F462908

General Info

Members Datasets Scaffolds Average Seq Length
553 304 1106 120

Family's Representative Sequence

Representative Sequence 3300046689|Ga0495613_0164475|Ga0495613_0164475_1156_1563
Length 135
Sequence LTDRPPNSQEVEVAITGIDFIGIPTQDAERSRTFYIETLGLRPDEHGRFECWAGETCFGIWEPEKQGMQFAPQKNAHPALHVDDVASARAELEAKGVEFNGDTFDTGVCHMALFSDPDGNDLMLHNRYAPYPDSE

Samples

Sample ID Description Type Environment
1 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
163 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
183 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
184 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
185 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
186 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
187 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
290 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
296 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
299 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
300 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
301 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.16
Nodule 0
Rhizoplane 5.61
Rhizosphere 88.25
Stem 0
Stem Tuber 0
Unclassified 6.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495613_0164475 3300046689 Bacteria 1577
2 JGI25406J46586_10093364 3300003203 Bacteria 905
3 JGI25407J50210_10011920 3300003373 Bacteria 2226
4 JGI25404J52841_10004552 3300003659 Bacteria 2819
5 Ga0065707_10590305 3300005295 Bacteria 696
6 Ga0070658_10781188 3300005327 Bacteria 830
7 Ga0070683_100000502 3300005329 Bacteria 27604
8 Ga0070683_100031082 3300005329 Bacteria 4852
9 Ga0070683_100095509 3300005329 Bacteria 2795
10 Ga0070683_101308377 3300005329 Bacteria 696
11 Ga0070690_100208638 3300005330 Bacteria 1362
12 Ga0070690_100803700 3300005330 Bacteria 729
13 Ga0070670_100229960 3300005331 Bacteria 1614
14 Ga0070677_10000011 3300005333 Bacteria 60102
15 Ga0068869_100423359 3300005334 Bacteria 1099
16 Ga0068869_101142778 3300005334 Bacteria 683
17 Ga0068869_101207705 3300005334 Bacteria 665
18 Ga0070666_10088732 3300005335 Bacteria 2122
19 Ga0070680_100214898 3300005336 Bacteria 1622
20 Ga0070682_100000028 3300005337 Bacteria 185177
21 Ga0068868_101497980 3300005338 Bacteria 632
22 Ga0070689_100105261 3300005340 Bacteria 2238
23 Ga0070691_10002165 3300005341 Bacteria 8700
24 Ga0070691_11037417 3300005341 Bacteria 513
25 Ga0070687_100336979 3300005343 Bacteria 969
26 Ga0070661_100000110 3300005344 Bacteria 68106
27 Ga0070661_100067842 3300005344 Bacteria 2622
28 Ga0070692_10051266 3300005345 Bacteria 2145
29 Ga0070692_10219578 3300005345 Bacteria 1123
30 Ga0070692_10389261 3300005345 Bacteria 877
31 Ga0070669_101623744 3300005353 Bacteria 563
32 Ga0070675_100000091 3300005354 Bacteria 52149
33 Ga0070671_100491763 3300005355 Bacteria 1055
34 Ga0070688_100000918 3300005365 Bacteria 14725
35 Ga0070688_100428481 3300005365 Bacteria 985
36 Ga0070688_100984588 3300005365 Bacteria 669
37 Ga0070659_100993101 3300005366 Bacteria 737
38 Ga0070659_101548636 3300005366 Bacteria 591
39 Ga0070667_100494218 3300005367 Bacteria 1121
40 Ga0070713_100316935 3300005436 Unclassified 1439
41 Ga0070701_10031929 3300005438 Bacteria 2618
42 Ga0070701_10830494 3300005438 Bacteria 633
43 Ga0070700_100040834 3300005441 Bacteria 2842
44 Ga0070700_100198585 3300005441 Bacteria 1407
45 Ga0070700_101169704 3300005441 Bacteria 641
46 Ga0070694_100264994 3300005444 Bacteria 1305
47 Ga0070663_100822493 3300005455 Bacteria 798
48 Ga0070663_101475396 3300005455 Bacteria 604
49 Ga0070663_101498168 3300005455 Bacteria 600
50 Ga0070678_100735430 3300005456 Bacteria 891
51 Ga0070678_100870565 3300005456 Bacteria 822
52 Ga0070678_102086136 3300005456 Bacteria 537
53 Ga0070662_100000008 3300005457 Bacteria 168754
54 Ga0070662_101598231 3300005457 Bacteria 563
55 Ga0070681_10438849 3300005458 Bacteria 1217
56 Ga0068867_101882766 3300005459 Bacteria 564
57 Ga0070685_10000032 3300005466 Bacteria 84253
58 Ga0070685_10194218 3300005466 Bacteria 1315
59 Ga0070685_10949084 3300005466 Bacteria 643
60 Ga0070706_100437272 3300005467 Bacteria 1218
61 Ga0070707_100630023 3300005468 Bacteria 1035
62 Ga0070698_100158855 3300005471 Bacteria 2205
63 Ga0070698_100178863 3300005471 Bacteria 2060
64 Ga0070698_102127323 3300005471 Bacteria 515
65 Ga0070684_100008529 3300005535 Bacteria 8020
66 Ga0070684_100250512 3300005535 Bacteria 1619
67 Ga0070684_100321365 3300005535 Bacteria 1422
68 Ga0068853_100746616 3300005539 Bacteria 935
69 Ga0070672_101285845 3300005543 Bacteria 653
70 Ga0070686_100018935 3300005544 Bacteria 4050
71 Ga0070695_101230819 3300005545 Bacteria 617
