metagRoot

F462907

General Info

Members	Datasets	Scaffolds	Average Seq Length
553	268	1104	163

Family's Representative Sequence

Representative Sequence	3300046674\|Ga0495588_0270713\|Ga0495588_0270713_191_769
Length	192
Sequence	MLSITLQKEILCKALSEKVKLMHASVSNHTSAQPSTHGHLADITAGNEYLAFKLGDEEYGIDILKVQEIRGYENVTRIANAPEFIKGVINLRGIIVPIVDMRIKFNLGEPSYDQFTVVIILSIAGRVMGMVVDSVSDVTTLQPDQIRPAPQMGTALNTDYLVGLGTLEERMLILLDIERLMSSAEMGLLQQV

Samples

	Sample ID	Description	Type	Environment
1	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
4	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
5	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
6	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
7	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
8	3300003163	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
9	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
10	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
11	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
12	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
13	3300003544	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
14	3300003574	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
15	3300003575	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
16	3300003577	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
17	3300003613	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
18	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
19	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
20	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
21	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
22	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
23	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
24	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
25	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
26	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
27	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
28	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
29	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
30	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
31	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
32	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
35	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
36	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
37	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
38	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
39	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
40	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
41	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
42	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
43	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
44	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
45	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
46	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
47	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
48	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
49	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
50	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
51	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
52	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
53	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
54	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
55	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
56	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
57	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
58	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
59	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
60	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
61	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
62	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
63	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
64	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
65	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
66	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
67	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
68	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
69	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
70	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
71	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
72	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
73	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
74	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
75	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
76	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
77	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
78	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
79	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
80	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
81	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
92	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
93	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
94	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
95	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
96	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
97	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
98	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
99	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
100	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
101	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
102	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
103	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
104	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
105	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
106	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
107	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
108	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
109	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
110	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
111	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
112	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
113	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
114	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
115	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
116	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
117	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
118	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
119	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
120	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
121	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
122	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
123	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
124	3300044669	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E	Metagenome	Unclassified
125	3300044672	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E	Metagenome	Unclassified
126	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
127	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
128	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
129	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
130	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
131	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
132	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
133	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
134	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
135	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
136	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
137	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
138	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
139	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
140	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
141	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
142	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
143	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
144	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
145	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
146	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
147	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
148	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
149	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
150	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
151	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
152	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
153	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
154	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
155	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
156	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
157	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
158	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
159	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
160	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
161	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
162	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
163	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
164	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
165	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
166	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
167	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
168	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
169	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
170	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
171	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
172	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
173	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
174	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
175	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
176	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
177	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
178	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
179	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
180	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
181	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
182	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
183	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
184	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
185	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
186	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
187	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
188	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
189	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
190	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
191	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
192	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
193	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
194	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
195	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
196	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
197	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
198	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
199	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
200	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
201	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
202	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
203	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
204	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
205	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
206	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
207	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
208	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
209	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
210	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
211	3300049127	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
212	3300049162	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
213	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
214	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
215	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
216	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
217	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
218	3300049658	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought	Metagenome	Rhizosphere
219	3300049659	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control	Metagenome	Rhizosphere
220	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
221	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
222	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
223	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
224	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
225	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
226	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
227	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
228	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
229	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
230	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
231	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
232	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
233	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
234	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
235	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
236	3300059491	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
237	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
238	3300059503	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
239	3300059504	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
240	3300059511	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
241	3300059641	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
242	3300059642	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
243	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
244	3300059645	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
245	3300059649	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
246	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
247	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
248	2511231026	Herbaspirillum sp. YR522	Isolate	Rhizosphere
249	2526164713	Paraburkholderia phenoliruptrix JPY366	Isolate	Nodule
250	2547132512	Azospira oryzae 6a3	Isolate	Unclassified
251	2643221603	Noviherbaspirillum sp. Root189	Isolate	Unclassified
252	2643221645	Massilia sp. Root351	Isolate	Unclassified
253	2643221664	Massilia sp. Root418	Isolate	Unclassified
254	2738541280	Massilia sp. GV090	Isolate	Unclassified
255	2738541297	Duganella sp. GV083	Isolate	Unclassified
256	2738541300	Massilia sp. GV016	Isolate	Unclassified
257	2738541357	Duganella sp. GV053	Isolate	Unclassified
258	2738543003	Duganella sp. GV066	Isolate	Unclassified
259	2738543018	Massilia sp. GV045	Isolate	Unclassified
260	2738543026	Duganella sp. GV089	Isolate	Unclassified
261	2738543029	Duganella sp. GV039	Isolate	Unclassified
262	2738543030	Massilia sp. GV097	Isolate	Unclassified
263	2821131069	Duganella sp. 1224	Isolate	Unclassified
264	2857553236	Duganella sp. R-74557	Isolate	Unclassified
265	2857564685	Duganella sp. R-74599	Isolate	Unclassified
266	2904424332	Duganella sp. 1411	Isolate	Rhizosphere
267	2919476304	Duganella sp. 3397	Isolate	Unclassified
268	8057160832	Larsenimonas rhizosphaerae GH2-1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	91.32
Metatranscriptomes	4.7
Isolates	3.98

