga0495593_0000190 Ga0495593_0000190_3683_4639 307
504 3300047673 Ga0495593_0004528 Ga0495593_0004528_526_1479 307
505 3300048903 Ga0496100_0225016 Ga0496100_0225016_379_1308 307
506 3300048905 Ga0496102_0019492 Ga0496102_0019492_1659_2588 307
507 3300048906 Ga0496103_0024423 Ga0496103_0024423_1531_2460 307
508 3300048907 Ga0496104_0049007 Ga0496104_0049007_2975_3904 307
509 3300048907 Ga0496104_0146661 Ga0496104_0146661_76_1005 307
510 3300048911 Ga0496108_0032439 Ga0496108_0032439_2009_2938 307
511 3300048915 Ga0496112_0017832 Ga0496112_0017832_1515_2444 307
512 3300048916 Ga0496113_0014472 Ga0496113_0014472_2544_3473 307
513 3300048918 Ga0496115_0072067 Ga0496115_0072067_1297_2253 307
514 3300048918 Ga0496115_0094807 Ga0496115_0094807_829_1788 307
515 3300048919 Ga0496116_0112175 Ga0496116_0112175_155_1096 307
516 3300048920 Ga0496117_0061870 Ga0496117_0061870_1535_2464 307
517 3300048920 Ga0496117_0118290 Ga0496117_0118290_230_1171 307
518 3300048921 Ga0496118_0025184 Ga0496118_0025184_3519_4460 307
519 3300048921 Ga0496118_0070834 Ga0496118_0070834_1295_2224 307
520 3300048922 Ga0496119_0073004 Ga0496119_0073004_36_965 307
521 3300048924 Ga0496121_0000099 Ga0496121_0000099_19203_20144 307
522 3300048927 Ga0496124_0005312 Ga0496124_0005312_7412_8353 307
523 3300048927 Ga0496124_0016688 Ga0496124_0016688_118_1047 307
524 3300048928 Ga0496125_0094316 Ga0496125_0094316_903_1832 307
525 3300048928 Ga0496125_0151566 Ga0496125_0151566_221_1150 307
526 3300048929 Ga0496126_0006667 Ga0496126_0006667_6358_7299 307
527 3300048929 Ga0496126_0144913 Ga0496126_0144913_672_1631 307
528 3300050489 nmdc:mga03683_29390_c1 nmdc:mga03683_29390_c1_535_1464 307
529 3300050490 nmdc:mga03n38_7163_c1 nmdc:mga03n38_7163_c1_1214_2143 307
530 3300050491 nmdc:mga00v17_9842_c1 nmdc:mga00v17_9842_c1_430_1359 307
531 3300050493 nmdc:mga0k408_10484_c1 nmdc:mga0k408_10484_c1_1211_2140 307
532 3300050494 nmdc:mga06z11_164267_c1 nmdc:mga06z11_164267_c1_152_1081 307
533 3300053077 Ga0495601_0013705 Ga0495601_0013705_2646_3602 307
534 3300053080 Ga0500635_0068354 Ga0500635_0068354_215_1162 307
535 3300053084 Ga0495595_0000170 Ga0495595_0000170_4535_5491 307
536 3300053085 Ga0495619_0000803 Ga0495619_0000803_11478_12434 307
537 3300053094 Ga0500566_0000008 Ga0500566_0000008_91512_92459 307
538 3300053095 Ga0500640_002483 Ga0500640_002483_3597_4544 307
539 3300053111 Ga0500572_000027 Ga0500572_000027_1950_2879 307
540 3300053121 Ga0500607_125280 Ga0500607_125280_34_963 307
541 3300053123 Ga0500614_017341 Ga0500614_017341_327_1274 307
542 3300053136 Ga0500559_0000823 Ga0500559_0000823_16279_17208 307
543 3300053136 Ga0500559_0003471 Ga0500559_0003471_5693_6640 307
544 3300053136 Ga0500559_0036941 Ga0500559_0036941_470_1411 307
545 3300053140 Ga0500573_0052799 Ga0500573_0052799_132_1073 307
546 3300053150 Ga0500603_000033 Ga0500603_000033_8327_9274 307
547 3300053153 Ga0500616_0000166 Ga0500616_0000166_22465_23421 307
548 3300053159 Ga0500630_000238 Ga0500630_000238_8858_9805 307
549 3300053163 Ga0500639_000010 Ga0500639_000010_118224_119171 307
550 3300053163 Ga0500639_009289 Ga0500639_009289_1498_2427 307
551 3300053177 Ga0500636_0050907 Ga0500636_0050907_1315_2256 307
552 3300053177 Ga0500636_0058941 Ga0500636_0058941_294_1235 307
553 iso_pu_bacteria 2511231028 2511394424 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03976

PPK2

Polyphosphate kinase 2 (PPK2)

47

287

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bmm-assembly2.cif.gz_C crystal structure of polyphosphate kinase 2 from deinococcus radiodurans in apo form 0.9579 13 283
5lcd-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber bound to amp 0.9488 14 281
5o6m-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9472 14 281
5o6k-assembly1.cif.gz_D structure of polyphosphate kinase from meiothermus ruber n121d 0.9433 19 283
5o6m-assembly1.cif.gz_C structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9433 19 283
ID Description Score Start End Superfamily
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9594 13 283 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9415 19 284 3.40.50.300
3czpB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.934 30 274 3.40.50.300
6angA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.924 7 299 3.40.50.300
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9207 13 283 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A401U1Q0-F1-model_v4 Polyphosphate kinase-2-related domain-containing protein 0.9784 79 242 GO:0006797
GO:0016776
AF-A0A2V8LTK9-F1-model_v4 Polyphosphate kinase-2-related domain-containing protein 0.9738 25 209 GO:0006797
GO:0016776
AF-A0A401U1Q0-F1-model_v4 Polyphosphate kinase-2-related domain-containing protein 0.9726 79 242 GO:0006797
GO:0016776
AF-A0A7X6U1E1-F1-model_v4 Polyphosphate kinase 2 family protein 0.9724 13 273 GO:0006797
GO:0008976
AF-A0A7W1CCM5-F1-model_v4 Polyphosphate kinase 2 family protein 0.9722 46 297 GO:0006797
GO:0008976

Feature Viewer

pLDDT pTM Quality
88.75 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map