72 Ga0070696_100214955 3300005546 Bacteria 1441
73 Ga0070696_100833287 3300005546 Bacteria 761
74 Ga0070693_100120818 3300005547 Bacteria 1624
75 Ga0070693_100560620 3300005547 Unclassified 819
76 Ga0070665_100016069 3300005548 Bacteria 7511
77 Ga0070665_100389211 3300005548 Bacteria 1402
78 Ga0070704_100833961 3300005549 Bacteria 826
79 Ga0068855_101086472 3300005563 Bacteria 837
80 Ga0070664_100126265 3300005564 Bacteria 2244
81 Ga0068857_100100375 3300005577 Bacteria 2596
82 Ga0068854_100275476 3300005578 Bacteria 1352
83 Ga0070702_100417476 3300005615 Bacteria 964
84 Ga0070702_100569290 3300005615 Bacteria 844
85 Ga0070702_100879713 3300005615 Bacteria 699
86 Ga0070702_101677913 3300005615 Bacteria 528
87 Ga0068852_100023035 3300005616 Bacteria 5006
88 Ga0068852_100384447 3300005616 Bacteria 1377
89 Ga0068864_100472269 3300005618 Bacteria 1203
90 Ga0068861_100195617 3300005719 Bacteria 1694
91 Ga0068861_101938230 3300005719 Bacteria 587
92 Ga0068851_10015685 3300005834 Bacteria 3614
93 Ga0068851_10297435 3300005834 Bacteria 927
94 Ga0068863_100057796 3300005841 Bacteria 3671
95 Ga0068863_101763476 3300005841 Bacteria 629
96 Ga0068863_102528362 3300005841 Bacteria 523
97 Ga0068858_100000033 3300005842 Bacteria 142748
98 Ga0068858_101861756 3300005842 Bacteria 594
99 Ga0068860_100074929 3300005843 Bacteria 3219
100 Ga0068860_101217834 3300005843 Bacteria 773
101 Ga0068860_102355387 3300005843 Bacteria 553
102 Ga0068862_100553336 3300005844 Bacteria 1099
103 Ga0081538_10000257 3300005981 Bacteria 60184
104 Ga0081538_10047736 3300005981 Bacteria 2622
105 Ga0081540_1000079 3300005983 Bacteria 103786
106 Ga0081539_10002753 3300005985 Bacteria 23665
107 Ga0075365_10054878 3300006038 Bacteria 2643
108 Ga0075365_10260620 3300006038 Bacteria 1219
109 Ga0075368_10026552 3300006042 Bacteria 2228
110 Ga0075363_100180595 3300006048 Bacteria 1201
111 Ga0075363_100249873 3300006048 Bacteria 1021
112 Ga0075364_10237563 3300006051 Bacteria 1237
113 Ga0075364_10301794 3300006051 Bacteria 1090
114 Ga0075432_10095737 3300006058 Bacteria 1092
115 Ga0075367_10108522 3300006178 Bacteria 1702
116 Ga0075367_10468310 3300006178 Bacteria 799
117 Ga0097621_100520425 3300006237 Bacteria 1080
118 Ga0068871_101269821 3300006358 Bacteria 692
119 Ga0075428_100335122 3300006844 Bacteria 1625
120 Ga0075430_100153655 3300006846 Bacteria 1916
121 Ga0068865_100658075 3300006881 Bacteria 891
122 Ga0105244_10253147 3300009036 Bacteria 820
123 Ga0105240_10454690 3300009093 Bacteria 1432
124 Ga0105240_11881246 3300009093 Bacteria 623
125 Ga0111539_10017102 3300009094 Bacteria 8977
126 Ga0111539_10086225 3300009094 Unclassified 3690
127 Ga0111539_10659477 3300009094 Bacteria 1218
128 Ga0105245_10002462 3300009098 Bacteria 16746
129 Ga0105245_10030959 3300009098 Bacteria 4733
130 Ga0105245_10115377 3300009098 Bacteria 2502
131 Ga0105245_10137536 3300009098 Bacteria 2297
132 Ga0105247_10968101 3300009101 Bacteria 662
133 Ga0105247_11062026 3300009101 Bacteria 636
134 Ga0105247_11071687 3300009101 Bacteria 634
135 Ga0105247_11194161 3300009101 Bacteria 605
136 Ga0114129_10539564 3300009147 Bacteria 1518
137 Ga0114129_10675861 3300009147 Bacteria 1330
138 Ga0105243_10249705 3300009148 Unclassified 1583
139 Ga0105243_10314761 3300009148 Unclassified 1424
140 Ga0105241_10097371 3300009174 Bacteria 2332
141 Ga0105242_10429255 3300009176 Bacteria 1240
142 Ga0105248_10022371 3300009177 Bacteria 7013
143 Ga0105237_12778754 3300009545 Bacteria 501
144 Ga0105238_10432928 3300009551 Bacteria 1311
145 Ga0105238_11571956 3300009551 Bacteria 687
146 Ga0105249_10000074 3300009553 Bacteria 145235
147 Ga0105249_10142843 3300009553 Bacteria 2297
148 Ga0105249_10144246 3300009553 Bacteria 2286
149 Ga0105249_10158747 3300009553 Bacteria 2184
150 Ga0105249_10373501 3300009553 Bacteria 1450
151 Ga0105249_11429237 3300009553 Bacteria 764
152 Ga0105249_11880611 3300009553 Bacteria 671
153 Ga0105239_10253758 3300010375 Bacteria 1976
154 Ga0105239_10470873 3300010375 Bacteria 1427
155 Ga0105239_10480875 3300010375 Bacteria 1411
156 Ga0105239_10765516 3300010375 Bacteria 1105
157 Ga0157371_10249986 3300013102 Bacteria 1276
158 Ga0157370_10002243 3300013104 Bacteria 23500
159 Ga0157369_10000105 3300013105 Bacteria 117996
160 Ga0157374_10005660 3300013296 Bacteria 10536
161 Ga0157374_10006706 3300013296 Bacteria 9784
162 Ga0157374_10175798 3300013296 Bacteria 2090
163 Ga0157378_10013905 3300013297 Bacteria 7039
164 Ga0157378_10138014 3300013297 Bacteria 2262
165 Ga0157378_10730122 3300013297 Bacteria 1012
166 Ga0163162_11148982 3300013306 Bacteria 880