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	22.24
Nodule	1.08
Rhizoplane	3.07
Rhizosphere	65.64
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0495588_0270713	3300046674	Bacteria	895
2	SwRhRL2b_contig_1461477	2162886007	Bacteria	3135
3	JGI25154J39366_1001906	3300002738	Bacteria	6308
4	JGI25154J39366_1002842	3300002738	Bacteria	4093
5	JGI25158J39367_1014369	3300002739	Bacteria	1024
6	JGI25152J39213_1000005	3300002773	Bacteria	160019
7	JGI25152J39213_1000395	3300002773	Bacteria	26530
8	JGI25152J39213_1001135	3300002773	Bacteria	12394
9	JGI25150J39212_1000257	3300002774	Bacteria	28157
10	JGI25150J39212_1003081	3300002774	Bacteria	3987
11	JGI25159J45721_1001262	3300002987	Bacteria	10675
12	JGI25159J45721_1002087	3300002987	Bacteria	7852
13	JGI25159J45721_1006008	3300002987	Bacteria	3710
14	JGI25159J45721_1009997	3300002987	Bacteria	2456
15	JGI25159J45721_1011209	3300002987	Bacteria	2219
16	JGI25159J45721_1013151	3300002987	Bacteria	1932
17	Ga0006759J45824_1040057	3300003163	Bacteria	741
18	JGI25153J46596_10005220	3300003215	Bacteria	6836
19	JGI25153J46596_10012789	3300003215	Bacteria	3595
20	JGI25153J46596_10021873	3300003215	Bacteria	2374
21	rootL2_10025949	3300003322	Bacteria	1768
22	rootL2_10163565	3300003322	Bacteria	1140
23	rootL2_10172118	3300003322	Bacteria	4219
24	JGI25160J50197_1006456	3300003354	Bacteria	4745
25	JGI25160J50197_1015450	3300003354	Bacteria	2503
26	JGI25161J50226_1002529	3300003374	Bacteria	4636
27	JGI25161J50226_1008082	3300003374	Bacteria	1664
28	Ga0007417J51691_1033061	3300003544	Bacteria	792
29	Ga0007417J51691_1092036	3300003544	Bacteria	655
30	Ga0007410J51695_1032984	3300003574	Bacteria	800
31	Ga0007410J51695_1075106	3300003574	Bacteria	539
32	Ga0007409J51694_1018473	3300003575	Bacteria	820
33	Ga0007416J51690_1023281	3300003577	Bacteria	799
34	Ga0007415J51800_128042	3300003613	Bacteria	660
35	Ga0032354_1035241	3300003693	Bacteria	805
36	Ga0055526_1000030	3300003771	Bacteria	143833
37	Ga0055526_1000299	3300003771	Bacteria	41248
38	Ga0055526_1004222	3300003771	Bacteria	8724
39	Ga0055526_1021791	3300003771	Bacteria	2212
40	Ga0055526_1054898	3300003771	Bacteria	882
41	Ga0055537_1000154	3300003773	Bacteria	51753
42	Ga0055537_1000352	3300003773	Bacteria	31239
43	Ga0055537_1009364	3300003773	Bacteria	2170
44	Ga0055537_1011579	3300003773	Bacteria	1777
45	Ga0055537_1021026	3300003773	Bacteria	978
46	Ga0055524_1000021	3300003775	Bacteria	227578
47	Ga0055524_1000099	3300003775	Bacteria	107171
48	Ga0055524_1000187	3300003775	Bacteria	68927
49	Ga0055524_1004400	3300003775	Bacteria	6499
50	Ga0055524_1004548	3300003775	Bacteria	6384
51	Ga0055524_1005250	3300003775	Bacteria	5817
52	Ga0055524_1006690	3300003775	Bacteria	4979
53	Ga0055524_1010226	3300003775	Bacteria	3750
54	Ga0055524_1054133	3300003775	Bacteria	882
55	Ga0055534_1000513	3300003784	Bacteria	20944
56	Ga0055534_1002618	3300003784	Bacteria	6131
57	Ga0055534_1002635	3300003784	Bacteria	6093
58	Ga0055528_1000059	3300003790	Bacteria	87695
59	Ga0055528_1000134	3300003790	Bacteria	60071
60	Ga0055528_1004752	3300003790	Bacteria	6473
61	Ga0055530_10012808	3300003791	Bacteria	2902
62	Ga0055530_10024424	3300003791	Bacteria	1713
63	Ga0055530_10037340	3300003791	Bacteria	1216
64	Ga0055531_10013680	3300003794	Bacteria	3721
65	Ga0055543_1002545	3300004625	Bacteria	5950
66	Ga0055543_1002848	3300004625	Bacteria	5454
67	Ga0055543_1003435	3300004625	Bacteria	4682
68	Ga0065165_1000005	3300005262	Bacteria	370361
69	Ga0065165_1000055	3300005262	Bacteria	187003
70	Ga0065165_1000161	3300005262	Bacteria	116828
71	Ga0065165_1008738	3300005262	Bacteria	4674
72	Ga0065165_1023935	3300005262	Bacteria	2061
73	Ga0065165_1076394	3300005262	Bacteria	878
74	Ga0065704_10080069	3300005289	Bacteria	4017
75	Ga0065704_10294778	3300005289	Bacteria	842
76	Ga0070687_100006487	3300005343	Bacteria	4798
77	Ga0070661_100352170	3300005344	Bacteria	1155
78	Ga0070701_10817497	3300005438	Bacteria	637
79	Ga0070663_101003553	3300005455	Bacteria	726
80	Ga0070662_100243355	3300005457	Bacteria	1443
81	Ga0070698_100236037	3300005471	Bacteria	1762
82	Ga0070698_100264333	3300005471	Bacteria	1652
83	Ga0070704_100138856	3300005549	Bacteria	1895
84	Ga0070664_100056867	3300005564	Bacteria	3324
85	Ga0068854_101790607	3300005578	Bacteria	563
86	Ga0075363_100057244	3300006048	Bacteria	2091
87	Ga0075432_10015104	3300006058	Bacteria	2632
88	Ga0070712_100031691	3300006175	Bacteria	3564
89	Ga0075362_10005190	3300006177	Bacteria	4746
90	Ga0075430_100007348	3300006846	Bacteria	9310
91	Ga0075430_100010695	3300006846	Bacteria	7776
92	Ga0075431_100000307	3300006847	Bacteria	38506
93	Ga0075431_100003813	3300006847	Bacteria	14657
94	Ga0075433_10058639	3300006852	Bacteria	3367
95	Ga0075429_100075130	3300006880	Bacteria	2944
96	Ga0079104_1009630	3300006946	Bacteria	3258
97	Ga0079104_1010273	3300006946	Bacteria	3096
98	Ga0099826_10000002	3300006948	Bacteria	1125830
99	Ga0075435_101364271	3300007076	Bacteria	621
100	Ga0105244_10000853	3300009036	Bacteria	25698
101	Ga0105244_10001358	3300009036	Bacteria	19911
102	Ga0105242_11322444	3300009176	Bacteria	745
103	Ga0105237_11578017	3300009545	Bacteria	663
104	Ga0105239_10684948	3300010375	Bacteria	1172
105	Ga0157371_10484893	3300013102	Bacteria	912
106	Ga0157371_10850636	3300013102	Bacteria	690
107	Ga0157370_10265893	3300013104	Bacteria	1585
108	Ga0163162_10150722	3300013306	Bacteria	2443
109	Ga0157372_10158298	3300013307	Bacteria	2617
110	Ga0157376_10095410	3300014969	Bacteria	2586
111	Ga0182006_1000026	3300015261	Bacteria	253543
112	Ga0182005_1000007	3300015265	Bacteria	490994
113	Ga0183362_10001	3300015683	Bacteria	2046624
114	Ga0163161_10013042	3300017792	Bacteria	5776
115	Ga0206356_10656751	3300020070	Bacteria	646
116	Ga0213872_10000028	3300021361	Bacteria	148766
117	Ga0213872_10006430	3300021361	Bacteria	5898
118	Ga0213872_10022306	3300021361	Bacteria	2915
119	Ga0213872_10038434	3300021361	Bacteria	2184
120	Ga0213872_10042049	3300021361	Bacteria	2084
121	Ga0209436_100351	3300025208	Bacteria	20779
122	Ga0209436_103001	3300025208	Bacteria	4686
123	Ga0209436_104886	3300025208	Bacteria	3210
124	Ga0209436_109138	3300025208	Bacteria	1913
125	Ga0209436_113812	3300025208	Bacteria	1306
126	Ga0209437_107534	3300025233	Bacteria	1766
127	Ga0207425_1000001	3300025245	Bacteria	2525432
128	Ga0207425_1000009	3300025245	Bacteria	593135
129	Ga0207425_1000339	3300025245	Bacteria	32468
130	Ga0209646_1000010	3300025246	Bacteria	573803
131	Ga0209646_1000613	3300025246	Bacteria	13729