167 Ga0157372_12450835 3300013307 Bacteria 599
168 Ga0157375_10000109 3300013308 Bacteria 80349
169 Ga0157375_10375509 3300013308 Bacteria 1588
170 Ga0157375_12616700 3300013308 Bacteria 603
171 Ga0157375_13375633 3300013308 Bacteria 532
172 Ga0163163_10266810 3300014325 Bacteria 1763
173 Ga0163163_13204648 3300014325 Bacteria 510
174 Ga0157380_10000186 3300014326 Bacteria 35981
175 Ga0157380_10000202 3300014326 Bacteria 35113
176 Ga0157380_10086342 3300014326 Bacteria 2578
177 Ga0157380_10429669 3300014326 Bacteria 1262
178 Ga0157380_10599175 3300014326 Bacteria 1090
179 Ga0157380_10628803 3300014326 Bacteria 1067
180 Ga0157380_11998137 3300014326 Bacteria 642
181 Ga0157380_13340040 3300014326 Bacteria 513
182 Ga0157377_10352308 3300014745 Unclassified 988
183 Ga0157379_10008825 3300014968 Bacteria 8791
184 Ga0157379_10322624 3300014968 Bacteria 1410
185 Ga0157376_11862900 3300014969 Bacteria 638
186 Ga0163161_10241257 3300017792 Bacteria 1406
187 Ga0207697_10241591 3300025315 Bacteria 798
188 Ga0207656_10002630 3300025321 Bacteria 6075
189 Ga0207682_10000159 3300025893 Bacteria 30618
190 Ga0207642_10054412 3300025899 Bacteria 1826
191 Ga0207688_10049352 3300025901 Bacteria 2352
192 Ga0207680_10022832 3300025903 Bacteria 3408
193 Ga0207699_10345326 3300025906 Unclassified 1049
194 Ga0207645_10052290 3300025907 Bacteria 2610
195 Ga0207643_10123605 3300025908 Bacteria 1535
196 Ga0207643_10154587 3300025908 Bacteria 1377
197 Ga0207643_10292415 3300025908 Bacteria 1012
198 Ga0207705_10034832 3300025909 Bacteria 3601
199 Ga0207695_10387038 3300025913 Bacteria 1283
200 Ga0207671_10945872 3300025914 Bacteria 680
201 Ga0207660_10109634 3300025917 Bacteria 2075
202 Ga0207662_10253113 3300025918 Bacteria 1157
203 Ga0207649_10000015 3300025920 Bacteria 245662
204 Ga0207646_10974847 3300025922 Bacteria 750
205 Ga0207681_10645485 3300025923 Bacteria 877
206 Ga0207650_10491713 3300025925 Bacteria 1025
207 Ga0207659_10000707 3300025926 Bacteria 19793
208 Ga0207659_11217012 3300025926 Unclassified 647
209 Ga0207687_10000815 3300025927 Bacteria 21058
210 Ga0207687_10129471 3300025927 Bacteria 1900
211 Ga0207687_10219293 3300025927 Bacteria 1497
212 Ga0207700_10301425 3300025928 Unclassified 1384
213 Ga0207644_10371413 3300025931 Bacteria 1165
214 Ga0207690_10564754 3300025932 Bacteria 926
215 Ga0207690_10825687 3300025932 Bacteria 767
216 Ga0207690_10848746 3300025932 Bacteria 756
217 Ga0207706_10000016 3300025933 Bacteria 170697
218 Ga0207706_10056419 3300025933 Bacteria 3463
219 Ga0207686_10122291 3300025934 Bacteria 1773
220 Ga0207686_10507825 3300025934 Bacteria 936
221 Ga0207670_10291777 3300025936 Bacteria 1274
222 Ga0207669_11611141 3300025937 Bacteria 554
223 Ga0207704_10269351 3300025938 Unclassified 1289
224 Ga0207691_10259205 3300025940 Bacteria 1499
225 Ga0207711_10376351 3300025941 Bacteria 1317
226 Ga0207689_10133536 3300025942 Bacteria 2043
227 Ga0207689_10319302 3300025942 Bacteria 1289
228 Ga0207689_11395592 3300025942 Bacteria 587
229 Ga0207661_10000391 3300025944 Bacteria 28421
230 Ga0207661_10003103 3300025944 Bacteria 11507
231 Ga0207661_10275193 3300025944 Bacteria 1503
232 Ga0207679_10275495 3300025945 Bacteria 1441
233 Ga0207651_10568412 3300025960 Unclassified 988
234 Ga0207712_10000007 3300025961 Bacteria 539589
235 Ga0207712_10063305 3300025961 Bacteria 2633
236 Ga0207712_10107853 3300025961 Bacteria 2083
237 Ga0207712_10336591 3300025961 Bacteria 1250
238 Ga0207712_10700168 3300025961 Bacteria 884
239 Ga0207668_12090868 3300025972 Bacteria 510
240 Ga0207658_10519553 3300025986 Bacteria 1062
241 Ga0207658_11264531 3300025986 Bacteria 675
242 Ga0207677_10226451 3300026023 Bacteria 1503
243 Ga0207677_10522450 3300026023 Bacteria 1030
244 Ga0207703_10000577 3300026035 Bacteria 37419
245 Ga0207703_10485191 3300026035 Bacteria 1158
246 Ga0207639_10442326 3300026041 Bacteria 1179
247 Ga0207678_10395019 3300026067 Bacteria 1197
248 Ga0207678_10543299 3300026067 Bacteria 1016
249 Ga0207678_10624146 3300026067 Bacteria 946
250 Ga0207708_10064740 3300026075 Bacteria 2793
251 Ga0207708_11337045 3300026075 Bacteria 628
252 Ga0207702_10499346 3300026078 Bacteria 1186
253 Ga0207641_10043871 3300026088 Bacteria 3758
254 Ga0207641_10589144 3300026088 Bacteria 1088
255 Ga0207648_10041240 3300026089 Bacteria 4053
256 Ga0207676_10754985 3300026095 Bacteria 946
257 Ga0207674_10160564 3300026116 Bacteria 2202
258 Ga0207675_100186006 3300026118 Bacteria 1991
259 Ga0207675_101192954 3300026118 Bacteria 781
260 Ga0207675_102693975 3300026118 Bacteria 506
261 Ga0207683_10035899 3300026121 Bacteria 4312
262 Ga0207683_10423565 3300026121 Bacteria 1226
263 Ga0207683_11917971 3300026121 Bacteria 541
264 Ga0207698_10009561 3300026142 Bacteria 6190
265 Ga0207698_10594368 3300026142 Bacteria 1090
266 Ga0209813_10096311 3300027866 Bacteria 1001
267 Ga0209974_10081026 3300027876 Bacteria 1117
268 Ga0209974_10129888 3300027876 Bacteria 898
269 Ga0207428_10060726 3300027907 Bacteria 2994
270 Ga0268266_10019755 3300028379 Bacteria 5741
271 Ga0268266_10080275 3300028379 Bacteria 2842
272 Ga0268266_10108836 3300028379 Bacteria 2453
273 Ga0268266_10173783 3300028379 Bacteria 1957
274 Ga0268266_10374101 3300028379 Bacteria 1342
275 Ga0268265_10455402 3300028380 Bacteria 1196
276 Ga0268265_10459642 3300028380 Unclassified 1191
277 Ga0268264_10655601 3300028381 Bacteria 1039
278 Ga0268264_11290495 3300028381 Bacteria 740
279 Ga0265338_10300314 3300028800 Bacteria 1168
280 Ga0307408_100541182 3300031548 Unclassified 1026
281 Ga0307408_100764077 3300031548 Bacteria 874
282 Ga0307408_101093467 3300031548 Bacteria 739
283 Ga0316575_10319151 3300031665 Bacteria 659
284 Ga0316578_10292748 3300031728 Bacteria 974
285 Ga0307405_10084186 3300031731 Bacteria 2087
286 Ga0307410_12018864 3300031852 Bacteria 515
287 Ga0307406_10182769 3300031901 Bacteria 1528
288 Ga0307406_10441813 3300031901 Unclassified 1041
289 Ga0307407_10750974 3300031903 Bacteria 739
290 Ga0307412_10353433 3300031911 Bacteria 1181
291 Ga0307409_100438178 3300031995 Bacteria 1258
292 Ga0307409_101594119 3300031995 Bacteria 681
293 Ga0307416_100063878 3300032002 Bacteria 3017
294 Ga0307416_100225394 3300032002 Bacteria 1802
295 Ga0307416_100324897 3300032002 Bacteria 1543
296 Ga0307416_101114470 3300032002 Bacteria 894
297 Ga0307416_101833770 3300032002 Bacteria 710
298 Ga0307414_11091720 3300032004 Bacteria 737
299 Ga0307411_10166225 3300032005 Bacteria 1659
300 Ga0307411_10216176 3300032005 Unclassified 1484
301 Ga0373952_0243613 3300035092 Bacteria 542
302 Ga0373956_0193220 3300035119 Bacteria 964
303 Ga0373960_0290367 3300035121 Bacteria 605
304 Ga0373937_0364723 3300036401 Bacteria 1369
305 Ga0436363_0900566 3300039450 Bacteria 786
306 Ga0439453_0091506 3300041408 Unclassified 668
307 Ga0439453_0191362 3300041408 Unclassified 503
308 Ga0439466_0080428 3300041411 Bacteria 1028
309 Ga0451851_0610893 3300041507 Bacteria 555
310 Ga0451853_2533835 3300041512 Bacteria 1143
311 Ga0451853_2824700 3300041512 Unclassified 1578
312 Ga0439437_001878 3300042000 Bacteria 2230
313 Ga0439441_006041 3300042001 Bacteria 1905
314 Ga0439454_087655 3300042011 Unclassified 572
315 Ga0450902_063521 3300042137 Unclassified 640
316 Ga0450907_023578 3300042146 Bacteria 1039
317 Ga0439435_0241830 3300042436 Bacteria 606
318 Ga0439464_0184549 3300042439 Unclassified 662
319 Ga0466971_0270687 3300044719 Bacteria 812
320 Ga0451576_0231402 3300045051 Bacteria 1930
321 Ga0451576_1599998 3300045051 Bacteria 676
322 Ga0466958_0027847 3300045836 Bacteria 3346
323 Ga0466958_0343780 3300045836 Bacteria 960
324 Ga0466967_0299943 3300045976 Bacteria 1546
325 Ga0495592_0162691 3300046454 Bacteria 1534
326 Ga0495629_0000899 3300046459 Bacteria 23864
327 Ga0495629_0127535 3300046459 Bacteria 1773
328 Ga0495638_0061530 3300046460 Bacteria 2320
329 Ga0495641_0000003 3300046461 Bacteria 242879
330 Ga0495641_0039873 3300046461 Bacteria 2187
331 Ga0495641_0183794 3300046461 Bacteria 936
332 Ga0495653_0029085 3300046463 Bacteria 4415
333 Ga0495584_0124290 3300046491 Bacteria 1307
334 Ga0495594_0000032 3300046499 Bacteria 63783
335 Ga0495596_0335163 3300046500 Unclassified 589
336 Ga0495607_0169952 3300046501 Bacteria 1102
337 Ga0495608_0007248 3300046511 Bacteria 7842
338 Ga0495620_0323947 3300046515 Bacteria 585
339 Ga0495628_0081774 3300046516 Bacteria 2509
340 Ga0495630_0001450 3300046517 Bacteria 16430
341 Ga0495630_0787893 3300046517 Bacteria 726
342 Ga0495644_0001581 3300046523 Bacteria 9286
343 Ga0495644_0090190 3300046523 Bacteria 1157
344 Ga0495644_0123972 3300046523 Bacteria 984
345 Ga0495652_0000003 3300046529 Bacteria 597094
346 Ga0495652_0309555 3300046529 Bacteria 1145
347 Ga0495652_1107569 3300046529 Unclassified 514
348 Ga0495640_0023176 3300046533 Bacteria 4531
349 Ga0495587_0334359 3300046536 Bacteria 845
350 Ga0495598_0001025 3300046537 Bacteria 5349
351 Ga0495622_0000050 3300046557 Bacteria 106111
352 Ga0495667_0198081 3300046559 Bacteria 1286
353 Ga0495656_0001440 3300046615 Bacteria 7786
354 Ga0495656_0131709 3300046615 Bacteria 1191
355 Ga0495656_0519278 3300046615 Bacteria 633
356 Ga0495634_0591127 3300046642 Unclassified 645
357 Ga0495625_0884818 3300046660 Bacteria 513
358 Ga0495635_0008443 3300046663 Bacteria 7194