132	Ga0209026_1003538	3300025250	Bacteria	5064
133	Ga0209026_1004793	3300025250	Bacteria	3865
134	Ga0209026_1005027	3300025250	Bacteria	3697
135	Ga0209129_1000001	3300025258	Bacteria	1452436
136	Ga0209129_1000003	3300025258	Bacteria	903689
137	Ga0209129_1000061	3300025258	Bacteria	246061
138	Ga0209565_1000057	3300025263	Bacteria	196908
139	Ga0209565_1000184	3300025263	Bacteria	76638
140	Ga0209565_1000765	3300025263	Bacteria	18855
141	Ga0209565_1010721	3300025263	Bacteria	2263
142	Ga0209565_1033708	3300025263	Bacteria	985
143	Ga0209673_1000029	3300025273	Bacteria	351978
144	Ga0209673_1000051	3300025273	Bacteria	282161
145	Ga0209673_1013647	3300025273	Bacteria	3194
146	Ga0209130_1000084	3300025284	Bacteria	160070
147	Ga0209130_1000091	3300025284	Bacteria	149502
148	Ga0209130_1000175	3300025284	Bacteria	91205
149	Ga0209130_1002422	3300025284	Bacteria	9393
150	Ga0209130_1003652	3300025284	Bacteria	6378
151	Ga0209675_1000019	3300025291	Bacteria	351950
152	Ga0209675_1000027	3300025291	Bacteria	282175
153	Ga0209675_1001211	3300025291	Bacteria	15650
154	Ga0209675_1002713	3300025291	Bacteria	8882
155	Ga0209675_1002714	3300025291	Bacteria	8882
156	Ga0209564_1000010	3300025295	Bacteria	885399
157	Ga0209564_1000068	3300025295	Bacteria	311171
158	Ga0209564_1000094	3300025295	Bacteria	243176
159	Ga0209564_1000889	3300025295	Bacteria	39484
160	Ga0209564_1005384	3300025295	Bacteria	7334
161	Ga0209564_1033786	3300025295	Bacteria	1514
162	Ga0209758_1000041	3300025297	Bacteria	410328
163	Ga0209758_1000073	3300025297	Bacteria	276262
164	Ga0209758_1000101	3300025297	Bacteria	225913
165	Ga0209050_1000046	3300025298	Bacteria	386466
166	Ga0209050_1000442	3300025298	Bacteria	75310
167	Ga0209050_1013122	3300025298	Bacteria	3717
168	Ga0209256_1000018	3300025299	Bacteria	568467
169	Ga0209256_1000044	3300025299	Bacteria	337264
170	Ga0209256_1000068	3300025299	Bacteria	246064
171	Ga0209256_1000116	3300025299	Bacteria	169876
172	Ga0209256_1000145	3300025299	Bacteria	150609
173	Ga0209256_1000944	3300025299	Bacteria	35230
174	Ga0209256_1000988	3300025299	Bacteria	34026
175	Ga0209256_1001504	3300025299	Bacteria	23632
176	Ga0209256_1005880	3300025299	Bacteria	6797
177	Ga0207426_1002522	3300025302	Bacteria	11488
178	Ga0207426_1049750	3300025302	Bacteria	1253
179	Ga0209051_1084955	3300025303	Bacteria	899
180	Ga0209257_1000068	3300025304	Bacteria	341291
181	Ga0207655_1003094	3300025728	Bacteria	12643
182	Ga0207662_10049387	3300025918	Bacteria	2496
183	Ga0207657_10565395	3300025919	Bacteria	889
184	Ga0207650_10752491	3300025925	Bacteria	825
185	Ga0207687_10328281	3300025927	Bacteria	1240
186	Ga0207700_10883835	3300025928	Bacteria	800
187	Ga0207706_10189257	3300025933	Bacteria	1807
188	Ga0207679_10285849	3300025945	Bacteria	1416
189	Ga0207678_10221123	3300026067	Bacteria	1621
190	Ga0207678_10988778	3300026067	Bacteria	745
191	Ga0207641_10450365	3300026088	Bacteria	1244
192	Ga0209281_1007000	3300027111	Bacteria	2862
193	Ga0209282_1000001	3300027666	Bacteria	2450367
194	Ga0207428_10778334	3300027907	Bacteria	681
195	Ga0316181_1044356	3300030744	Bacteria	781
196	Ga0316182_1264385	3300030745	Bacteria	1996
197	Ga0265331_10014718	3300031250	Bacteria	4155
198	Ga0265327_10036265	3300031251	Bacteria	2713
199	Ga0307408_100000981	3300031548	Bacteria	22068
200	Ga0307408_100002767	3300031548	Bacteria	12179
201	Ga0265314_10026912	3300031711	Bacteria	4315
202	Ga0265314_10066364	3300031711	Bacteria	2434
203	Ga0307405_10537483	3300031731	Bacteria	943
204	Ga0307413_10579002	3300031824	Bacteria	915
205	Ga0307518_10220327	3300031838	Bacteria	1239
206	Ga0307412_10816818	3300031911	Bacteria	811
207	Ga0307412_10937376	3300031911	Bacteria	761
208	Ga0307409_100954037	3300031995	Bacteria	874
209	Ga0307416_100077240	3300032002	Bacteria	2796
210	Ga0307416_100153247	3300032002	Bacteria	2117
211	Ga0307411_10488768	3300032005	Bacteria	1038
212	Ga0307415_100163703	3300032126	Bacteria	1727
213	Ga0373925_0456418	3300037068	Bacteria	1047
214	Ga0395899_0000956	3300037312	Bacteria	27045
215	Ga0395899_0001859	3300037312	Bacteria	17459
216	Ga0395899_0005685	3300037312	Bacteria	9681
217	Ga0395899_0010146	3300037312	Bacteria	7222
218	Ga0395899_0013974	3300037312	Bacteria	6131
219	Ga0395899_0016969	3300037312	Bacteria	5549
220	Ga0395899_0169586	3300037312	Bacteria	1537
221	Ga0395899_0446244	3300037312	Bacteria	848
222	Ga0395899_0677771	3300037312	Bacteria	649
223	Ga0395900_0002911	3300037418	Bacteria	18649
224	Ga0395900_0012846	3300037418	Bacteria	8556
225	Ga0395900_0055358	3300037418	Bacteria	4085
226	Ga0395900_0256585	3300037418	Bacteria	1747
227	Ga0395898_0014005	3300037466	Bacteria	8241
228	Ga0395898_0294748	3300037466	Bacteria	1547
229	Ga0395898_0350813	3300037466	Bacteria	1407
230	Ga0395905_0003076	3300037471	Bacteria	18042
231	Ga0395905_0008279	3300037471	Bacteria	10265
232	Ga0395905_0011242	3300037471	Bacteria	8654
233	Ga0395905_0014393	3300037471	Bacteria	7555
234	Ga0395905_0254933	3300037471	Bacteria	1639
235	Ga0395905_0307657	3300037471	Bacteria	1473
236	Ga0395905_0548908	3300037471	Bacteria	1057
237	Ga0395905_0726369	3300037471	Bacteria	895
238	Ga0395901_0000054	3300038443	Bacteria	160505
239	Ga0395901_0136176	3300038443	Bacteria	2581
240	Ga0395901_0173048	3300038443	Bacteria	2265
241	Ga0395901_0186978	3300038443	Bacteria	2172
242	Ga0395901_0391537	3300038443	Bacteria	1429
243	Ga0436361_0094167	3300039447	Bacteria	4739
244	Ga0436361_0239828	3300039447	Bacteria	7791
245	Ga0436361_0415428	3300039447	Bacteria	27224
246	Ga0436361_0454653	3300039447	Bacteria	5158
247	Ga0436361_0616428	3300039447	Bacteria	15855
248	Ga0436361_0751503	3300039447	Bacteria	33769
249	Ga0451789_1340800	3300041443	Bacteria	621
250	Ga0451853_0633733	3300041512	Bacteria	711
251	Ga0439441_177702	3300042001	Bacteria	511
252	Ga0439448_0003458	3300042005	Bacteria	4372
253	Ga0450906_048048	3300042145	Bacteria	753
254	Ga0439446_0109307	3300042156	Bacteria	881
255	Ga0451577_0004580	3300042876	Bacteria	14527
256	Ga0451577_0011575	3300042876	Bacteria	8338
257	Ga0451577_0011766	3300042876	Bacteria	8259
258	Ga0451577_0171947	3300042876	Bacteria	1952
259	Ga0451577_0303962	3300042876	Bacteria	1445
260	Ga0466969_0549737	3300044656	Bacteria	528
261	Ga0466972_0000029	3300044658	Bacteria	165236
262	Ga0466972_0000041	3300044658	Bacteria	132242
263	Ga0466972_0077596	3300044658	Bacteria	1582
264	Ga0466972_0105427	3300044658	Bacteria	1333
265	Ga0466981_0367065	3300044669	Bacteria	870
266	Ga0466982_0067121	3300044672	Bacteria	2213
267	Ga0453683_0000063	3300044673	Bacteria	175298
268	Ga0466965_0005670	3300044683	Bacteria	5634
269	Ga0466965_0029673	3300044683	Bacteria	2662
270	Ga0466965_0062996	3300044683	Bacteria	1855
271	Ga0466965_0260223	3300044683	Bacteria	932
272	Ga0466965_0632568	3300044683	Bacteria	610
273	Ga0466966_0019240	3300044684	Bacteria	4494
274	Ga0466964_0004963	3300044706	Bacteria	4917
275	Ga0466964_0320689	3300044706	Bacteria	787
276	Ga0453684_0000140	3300044712	Bacteria	319864
277	Ga0453684_0001176	3300044712	Bacteria	81199
278	Ga0453684_0175448	3300044712	Bacteria	2521
279	Ga0453684_0333104	3300044712	Bacteria	1716
280	Ga0453684_0491789	3300044712	Bacteria	1360
281	Ga0453684_0524448	3300044712	Bacteria	1308
282	Ga0466968_0037791	3300044735	Bacteria	2027
283	Ga0466968_0094557	3300044735	Bacteria	1328
284	Ga0466970_0027859	3300044765	Bacteria	2966
285	Ga0466970_0028613	3300044765	Bacteria	2930
286	Ga0466957_0066326	3300044842	Bacteria	2225
287	Ga0466959_0010294	3300045049	Bacteria	6679
288	Ga0466959_0064752	3300045049	Bacteria	2654
289	Ga0451576_0012875	3300045051	Bacteria	9377
290	Ga0451576_0341803	3300045051	Bacteria	1567
291	Ga0451576_0458082	3300045051	Bacteria	1339
292	Ga0495617_000041	3300046452	Bacteria	124027
293	Ga0495617_031756	3300046452	Bacteria	1772
294	Ga0495627_000007	3300046453	Bacteria	575915
295	Ga0495627_013592	3300046453	Bacteria	2861
296	Ga0495603_0038000	3300046455	Bacteria	2888
297	Ga0495603_0074979	3300046455	Bacteria	1986
298	Ga0495590_0053476	3300046457	Bacteria	1410
299	Ga0495629_0150432	3300046459	Bacteria	1618
300	Ga0495638_0001950	3300046460	Bacteria	17693
301	Ga0495653_0000002	3300046463	Bacteria	507262
302	Ga0495650_0000118	3300046471	Bacteria	187358
303	Ga0495650_0000156	3300046471	Bacteria	155338
304	Ga0495650_0000283	3300046471	Bacteria	96503
305	Ga0495650_0012570	3300046471	Bacteria	4545
306	Ga0495582_0134313	3300046473	Bacteria	1399
307	Ga0495605_0000598	3300046474	Bacteria	28458
308	Ga0495605_0033838	3300046474	Bacteria	2592
309	Ga0495584_0004974	3300046491	Bacteria	7082
310	Ga0495584_0010756	3300046491	Bacteria	4699
311	Ga0495584_0027987	3300046491	Bacteria	2855
312	Ga0495584_0073511	3300046491	Bacteria	1718
313	Ga0495585_0007815	3300046492	Bacteria	6509
314	Ga0495585_0085860	3300046492	Bacteria	1700
315	Ga0495594_0008008	3300046499	Bacteria	5434
316	Ga0495594_0029645	3300046499	Bacteria	2958
317	Ga0495607_0002847	3300046501	Bacteria	13713
318	Ga0495607_0006823	3300046501	Bacteria	7967
319	Ga0495607_0029696	3300046501	Bacteria	3363
320	Ga0495607_0091753	3300046501	Bacteria	1644
321	Ga0495607_0105146	3300046501	Bacteria	1505
322	Ga0495607_0134272	3300046501	Bacteria	1283
323	Ga0495583_0000035	3300046506	Bacteria	246849
324	Ga0495583_0001445	3300046506	Bacteria	24126
325	Ga0495583_0010646	3300046506	Bacteria	5346
326	Ga0495606_0000703	3300046507	Bacteria	51821
327	Ga0495606_0001147	3300046507	Bacteria	37572
328	Ga0495606_0009682	3300046507	Bacteria	8110
329	Ga0495606_0010643	3300046507	Bacteria	7606
330	Ga0495606_0040641	3300046507	Bacteria	3125
331	Ga0495610_0000003	3300046512	Bacteria	1203910
332	Ga0495610_0040601	3300046512	Bacteria	2343
333	Ga0495610_0076921	3300046512	Bacteria	1542
334	Ga0495616_0000343	3300046513	Bacteria	36983
335	Ga0495616_0001789	3300046513	Bacteria	14612
336	Ga0495616_0004098	3300046513	Bacteria	9244
337	Ga0495616_0057001	3300046513	Bacteria	1927
338	Ga0495628_0588307	3300046516	Bacteria	796
339	Ga0495631_0009707	3300046518	Bacteria	4798
340	Ga0495637_0000482	3300046520	Bacteria	29077
341	Ga0495637_0043530	3300046520	Bacteria	1915
342	Ga0495637_0058860	3300046520	Bacteria	1582
343	Ga0495643_0001637	3300046522	Bacteria	19768
344	Ga0495643_0038484	3300046522	Bacteria	2619
345	Ga0495648_0013512	3300046524	Bacteria	6028
346	Ga0495648_0031766	3300046524	Bacteria	3473
347	Ga0495648_0084481	3300046524	Bacteria	1796
348	Ga0495648_0106432	3300046524	Bacteria	1535
349	Ga0495648_0312925	3300046524	Bacteria	731
350	Ga0495663_0217746	3300046525	Bacteria	670
351	Ga0495666_0112598	3300046526	Bacteria	1277
352	Ga0495642_0009421	3300046528	Bacteria	3739
353	Ga0495654_0000038	3300046530	Bacteria	185693
354	Ga0495654_0017997	3300046530	Bacteria	3707
355	Ga0495654_0082792	3300046530	Bacteria	1501
356	Ga0495598_0015814	3300046537	Bacteria	1913
357	Ga0495609_0000636	3300046538	Bacteria	27314
358	Ga0495609_0000908	3300046538	Bacteria	21503
359	Ga0495609_0003925	3300046538	Bacteria	8335
360	Ga0495609_0006138	3300046538	Bacteria	6178
361	Ga0495621_0029559	3300046539	Bacteria	1869
362	Ga0495597_0010396	3300046542	Bacteria	4550
363	Ga0495597_0114218	3300046542	Bacteria	1130
364	Ga0495622_0000013	3300046557	Bacteria	186778
365	Ga0495622_0052526	3300046557	Bacteria	1891
366	Ga0495633_0016870	3300046558	Bacteria	3749
367	Ga0495633_0135812	3300046558	Bacteria	1137
368	Ga0495633_0138257	3300046558	Bacteria	1126
369	Ga0495633_0155768	3300046558	Bacteria	1054
370	Ga0495633_0257139	3300046558	Bacteria	796
371	Ga0495656_0165108	3300046615	Bacteria	1078
372	Ga0495668_0000006	3300046616	Bacteria	553404
373	Ga0495668_0000029	3300046616	Bacteria	279128
374	Ga0495668_0000048	3300046616	Bacteria	217867
375	Ga0495668_0002401	3300046616	Bacteria	15518
376	Ga0495668_0011995	3300046616	Bacteria	5159
377	Ga0495668_0020180	3300046616	Bacteria	3833
378	Ga0495611_0007976	3300046648	Bacteria	4497
379	Ga0495611_0039554	3300046648	Bacteria	2099
380	Ga0495625_0009364	3300046660	Bacteria	8201
381	Ga0495625_0023387	3300046660	Bacteria	4720
382	Ga0495625_0048447	3300046660	Bacteria	3059
383	Ga0495625_0048663	3300046660	Bacteria	3051
384	Ga0495625_0057969	3300046660	Bacteria	2753
385	Ga0495625_0127931	3300046660	Bacteria	1723
386	Ga0495625_0432950	3300046660	Bacteria	816
387	Ga0495659_0000131	3300046664	Bacteria	32964
388	Ga0495659_0010583	3300046664	Bacteria	2964
389	Ga0495659_0010749	3300046664	Bacteria	2944
390	Ga0495659_0018249	3300046664	Bacteria	2335
391	Ga0495661_0024496	3300046665	Bacteria	3906
392	Ga0495661_0044005	3300046665	Bacteria	2740
393	Ga0495661_0048407	3300046665	Bacteria	2583
394	Ga0495661_0053181	3300046665	Bacteria	2436
395	Ga0495661_0412569	3300046665	Bacteria	655
396	Ga0495588_0125310	3300046674	Bacteria	1354
397	Ga0495669_0000252	3300046684	Bacteria	31128
398	Ga0495669_0000898	3300046684	Bacteria	12510
399	Ga0495670_0049128	3300046691	Bacteria	2110
400	Ga0495671_0000001	3300046692	Bacteria	1169494
401	Ga0495671_0000424	3300046692	Bacteria	33646
402	Ga0495671_0015429	3300046692	Bacteria	4091