359 Ga0495659_0387017 3300046664 Bacteria 602
360 Ga0495661_0413973 3300046665 Bacteria 654
361 Ga0495588_0000266 3300046674 Bacteria 40474
362 Ga0495599_0007749 3300046678 Bacteria 6518
363 Ga0495599_0233624 3300046678 Bacteria 1122
364 Ga0495647_0000019 3300046681 Bacteria 78887
365 Ga0495647_0007277 3300046681 Bacteria 3701
366 Ga0495647_0296145 3300046681 Unclassified 728
367 Ga0495624_0000030 3300046690 Bacteria 91755
368 Ga0495624_0011902 3300046690 Bacteria 5963
369 Ga0495670_0012525 3300046691 Bacteria 4173
370 Ga0495670_0423986 3300046691 Unclassified 720
371 Ga0495660_0213137 3300046810 Bacteria 915
372 Ga0495674_0000020 3300047319 Bacteria 178465
373 Ga0495676_0012509 3300047321 Bacteria 7641
374 Ga0495676_0128073 3300047321 Bacteria 1837
375 Ga0495680_0000352 3300047322 Bacteria 51468
376 Ga0495680_0151670 3300047322 Bacteria 1689
377 Ga0495675_0002318 3300047444 Bacteria 11377
378 Ga0495673_0068380 3300047469 Bacteria 1501
379 Ga0495684_0461178 3300047471 Bacteria 881
380 Ga0495686_0035977 3300047472 Bacteria 3179
381 Ga0495686_0037788 3300047472 Bacteria 3091
382 Ga0495614_0121634 3300048089 Bacteria 1151
383 Ga0495615_0284945 3300048090 Unclassified 532
384 Ga0496100_0257041 3300048903 Bacteria 1294
385 Ga0496102_0000129 3300048905 Bacteria 104478
386 Ga0496102_0025877 3300048905 Bacteria 5227
387 Ga0496102_0108669 3300048905 Bacteria 2584
388 Ga0496102_0286260 3300048905 Bacteria 1553
389 Ga0496102_0747122 3300048905 Bacteria 901
390 Ga0496102_1795592 3300048905 Bacteria 530
391 Ga0496103_0000087 3300048906 Bacteria 104566
392 Ga0496103_0132383 3300048906 Bacteria 1593
393 Ga0496103_0201416 3300048906 Bacteria 1280
394 Ga0496103_0475034 3300048906 Unclassified 801
395 Ga0496105_0095327 3300048908 Bacteria 2458
396 Ga0496106_0000286 3300048909 Bacteria 35738
397 Ga0496106_0067698 3300048909 Bacteria 2723
398 Ga0496106_0143571 3300048909 Unclassified 1879
399 Ga0496107_0130610 3300048910 Bacteria 1854
400 Ga0496107_0243585 3300048910 Bacteria 1338
401 Ga0496108_0000001 3300048911 Bacteria 919044
402 Ga0496108_0002430 3300048911 Bacteria 14893
403 Ga0496109_0000006 3300048912 Bacteria 325513
404 Ga0496109_0002798 3300048912 Bacteria 14606
405 Ga0496110_0002114 3300048913 Bacteria 14832
406 Ga0496110_0176283 3300048913 Bacteria 1940
407 Ga0496111_0000185 3300048914 Bacteria 28524
408 Ga0496111_0443318 3300048914 Bacteria 958
409 Ga0496111_0869209 3300048914 Bacteria 650
410 Ga0496112_1646597 3300048915 Bacteria 555
411 Ga0496113_0130818 3300048916 Bacteria 1969
412 Ga0496114_0954283 3300048917 Bacteria 740
413 Ga0496114_1625822 3300048917 Unclassified 534
414 Ga0496115_0335781 3300048918 Bacteria 1234
415 Ga0496117_0026907 3300048920 Bacteria 4491
416 Ga0496118_0020242 3300048921 Bacteria 5908
417 Ga0496119_0048221 3300048922 Bacteria 2643
418 Ga0496120_0004697 3300048923 Bacteria 11270
419 Ga0496121_0416489 3300048924 Bacteria 875
420 Ga0496124_0046202 3300048927 Bacteria 3730
421 Ga0496125_0204780 3300048928 Bacteria 1287
422 Ga0501031_0013727 3300049568 Bacteria 5280
423 Ga0501031_0513367 3300049568 Bacteria 773
424 Ga0501032_0016408 3300049569 Bacteria 5210
425 Ga0501032_0398235 3300049569 Unclassified 884
426 Ga0501033_0042519 3300049570 Bacteria 3388
427 Ga0501033_0204327 3300049570 Bacteria 1410
428 Ga0501033_0724019 3300049570 Bacteria 676
429 Ga0501034_0412247 3300049571 Bacteria 1273
430 Ga0501036_0000770 3300049572 Bacteria 23736
431 Ga0501036_0054691 3300049572 Bacteria 3382
432 Ga0501036_0207035 3300049572 Bacteria 1649
433 Ga0501036_0367402 3300049572 Bacteria 1201
434 Ga0501037_0373474 3300049573 Bacteria 981
435 Ga0501038_0087632 3300049574 Bacteria 2614
436 Ga0501038_0450862 3300049574 Bacteria 989
437 Ga0501039_0033310 3300049575 Bacteria 3973
438 Ga0501039_0056573 3300049575 Bacteria 3039
439 Ga0501039_0261975 3300049575 Bacteria 1359
440 Ga0501040_0003699 3300049576 Bacteria 9911
441 Ga0501040_0035014 3300049576 Bacteria 3403
442 Ga0501040_0994325 3300049576 Bacteria 608
443 Ga0501041_0008249 3300049577 Bacteria 6127
444 Ga0501041_0089398 3300049577 Bacteria 1901
445 Ga0501042_0016213 3300049578 Bacteria 5111
446 Ga0501042_0018727 3300049578 Bacteria 4798
447 Ga0501042_0029066 3300049578 Bacteria 3899
448 Ga0501042_0104944 3300049578 Bacteria 2034
449 Ga0501042_0258048 3300049578 Bacteria 1258
450 Ga0501042_1258529 3300049578 Bacteria 539
451 Ga0501043_0131406 3300049579 Bacteria 1962
452 Ga0501046_0005831 3300049580 Bacteria 10982
453 Ga0501046_0073178 3300049580 Bacteria 2660
454 Ga0501046_0748601 3300049580 Bacteria 687
455 Ga0501048_0001984 3300049582 Bacteria 15558