403	Ga0495671_0016794	3300046692	Bacteria	3903
404	Ga0495649_0001756	3300046694	Bacteria	15980
405	Ga0495649_0016067	3300046694	Bacteria	4249
406	Ga0495649_0114952	3300046694	Bacteria	1425
407	Ga0495649_0220491	3300046694	Bacteria	981
408	Ga0495589_0176648	3300046794	Bacteria	1014
409	Ga0495660_0008242	3300046810	Bacteria	6104
410	Ga0495660_0009445	3300046810	Bacteria	5686
411	Ga0495660_0013668	3300046810	Bacteria	4706
412	Ga0495660_0038874	3300046810	Bacteria	2644
413	Ga0495660_0106628	3300046810	Bacteria	1435
414	Ga0495636_0000811	3300047318	Bacteria	11512
415	Ga0495636_0002048	3300047318	Bacteria	7737
416	Ga0495636_0005914	3300047318	Bacteria	4800
417	Ga0495636_0100429	3300047318	Bacteria	1264
418	Ga0495674_0080093	3300047319	Bacteria	2803
419	Ga0495672_0000973	3300047320	Bacteria	29705
420	Ga0495672_0006177	3300047320	Bacteria	9342
421	Ga0495672_0011872	3300047320	Bacteria	6114
422	Ga0495676_0017575	3300047321	Bacteria	6319
423	Ga0495683_0000952	3300047323	Bacteria	20358
424	Ga0495687_000148	3300047443	Bacteria	106947
425	Ga0495687_002762	3300047443	Bacteria	13602
426	Ga0495687_016671	3300047443	Bacteria	3689
427	Ga0495687_042465	3300047443	Bacteria	1986
428	Ga0495687_153366	3300047443	Bacteria	784
429	Ga0495677_0004720	3300047445	Bacteria	5196
430	Ga0495677_0006369	3300047445	Bacteria	4458
431	Ga0495677_0010235	3300047445	Bacteria	3448
432	Ga0495679_006853	3300047446	Bacteria	4839
433	Ga0495679_019788	3300047446	Bacteria	2357
434	Ga0495679_037484	3300047446	Bacteria	1524
435	Ga0495685_000077	3300047447	Bacteria	37238
436	Ga0495685_009695	3300047447	Bacteria	3222
437	Ga0495685_019032	3300047447	Bacteria	2357
438	Ga0495685_051116	3300047447	Bacteria	1402
439	Ga0495685_073847	3300047447	Bacteria	1140
440	Ga0495673_0000100	3300047469	Bacteria	173962
441	Ga0495673_0057567	3300047469	Bacteria	1678
442	Ga0495681_0002968	3300047470	Bacteria	11956
443	Ga0495681_0002980	3300047470	Bacteria	11924
444	Ga0495681_0008901	3300047470	Bacteria	6236
445	Ga0495681_0201572	3300047470	Bacteria	807
446	Ga0495686_0000874	3300047472	Bacteria	38436
447	Ga0495686_0001479	3300047472	Bacteria	25538
448	Ga0495686_0066205	3300047472	Bacteria	2233
449	Ga0495686_0097101	3300047472	Bacteria	1782
450	Ga0495626_0006135	3300048091	Bacteria	6889
451	Ga0495626_0024982	3300048091	Bacteria	2924
452	Ga0496101_0166254	3300048904	Bacteria	1694
453	Ga0496102_0020653	3300048905	Bacteria	5820
454	Ga0496102_0077882	3300048905	Bacteria	3051
455	Ga0496102_1124444	3300048905	Bacteria	705
456	Ga0496103_0003038	3300048906	Bacteria	10335
457	Ga0496103_0006660	3300048906	Bacteria	6896
458	Ga0496106_0236372	3300048909	Bacteria	1460
459	Ga0496109_0358556	3300048912	Bacteria	1378
460	Ga0496110_0441884	3300048913	Bacteria	1185
461	Ga0496110_0754295	3300048913	Bacteria	876
462	Ga0496111_0109096	3300048914	Bacteria	2038
463	Ga0496114_0127806	3300048917	Bacteria	2192
464	Ga0496114_0187535	3300048917	Bacteria	1808
465	Ga0496114_0372836	3300048917	Bacteria	1263
466	Ga0496114_0399533	3300048917	Bacteria	1217
467	Ga0496115_0361667	3300048918	Bacteria	1182
468	Ga0496118_0523900	3300048921	Bacteria	584
469	Ga0496120_0109001	3300048923	Bacteria	1450
470	Ga0496121_0248997	3300048924	Bacteria	1233
471	Ga0496122_0011024	3300048925	Bacteria	9233
472	Ga0496122_0054161	3300048925	Bacteria	3016
473	Ga0496122_0076790	3300048925	Bacteria	2349
474	Ga0496123_0006679	3300048926	Bacteria	11119
475	Ga0496124_0141048	3300048927	Bacteria	1902
476	Ga0496124_0493481	3300048927	Bacteria	823
477	Ga0496125_0000542	3300048928	Bacteria	64978
478	Ga0496125_0002429	3300048928	Bacteria	24227
479	Ga0496126_0017336	3300048929	Bacteria	7178
480	Ga0501306_057942	3300049127	Bacteria	633
481	Ga0501307_017480	3300049162	Bacteria	904
482	Ga0495678_000004	3300049459	Bacteria	532920
483	Ga0495678_001499	3300049459	Bacteria	18192
484	Ga0495678_024887	3300049459	Bacteria	2578
485	Ga0495678_052314	3300049459	Bacteria	1573
486	Ga0495682_0000869	3300049460	Bacteria	18741
487	Ga0495682_0008079	3300049460	Bacteria	4157
488	Ga0501032_0001205	3300049569	Bacteria	20672
489	Ga0501038_0632078	3300049574	Bacteria	807
490	Ga0501071_1040454	3300049587	Bacteria	633
491	Ga0501211_004952	3300049658	Bacteria	1344
492	Ga0501214_011093	3300049659	Bacteria	1003
493	Ga0501222_010742	3300049662	Bacteria	1208
494	Ga0501227_002178	3300049665	Bacteria	4331
495	Ga0501227_007019	3300049665	Bacteria	2412
496	Ga0501227_010384	3300049665	Bacteria	2018
497	Ga0501238_008241	3300049671	Bacteria	1367
498	Ga0501249_002908	3300049679	Bacteria	3444
499	Ga0501249_012616	3300049679	Bacteria	1787
500	Ga0501269_000404	3300049766	Bacteria	10033
501	Ga0501269_000424	3300049766	Bacteria	9503
502	Ga0501279_000443	3300049775	Bacteria	5502
503	Ga0501279_003130	3300049775	Bacteria	2152
504	Ga0501035_0000965	3300049822	Bacteria	30391
505	nmdc:mga03683_11945_c1	3300050489	Bacteria	3158
506	nmdc:mga03n38_12870_c1	3300050490	Bacteria	3162
507	nmdc:mga0qj67_40212_c1	3300050509	Bacteria	3675
508	nmdc:mga0qj67_70913_c1	3300050509	Bacteria	2780
509	nmdc:mga06r32_96024_c1	3300050510	Bacteria	2902
510	Ga0500608_148275	3300053122	Bacteria	1031
511	Ga0500618_008482	3300053125	Bacteria	2862
512	Ga0500573_0029056	3300053140	Bacteria	3186
513	Ga0500619_166015	3300053154	Bacteria	748
514	Ga0500622_0038206	3300053156	Bacteria	2505
515	Ga0500622_0071756	3300053156	Bacteria	1750
516	Ga0587070_121000	3300059491	Bacteria	626
517	Ga0587077_023307	3300059493	Bacteria	1117
518	Ga0587077_101697	3300059493	Bacteria	691
519	Ga0587080_019837	3300059503	Bacteria	1092
520	Ga0587082_001688	3300059504	Bacteria	2348
521	Ga0587091_080138	3300059511	Bacteria	731
522	Ga0587068_080496	3300059641	Bacteria	657
523	Ga0587069_074339	3300059642	Bacteria	651
524	Ga0587072_064098	3300059643	Bacteria	763
525	Ga0587076_031379	3300059645	Bacteria	944
526	Ga0587076_039413	3300059645	Bacteria	877
527	Ga0587076_041782	3300059645	Bacteria	860
528	Ga0587102_017817	3300059649	Bacteria	777
529	Ga0587111_0055499	3300060346	Bacteria	886
530	Ga0466962_0339013	3300061719	Bacteria	747
531	2511384893	2511231026	Bacteria	5225445
532	2527080962	2526164713	Bacteria	6780608
533	2548848078	2547132512	Bacteria	3416496
534	2644027908	2643221603	Bacteria	6147767
535	2644028843	2643221603	Bacteria	6147767
536	2644254379	2643221645	Bacteria	7207331
537	2644357954	2643221664	Bacteria	7272945
538	2738738205	2738541280	Bacteria	6630198
539	2738829269	2738541297	Bacteria	6549566
540	2738842989	2738541300	Bacteria	6675882
541	2739153065	2738541357	Bacteria	6549408
542	2739194985	2738543003	Bacteria	6549560
543	2739273737	2738543018	Bacteria	6718814
544	2739321461	2738543026	Bacteria	6549408
545	2739339983	2738543029	Bacteria	6549249
546	2739342781	2738543030	Bacteria	6719714
547	2821131538	2821131069	Bacteria	6108407
548	2857554418	2857553236	Bacteria	6166726
549	2857564796	2857564685	Bacteria	6290584
550	2904426087	2904424332	Bacteria	7633521
551	2919478478	2919476304	Bacteria	5888696
552	8057161320	8057160832	Bacteria	3268302
553	Ga0495588_0270713
554	SwRhRL2b_contig_1461477
555	JGI25154J39366_1001906
556	JGI25154J39366_1002842
557	JGI25158J39367_1014369
558	JGI25152J39213_1000005
559	JGI25152J39213_1000395
560	JGI25152J39213_1001135
561	JGI25150J39212_1000257
562	JGI25150J39212_1003081
563	JGI25159J45721_1001262
564	JGI25159J45721_1002087
565	JGI25159J45721_1006008
566	JGI25159J45721_1009997
567	JGI25159J45721_1011209
568	JGI25159J45721_1013151
569	Ga0006759J45824_1040057
570	JGI25153J46596_10005220
571	JGI25153J46596_10012789
572	JGI25153J46596_10021873
573	rootL2_10025949
574	rootL2_10163565
575	rootL2_10172118
576	JGI25160J50197_1006456
577	JGI25160J50197_1015450
578	JGI25161J50226_1002529
579	JGI25161J50226_1008082
580	Ga0007417J51691_1033061
581	Ga0007417J51691_1092036
582	Ga0007410J51695_1032984
583	Ga0007410J51695_1075106
584	Ga0007409J51694_1018473
585	Ga0007416J51690_1023281
586	Ga0007415J51800_128042
587	Ga0032354_1035241
588	Ga0055526_1000030
589	Ga0055526_1000299
590	Ga0055526_1004222
591	Ga0055526_1021791
592	Ga0055526_1054898
593	Ga0055537_1000154
594	Ga0055537_1000352
595	Ga0055537_1009364
596	Ga0055537_1011579
597	Ga0055537_1021026
598	Ga0055524_1000021
599	Ga0055524_1000099
600	Ga0055524_1000187
601	Ga0055524_1004400
602	Ga0055524_1004548
603	Ga0055524_1005250
604	Ga0055524_1006690
605	Ga0055524_1010226
606	Ga0055524_1054133
607	Ga0055534_1000513
608	Ga0055534_1002618
609	Ga0055534_1002635
610	Ga0055528_1000059
611	Ga0055528_1000134
612	Ga0055528_1004752
613	Ga0055530_10012808
614	Ga0055530_10024424
615	Ga0055530_10037340
616	Ga0055531_10013680
617	Ga0055543_1002545
618	Ga0055543_1002848
619	Ga0055543_1003435
620	Ga0065165_1000005
621	Ga0065165_1000055
622	Ga0065165_1000161
623	Ga0065165_1008738
624	Ga0065165_1023935
625	Ga0065165_1076394
626	Ga0065704_10080069
627	Ga0065704_10294778
628	Ga0070687_100006487
629	Ga0070661_100352170
630	Ga0070701_10817497
631	Ga0070663_101003553
632	Ga0070662_100243355
633	Ga0070698_100236037
634	Ga0070698_100264333
635	Ga0070704_100138856
636	Ga0070664_100056867
637	Ga0068854_101790607
638	Ga0075363_100057244
639	Ga0075432_10015104
640	Ga0070712_100031691
641	Ga0075362_10005190
642	Ga0075430_100007348
643	Ga0075430_100010695
644	Ga0075431_100000307
645	Ga0075431_100003813
646	Ga0075433_10058639
647	Ga0075429_100075130
648	Ga0079104_1009630
649	Ga0079104_1010273
650	Ga0099826_10000002
651	Ga0075435_101364271
652	Ga0105244_10000853
653	Ga0105244_10001358
654	Ga0105242_11322444
655	Ga0105237_11578017
656	Ga0105239_10684948
657	Ga0157371_10484893
658	Ga0157371_10850636
659	Ga0157370_10265893
660	Ga0163162_10150722
661	Ga0157372_10158298
662	Ga0157376_10095410
663	Ga0182006_1000026
664	Ga0182005_1000007
665	Ga0183362_10001
666	Ga0163161_10013042
667	Ga0206356_10656751
668	Ga0213872_10000028
669	Ga0213872_10006430
670	Ga0213872_10022306
671	Ga0213872_10038434
672	Ga0213872_10042049
673	Ga0209436_100351
674	Ga0209436_103001
675	Ga0209436_104886
676	Ga0209436_109138
677	Ga0209436_113812
678	Ga0209437_107534
679	Ga0207425_1000001
680	Ga0207425_1000009
681	Ga0207425_1000339
682	Ga0209646_1000010
683	Ga0209646_1000613
684	Ga0209026_1003538
685	Ga0209026_1004793
686	Ga0209026_1005027
687	Ga0209129_1000001
688	Ga0209129_1000003
689	Ga0209129_1000061
690	Ga0209565_1000057
691	Ga0209565_1000184
692	Ga0209565_1000765
693	Ga0209565_1010721
694	Ga0209565_1033708
695	Ga0209673_1000029
696	Ga0209673_1000051
697	Ga0209673_1013647
698	Ga0209130_1000084
699	Ga0209130_1000091
700	Ga0209130_1000175
701	Ga0209130_1002422
702	Ga0209130_1003652
703	Ga0209675_1000019
704	Ga0209675_1000027
705	Ga0209675_1001211
706	Ga0209675_1002713
707	Ga0209675_1002714
708	Ga0209564_1000010
709	Ga0209564_1000068
710	Ga0209564_1000094
711	Ga0209564_1000889
712	Ga0209564_1005384
713	Ga0209564_1033786
714	Ga0209758_1000041
715	Ga0209758_1000073
716	Ga0209758_1000101
717	Ga0209050_1000046
718	Ga0209050_1000442
719	Ga0209050_1013122
720	Ga0209256_1000018
721	Ga0209256_1000044
722	Ga0209256_1000068
723	Ga0209256_1000116
724	Ga0209256_1000145
725	Ga0209256_1000944
726	Ga0209256_1000988
727	Ga0209256_1001504
728	Ga0209256_1005880
729	Ga0207426_1002522
730	Ga0207426_1049750
731	Ga0209051_1084955
732	Ga0209257_1000068
733	Ga0207655_1003094
734	Ga0207662_10049387
735	Ga0207657_10565395
736	Ga0207650_10752491
737	Ga0207687_10328281
738	Ga0207700_10883835
739	Ga0207706_10189257
740	Ga0207679_10285849
741	Ga0207678_10221123
742	Ga0207678_10988778
743	Ga0207641_10450365
744	Ga0209281_1007000
745	Ga0209282_1000001
746	Ga0207428_10778334
747	Ga0316181_1044356
748	Ga0316182_1264385
749	Ga0265331_10014718
750	Ga0265327_10036265
751	Ga0307408_100000981
752	Ga0307408_100002767
753	Ga0265314_10026912
754	Ga0265314_10066364
755	Ga0307405_10537483
756	Ga0307413_10579002
757	Ga0307518_10220327
758	Ga0307412_10816818
759	Ga0307412_10937376
760	Ga0307409_100954037
761	Ga0307416_100077240
762	Ga0307416_100153247
763	Ga0307411_10488768
764	Ga0307415_100163703
765	Ga0373925_0456418
766	Ga0395899_0000956
767	Ga0395899_0001859
768	Ga0395899_0005685
769	Ga0395899_0010146
770	Ga0395899_0013974
771	Ga0395899_0016969
772	Ga0395899_0169586
773	Ga0395899_0446244
774	Ga0395899_0677771
775	Ga0395900_0002911
776	Ga0395900_0012846
777	Ga0395900_0055358
778	Ga0395900_0256585
779	Ga0395898_0014005
780	Ga0395898_0294748
781	Ga0395898_0350813
782	Ga0395905_0003076
783	Ga0395905_0008279
784	Ga0395905_0011242
785	Ga0395905_0014393
786	Ga0395905_0254933
787	Ga0395905_0307657
788	Ga0395905_0548908
789	Ga0395905_0726369
790	Ga0395901_0000054
791	Ga0395901_0136176
792	Ga0395901_0173048
793	Ga0395901_0186978
794	Ga0395901_0391537
795	Ga0436361_0094167
796	Ga0436361_0239828
797	Ga0436361_0415428
798	Ga0436361_0454653
799	Ga0436361_0616428
800	Ga0436361_0751503
801	Ga0451789_1340800
802	Ga0451853_0633733
803	Ga0439441_177702
804	Ga0439448_0003458
805	Ga0450906_048048
806	Ga0439446_0109307
807	Ga0451577_0004580
808	Ga0451577_0011575
809	Ga0451577_0011766
810	Ga0451577_0171947
811	Ga0451577_0303962