456 Ga0501048_0004998 3300049582 Bacteria 10111
457 Ga0501048_0398287 3300049582 Bacteria 984
458 Ga0501068_0031372 3300049584 Bacteria 3157
459 Ga0501068_0828762 3300049584 Unclassified 607
460 Ga0501069_0090855 3300049585 Bacteria 1727
461 Ga0501069_0186606 3300049585 Bacteria 1199
462 Ga0501070_0011298 3300049586 Bacteria 7544
463 Ga0501070_0087554 3300049586 Bacteria 2578
464 Ga0501070_0195367 3300049586 Bacteria 1662
465 Ga0501070_0213749 3300049586 Bacteria 1582
466 Ga0501071_0001603 3300049587 Bacteria 13269
467 Ga0501071_0251799 3300049587 Bacteria 1333
468 Ga0501072_0001453 3300049588 Bacteria 17756
469 Ga0501072_0001794 3300049588 Bacteria 15975
470 Ga0501072_0044647 3300049588 Bacteria 3484
471 Ga0501072_0883905 3300049588 Bacteria 698
472 Ga0501072_0904285 3300049588 Bacteria 689
473 Ga0501073_0102224 3300049589 Bacteria 1990
474 Ga0501074_0012876 3300049590 Bacteria 6082
475 Ga0501074_0038461 3300049590 Bacteria 3467
476 Ga0501075_0002810 3300049591 Bacteria 11670
477 Ga0501075_0003708 3300049591 Bacteria 10260
478 Ga0501075_0018771 3300049591 Bacteria 5011
479 Ga0501075_0114202 3300049591 Bacteria 2053
480 Ga0501075_0318559 3300049591 Unclassified 1185
481 Ga0501075_0367540 3300049591 Bacteria 1096
482 Ga0501076_0001287 3300049592 Bacteria 16716
483 Ga0501076_0039122 3300049592 Bacteria 3723
484 Ga0501076_0055937 3300049592 Bacteria 3130
485 Ga0501076_0346881 3300049592 Bacteria 1219
486 Ga0501076_0385953 3300049592 Bacteria 1151
487 Ga0501077_0016431 3300049593 Bacteria 4663
488 Ga0501077_0042767 3300049593 Bacteria 2880
489 Ga0501077_0079933 3300049593 Bacteria 2071
490 Ga0501079_0029048 3300049741 Bacteria 4244
491 Ga0501079_0037825 3300049741 Bacteria 3720
492 Ga0501079_0271218 3300049741 Bacteria 1326
493 Ga0501079_0413185 3300049741 Bacteria 1059
494 Ga0501079_1338418 3300049741 Bacteria 564
495 Ga0501080_0092161 3300049742 Bacteria 2814
496 Ga0501080_0412412 3300049742 Bacteria 1214
497 Ga0501080_0719469 3300049742 Bacteria 880
498 Ga0501081_0024499 3300049743 Bacteria 4051
499 Ga0501081_0030848 3300049743 Bacteria 3631
500 Ga0501081_0085502 3300049743 Archaea 2214
501 Ga0501081_0230673 3300049743 Bacteria 1348
502 Ga0501081_0633186 3300049743 Bacteria 801
503 Ga0501081_1240038 3300049743 Bacteria 565
504 Ga0501083_0095573 3300049744 Bacteria 1961
505 Ga0501083_0679668 3300049744 Bacteria 669
506 Ga0501035_0394874 3300049822 Unclassified 1151
507 Ga0501044_0269941 3300049823 Bacteria 1637
508 Ga0501044_0367064 3300049823 Bacteria 1357
509 Ga0501045_0018396 3300049824 Bacteria 4970
510 Ga0501045_0136286 3300049824 Bacteria 1825
511 Ga0501045_0375312 3300049824 Unclassified 1058
512 nmdc:mga03n38_250635_c1 3300050490 Bacteria 935
513 nmdc:mga03n38_516976_c1 3300050490 Bacteria 672
514 nmdc:mga03n38_76293_c1 3300050490 Bacteria 1563
515 nmdc:mga00v17_318037_c1 3300050491 Bacteria 1011
516 nmdc:mga00v17_477279_c1 3300050491 Bacteria 809
517 nmdc:mga0yw44_570272_c1 3300050492 Bacteria 769
518 nmdc:mga06z11_761799_c1 3300050494 Bacteria 590
519 nmdc:mga06z11_810527_c1 3300050494 Bacteria 570
520 nmdc:mga04h51_77017_c1 3300050495 Bacteria 1176
521 nmdc:mga05p37_1073795_c1 3300050507 Bacteria 846
522 nmdc:mga05p37_368744_c1 3300050507 Bacteria 1686
523 nmdc:mga05p37_457036_c1 3300050507 Bacteria 1476
524 nmdc:mga0qj67_950064_c1 3300050509 Bacteria 676
525 nmdc:mga08y16_13952_c1 3300050511 Bacteria 8457
526 Ga0495601_0241173 3300053077 Bacteria 1180
527 Ga0495601_0337400 3300053077 Bacteria 981
528 Ga0495612_0009442 3300053078 Bacteria 3957
529 Ga0495655_0000010 3300053083 Bacteria 125615
530 Ga0495655_0006650 3300053083 Bacteria 2113
531 Ga0495619_0000001 3300053085 Bacteria 586054
532 Ga0495619_0011588 3300053085 Bacteria 5555
533 Ga0495619_0038946 3300053085 Bacteria 3102
534 Ga0500566_0199959 3300053094 Bacteria 1010
535 Ga0500595_028260 3300053119 Bacteria 1913
536 Ga0500614_000154 3300053123 Bacteria 17409
537 Ga0500628_000024 3300053129 Bacteria 64538
538 Ga0501084_0016644 3300054114 Bacteria 6106
539 Ga0501084_0062320 3300054114 Bacteria 3121
540 Ga0501084_0153869 3300054114 Bacteria 1939
541 Ga0501084_0257171 3300054114 Bacteria 1474
542 Ga0501082_0045867 3300060353 Bacteria 3769
543 Ga0501082_0123844 3300060353 Bacteria 2241
544 Ga0501082_0153740 3300060353 Bacteria 1999
545 Ga0501082_0575294 3300060353 Unclassified 985
546 Ga0501082_0912137 3300060353 Bacteria 768
547 Ga0501082_0915539 3300060353 Bacteria 767
548 Ga0530510_0003412 3300061734 Bacteria 10928
549 Ga0530510_0016370 3300061734 Bacteria 5248
550 Ga0530510_0058924 3300061734 Bacteria 2777
551 Ga0530510_0180932 3300061734 Bacteria 1563