812	Ga0466969_0549737
813	Ga0466972_0000029
814	Ga0466972_0000041
815	Ga0466972_0077596
816	Ga0466972_0105427
817	Ga0466981_0367065
818	Ga0466982_0067121
819	Ga0453683_0000063
820	Ga0466965_0005670
821	Ga0466965_0029673
822	Ga0466965_0062996
823	Ga0466965_0260223
824	Ga0466965_0632568
825	Ga0466966_0019240
826	Ga0466964_0004963
827	Ga0466964_0320689
828	Ga0453684_0000140
829	Ga0453684_0001176
830	Ga0453684_0175448
831	Ga0453684_0333104
832	Ga0453684_0491789
833	Ga0453684_0524448
834	Ga0466968_0037791
835	Ga0466968_0094557
836	Ga0466970_0027859
837	Ga0466970_0028613
838	Ga0466957_0066326
839	Ga0466959_0010294
840	Ga0466959_0064752
841	Ga0451576_0012875
842	Ga0451576_0341803
843	Ga0451576_0458082
844	Ga0495617_000041
845	Ga0495617_031756
846	Ga0495627_000007
847	Ga0495627_013592
848	Ga0495603_0038000
849	Ga0495603_0074979
850	Ga0495590_0053476
851	Ga0495629_0150432
852	Ga0495638_0001950
853	Ga0495653_0000002
854	Ga0495650_0000118
855	Ga0495650_0000156
856	Ga0495650_0000283
857	Ga0495650_0012570
858	Ga0495582_0134313
859	Ga0495605_0000598
860	Ga0495605_0033838
861	Ga0495584_0004974
862	Ga0495584_0010756
863	Ga0495584_0027987
864	Ga0495584_0073511
865	Ga0495585_0007815
866	Ga0495585_0085860
867	Ga0495594_0008008
868	Ga0495594_0029645
869	Ga0495607_0002847
870	Ga0495607_0006823
871	Ga0495607_0029696
872	Ga0495607_0091753
873	Ga0495607_0105146
874	Ga0495607_0134272
875	Ga0495583_0000035
876	Ga0495583_0001445
877	Ga0495583_0010646
878	Ga0495606_0000703
879	Ga0495606_0001147
880	Ga0495606_0009682
881	Ga0495606_0010643
882	Ga0495606_0040641
883	Ga0495610_0000003
884	Ga0495610_0040601
885	Ga0495610_0076921
886	Ga0495616_0000343
887	Ga0495616_0001789
888	Ga0495616_0004098
889	Ga0495616_0057001
890	Ga0495628_0588307
891	Ga0495631_0009707
892	Ga0495637_0000482
893	Ga0495637_0043530
894	Ga0495637_0058860
895	Ga0495643_0001637
896	Ga0495643_0038484
897	Ga0495648_0013512
898	Ga0495648_0031766
899	Ga0495648_0084481
900	Ga0495648_0106432
901	Ga0495648_0312925
902	Ga0495663_0217746
903	Ga0495666_0112598
904	Ga0495642_0009421
905	Ga0495654_0000038
906	Ga0495654_0017997
907	Ga0495654_0082792
908	Ga0495598_0015814
909	Ga0495609_0000636
910	Ga0495609_0000908
911	Ga0495609_0003925
912	Ga0495609_0006138
913	Ga0495621_0029559
914	Ga0495597_0010396
915	Ga0495597_0114218
916	Ga0495622_0000013
917	Ga0495622_0052526
918	Ga0495633_0016870
919	Ga0495633_0135812
920	Ga0495633_0138257
921	Ga0495633_0155768
922	Ga0495633_0257139
923	Ga0495656_0165108
924	Ga0495668_0000006
925	Ga0495668_0000029
926	Ga0495668_0000048
927	Ga0495668_0002401
928	Ga0495668_0011995
929	Ga0495668_0020180
930	Ga0495611_0007976
931	Ga0495611_0039554
932	Ga0495625_0009364
933	Ga0495625_0023387
934	Ga0495625_0048447
935	Ga0495625_0048663
936	Ga0495625_0057969
937	Ga0495625_0127931
938	Ga0495625_0432950
939	Ga0495659_0000131
940	Ga0495659_0010583
941	Ga0495659_0010749
942	Ga0495659_0018249
943	Ga0495661_0024496
944	Ga0495661_0044005
945	Ga0495661_0048407
946	Ga0495661_0053181
947	Ga0495661_0412569
948	Ga0495588_0125310
949	Ga0495669_0000252
950	Ga0495669_0000898
951	Ga0495670_0049128
952	Ga0495671_0000001
953	Ga0495671_0000424
954	Ga0495671_0015429
955	Ga0495671_0016794
956	Ga0495649_0001756
957	Ga0495649_0016067
958	Ga0495649_0114952
959	Ga0495649_0220491
960	Ga0495589_0176648
961	Ga0495660_0008242
962	Ga0495660_0009445
963	Ga0495660_0013668
964	Ga0495660_0038874
965	Ga0495660_0106628
966	Ga0495636_0000811
967	Ga0495636_0002048
968	Ga0495636_0005914
969	Ga0495636_0100429
970	Ga0495674_0080093
971	Ga0495672_0000973
972	Ga0495672_0006177
973	Ga0495672_0011872
974	Ga0495676_0017575
975	Ga0495683_0000952
976	Ga0495687_000148
977	Ga0495687_002762
978	Ga0495687_016671
979	Ga0495687_042465
980	Ga0495687_153366
981	Ga0495677_0004720
982	Ga0495677_0006369
983	Ga0495677_0010235
984	Ga0495679_006853
985	Ga0495679_019788
986	Ga0495679_037484
987	Ga0495685_000077
988	Ga0495685_009695
989	Ga0495685_019032
990	Ga0495685_051116
991	Ga0495685_073847
992	Ga0495673_0000100
993	Ga0495673_0057567
994	Ga0495681_0002968
995	Ga0495681_0002980
996	Ga0495681_0008901
997	Ga0495681_0201572
998	Ga0495686_0000874
999	Ga0495686_0001479
1000	Ga0495686_0066205
1001	Ga0495686_0097101
1002	Ga0495626_0006135
1003	Ga0495626_0024982
1004	Ga0496101_0166254
1005	Ga0496102_0020653
1006	Ga0496102_0077882
1007	Ga0496102_1124444
1008	Ga0496103_0003038
1009	Ga0496103_0006660
1010	Ga0496106_0236372
1011	Ga0496109_0358556
1012	Ga0496110_0441884
1013	Ga0496110_0754295
1014	Ga0496111_0109096
1015	Ga0496114_0127806
1016	Ga0496114_0187535
1017	Ga0496114_0372836
1018	Ga0496114_0399533
1019	Ga0496115_0361667
1020	Ga0496118_0523900
1021	Ga0496120_0109001
1022	Ga0496121_0248997
1023	Ga0496122_0011024
1024	Ga0496122_0054161
1025	Ga0496122_0076790
1026	Ga0496123_0006679
1027	Ga0496124_0141048
1028	Ga0496124_0493481
1029	Ga0496125_0000542
1030	Ga0496125_0002429
1031	Ga0496126_0017336
1032	Ga0501306_057942
1033	Ga0501307_017480
1034	Ga0495678_000004
1035	Ga0495678_001499
1036	Ga0495678_024887
1037	Ga0495678_052314
1038	Ga0495682_0000869
1039	Ga0495682_0008079
1040	Ga0501032_0001205
1041	Ga0501038_0632078
1042	Ga0501071_1040454
1043	Ga0501211_004952
1044	Ga0501214_011093
1045	Ga0501222_010742
1046	Ga0501227_002178
1047	Ga0501227_007019
1048	Ga0501227_010384
1049	Ga0501238_008241
1050	Ga0501249_002908
1051	Ga0501249_012616
1052	Ga0501269_000404
1053	Ga0501269_000424
1054	Ga0501279_000443
1055	Ga0501279_003130
1056	Ga0501035_0000965
1057	nmdc:mga03683_11945_c1
1058	nmdc:mga03n38_12870_c1
1059	nmdc:mga0qj67_40212_c1
1060	nmdc:mga0qj67_70913_c1
1061	nmdc:mga06r32_96024_c1
1062	Ga0500608_148275
1063	Ga0500618_008482
1064	Ga0500573_0029056
1065	Ga0500619_166015
1066	Ga0500622_0038206
1067	Ga0500622_0071756
1068	Ga0587070_121000
1069	Ga0587077_023307
1070	Ga0587077_101697
1071	Ga0587080_019837
1072	Ga0587082_001688
1073	Ga0587091_080138
1074	Ga0587068_080496
1075	Ga0587069_074339
1076	Ga0587072_064098
1077	Ga0587076_031379
1078	Ga0587076_039413
1079	Ga0587076_041782
1080	Ga0587102_017817
1081	Ga0587111_0055499
1082	Ga0466962_0339013
1083	2511384893
1084	2527080962
1085	2548848078
1086	2644027908
1087	2644028843
1088	2644254379
1089	2644357954
1090	2738738205
1091	2738829269
1092	2738842989
1093	2739153065
1094	2739194985
1095	2739273737
1096	2739321461
1097	2739339983
1098	2739342781
1099	2821131538
1100	2857554418
1101	2857564796
1102	2904426087
1103	2919478478
1104	8057161320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01584