552 Ga0530510_0637444 3300061734 Bacteria 811
553 Ga0530510_1421362 3300061734 Bacteria 532
554 Ga0495613_0164475
555 JGI25406J46586_10093364
556 JGI25407J50210_10011920
557 JGI25404J52841_10004552
558 Ga0065707_10590305
559 Ga0070658_10781188
560 Ga0070683_100000502
561 Ga0070683_100031082
562 Ga0070683_100095509
563 Ga0070683_101308377
564 Ga0070690_100208638
565 Ga0070690_100803700
566 Ga0070670_100229960
567 Ga0070677_10000011
568 Ga0068869_100423359
569 Ga0068869_101142778
570 Ga0068869_101207705
571 Ga0070666_10088732
572 Ga0070680_100214898
573 Ga0070682_100000028
574 Ga0068868_101497980
575 Ga0070689_100105261
576 Ga0070691_10002165
577 Ga0070691_11037417
578 Ga0070687_100336979
579 Ga0070661_100000110
580 Ga0070661_100067842
581 Ga0070692_10051266
582 Ga0070692_10219578
583 Ga0070692_10389261
584 Ga0070669_101623744
585 Ga0070675_100000091
586 Ga0070671_100491763
587 Ga0070688_100000918
588 Ga0070688_100428481
589 Ga0070688_100984588
590 Ga0070659_100993101
591 Ga0070659_101548636
592 Ga0070667_100494218
593 Ga0070713_100316935
594 Ga0070701_10031929
595 Ga0070701_10830494
596 Ga0070700_100040834
597 Ga0070700_100198585
598 Ga0070700_101169704
599 Ga0070694_100264994
600 Ga0070663_100822493
601 Ga0070663_101475396
602 Ga0070663_101498168
603 Ga0070678_100735430
604 Ga0070678_100870565
605 Ga0070678_102086136
606 Ga0070662_100000008
607 Ga0070662_101598231
608 Ga0070681_10438849
609 Ga0068867_101882766
610 Ga0070685_10000032
611 Ga0070685_10194218
612 Ga0070685_10949084
613 Ga0070706_100437272
614 Ga0070707_100630023
615 Ga0070698_100158855
616 Ga0070698_100178863
617 Ga0070698_102127323
618 Ga0070684_100008529
619 Ga0070684_100250512
620 Ga0070684_100321365
621 Ga0068853_100746616
622 Ga0070672_101285845
623 Ga0070686_100018935
624 Ga0070695_101230819
625 Ga0070696_100214955
626 Ga0070696_100833287
627 Ga0070693_100120818
628 Ga0070693_100560620
629 Ga0070665_100016069
630 Ga0070665_100389211
631 Ga0070704_100833961
632 Ga0068855_101086472
633 Ga0070664_100126265
634 Ga0068857_100100375
635 Ga0068854_100275476
636 Ga0070702_100417476
637 Ga0070702_100569290
638 Ga0070702_100879713
639 Ga0070702_101677913
640 Ga0068852_100023035
641 Ga0068852_100384447
642 Ga0068864_100472269
643 Ga0068861_100195617
644 Ga0068861_101938230
645 Ga0068851_10015685
646 Ga0068851_10297435
647 Ga0068863_100057796
648 Ga0068863_101763476
649 Ga0068863_102528362
650 Ga0068858_100000033
651 Ga0068858_101861756
652 Ga0068860_100074929
653 Ga0068860_101217834
654 Ga0068860_102355387
655 Ga0068862_100553336
656 Ga0081538_10000257
657 Ga0081538_10047736
658 Ga0081540_1000079
659 Ga0081539_10002753
660 Ga0075365_10054878
661 Ga0075365_10260620
662 Ga0075368_10026552
663 Ga0075363_100180595
664 Ga0075363_100249873
665 Ga0075364_10237563
666 Ga0075364_10301794
667 Ga0075432_10095737
668 Ga0075367_10108522
669 Ga0075367_10468310
670 Ga0097621_100520425
671 Ga0068871_101269821
672 Ga0075428_100335122
673 Ga0075430_100153655
674 Ga0068865_100658075
675 Ga0105244_10253147
676 Ga0105240_10454690
677 Ga0105240_11881246
678 Ga0111539_10017102
679 Ga0111539_10086225
680 Ga0111539_10659477
681 Ga0105245_10002462
682 Ga0105245_10030959
683 Ga0105245_10115377
684 Ga0105245_10137536
685 Ga0105247_10968101
686 Ga0105247_11062026
687 Ga0105247_11071687
688 Ga0105247_11194161
689 Ga0114129_10539564
690 Ga0114129_10675861
691 Ga0105243_10249705
692 Ga0105243_10314761
693 Ga0105241_10097371
694 Ga0105242_10429255
695 Ga0105248_10022371
696 Ga0105237_12778754
697 Ga0105238_10432928
698 Ga0105238_11571956
699 Ga0105249_10000074
700 Ga0105249_10142843
701 Ga0105249_10144246
702 Ga0105249_10158747
703 Ga0105249_10373501
704 Ga0105249_11429237
705 Ga0105249_11880611
706 Ga0105239_10253758
707 Ga0105239_10470873
708 Ga0105239_10480875
709 Ga0105239_10765516
710 Ga0157371_10249986
711 Ga0157370_10002243
712 Ga0157369_10000105
713 Ga0157374_10005660
714 Ga0157374_10006706
715 Ga0157374_10175798
716 Ga0157378_10013905
717 Ga0157378_10138014
718 Ga0157378_10730122
719 Ga0163162_11148982
720 Ga0157372_12450835
721 Ga0157375_10000109
722 Ga0157375_10375509
723 Ga0157375_12616700
724 Ga0157375_13375633
725 Ga0163163_10266810
726 Ga0163163_13204648
727 Ga0157380_10000186
728 Ga0157380_10000202
729 Ga0157380_10086342
730 Ga0157380_10429669
731 Ga0157380_10599175
732 Ga0157380_10628803
733 Ga0157380_11998137
734 Ga0157380_13340040
735 Ga0157377_10352308
736 Ga0157379_10008825
737 Ga0157379_10322624
738 Ga0157376_11862900
739 Ga0163161_10241257
740 Ga0207697_10241591
741 Ga0207656_10002630
742 Ga0207682_10000159
743 Ga0207642_10054412
744 Ga0207688_10049352
745 Ga0207680_10022832