CheW

CheW-like domain

48

185

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8c5v-assembly1.cif.gz_H	chemotaxis core signalling unit from e protein lysed e. coli cells	0.9158	16	147
2qdl-assembly2.cif.gz_B	crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis	0.8807	15	136
4jpb-assembly1.cif.gz_W	the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima.	0.8554	15	150
8c5v-assembly1.cif.gz_H	chemotaxis core signalling unit from e protein lysed e. coli cells	0.842	16	147
2qdl-assembly1.cif.gz_A	crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis	0.8299	6	142

ID	Description	Score	Start	End	Superfamily
af_P0A964_36_100_2.40.50.180	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4	0.9836	35	98	2.40.50.180
af_P0A964_36_100_2.40.50.180	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4	0.9542	35	98	2.40.50.180
2qdlB02	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4	0.9388	36	102	2.40.50.180
2ch4W02	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4	0.8782	35	102	2.40.50.180
1b3qA04	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4	0.7813	36	101	2.40.50.180

ID	Description	Score	Start	End	GO Terms
AF-A0A140L2A0-F1-model_v4	Chemotaxis protein CheW	0.9673	15	108	GO:0005829 GO:0006935 GO:0007165
AF-A0A4Q6EW92-F1-model_v4	Purine-binding chemotaxis protein CheW	0.9253	15	137	GO:0005829 GO:0006935 GO:0007165
AF-A0A522XQQ5-F1-model_v4	Chemotaxis protein CheW	0.92	12	154	GO:0005829 GO:0006935 GO:0007165
AF-W1SLV9-F1-model_v4	deleted	0.92	14	144
AF-A0A2W7GW92-F1-model_v4	deleted	0.9199	10	153

F462907

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01584

CheW

CheW-like domain

48

185

0.97

Structural Annotation

Top 5 Hits

Map