746 Ga0207699_10345326
747 Ga0207645_10052290
748 Ga0207643_10123605
749 Ga0207643_10154587
750 Ga0207643_10292415
751 Ga0207705_10034832
752 Ga0207695_10387038
753 Ga0207671_10945872
754 Ga0207660_10109634
755 Ga0207662_10253113
756 Ga0207649_10000015
757 Ga0207646_10974847
758 Ga0207681_10645485
759 Ga0207650_10491713
760 Ga0207659_10000707
761 Ga0207659_11217012
762 Ga0207687_10000815
763 Ga0207687_10129471
764 Ga0207687_10219293
765 Ga0207700_10301425
766 Ga0207644_10371413
767 Ga0207690_10564754
768 Ga0207690_10825687
769 Ga0207690_10848746
770 Ga0207706_10000016
771 Ga0207706_10056419
772 Ga0207686_10122291
773 Ga0207686_10507825
774 Ga0207670_10291777
775 Ga0207669_11611141
776 Ga0207704_10269351
777 Ga0207691_10259205
778 Ga0207711_10376351
779 Ga0207689_10133536
780 Ga0207689_10319302
781 Ga0207689_11395592
782 Ga0207661_10000391
783 Ga0207661_10003103
784 Ga0207661_10275193
785 Ga0207679_10275495
786 Ga0207651_10568412
787 Ga0207712_10000007
788 Ga0207712_10063305
789 Ga0207712_10107853
790 Ga0207712_10336591
791 Ga0207712_10700168
792 Ga0207668_12090868
793 Ga0207658_10519553
794 Ga0207658_11264531
795 Ga0207677_10226451
796 Ga0207677_10522450
797 Ga0207703_10000577
798 Ga0207703_10485191
799 Ga0207639_10442326
800 Ga0207678_10395019
801 Ga0207678_10543299
802 Ga0207678_10624146
803 Ga0207708_10064740
804 Ga0207708_11337045
805 Ga0207702_10499346
806 Ga0207641_10043871
807 Ga0207641_10589144
808 Ga0207648_10041240
809 Ga0207676_10754985
810 Ga0207674_10160564
811 Ga0207675_100186006
812 Ga0207675_101192954
813 Ga0207675_102693975
814 Ga0207683_10035899
815 Ga0207683_10423565
816 Ga0207683_11917971
817 Ga0207698_10009561
818 Ga0207698_10594368
819 Ga0209813_10096311
820 Ga0209974_10081026
821 Ga0209974_10129888
822 Ga0207428_10060726
823 Ga0268266_10019755
824 Ga0268266_10080275
825 Ga0268266_10108836
826 Ga0268266_10173783
827 Ga0268266_10374101
828 Ga0268265_10455402
829 Ga0268265_10459642
830 Ga0268264_10655601
831 Ga0268264_11290495
832 Ga0265338_10300314
833 Ga0307408_100541182
834 Ga0307408_100764077
835 Ga0307408_101093467
836 Ga0316575_10319151
837 Ga0316578_10292748
838 Ga0307405_10084186
839 Ga0307410_12018864
840 Ga0307406_10182769
841 Ga0307406_10441813
842 Ga0307407_10750974
843 Ga0307412_10353433
844 Ga0307409_100438178
845 Ga0307409_101594119
846 Ga0307416_100063878
847 Ga0307416_100225394
848 Ga0307416_100324897
849 Ga0307416_101114470
850 Ga0307416_101833770
851 Ga0307414_11091720
852 Ga0307411_10166225
853 Ga0307411_10216176
854 Ga0373952_0243613
855 Ga0373956_0193220
856 Ga0373960_0290367
857 Ga0373937_0364723
858 Ga0436363_0900566
859 Ga0439453_0091506
860 Ga0439453_0191362
861 Ga0439466_0080428
862 Ga0451851_0610893
863 Ga0451853_2533835
864 Ga0451853_2824700
865 Ga0439437_001878
866 Ga0439441_006041
867 Ga0439454_087655
868 Ga0450902_063521
869 Ga0450907_023578
870 Ga0439435_0241830
871 Ga0439464_0184549
872 Ga0466971_0270687
873 Ga0451576_0231402
874 Ga0451576_1599998
875 Ga0466958_0027847
876 Ga0466958_0343780
877 Ga0466967_0299943
878 Ga0495592_0162691
879 Ga0495629_0000899
880 Ga0495629_0127535
881 Ga0495638_0061530
882 Ga0495641_0000003
883 Ga0495641_0039873
884 Ga0495641_0183794
885 Ga0495653_0029085
886 Ga0495584_0124290
887 Ga0495594_0000032
888 Ga0495596_0335163
889 Ga0495607_0169952
890 Ga0495608_0007248
891 Ga0495620_0323947
892 Ga0495628_0081774
893 Ga0495630_0001450
894 Ga0495630_0787893
895 Ga0495644_0001581
896 Ga0495644_0090190
897 Ga0495644_0123972
898 Ga0495652_0000003
899 Ga0495652_0309555
900 Ga0495652_1107569
901 Ga0495640_0023176
902 Ga0495587_0334359
903 Ga0495598_0001025
904 Ga0495622_0000050
905 Ga0495667_0198081
906 Ga0495656_0001440
907 Ga0495656_0131709
908 Ga0495656_0519278
909 Ga0495634_0591127
910 Ga0495625_0884818
911 Ga0495635_0008443
912 Ga0495659_0387017
913 Ga0495661_0413973
914 Ga0495588_0000266
915 Ga0495599_0007749
916 Ga0495599_0233624
917 Ga0495647_0000019
918 Ga0495647_0007277
919 Ga0495647_0296145
920 Ga0495624_0000030
921 Ga0495624_0011902
922 Ga0495670_0012525
923 Ga0495670_0423986
924 Ga0495660_0213137
925 Ga0495674_0000020
926 Ga0495676_0012509
927 Ga0495676_0128073
928 Ga0495680_0000352
929 Ga0495680_0151670
930 Ga0495675_0002318
931 Ga0495673_0068380
932 Ga0495684_0461178
933 Ga0495686_0035977
934 Ga0495686_0037788
935 Ga0495614_0121634
936 Ga0495615_0284945
937 Ga0496100_0257041
938 Ga0496102_0000129
939 Ga0496102_0025877
940 Ga0496102_0108669
941 Ga0496102_0286260
942 Ga0496102_0747122
943 Ga0496102_1795592
944 Ga0496103_0000087
945 Ga0496103_0132383
946 Ga0496103_0201416
947 Ga0496103_0475034
948 Ga0496105_0095327
949 Ga0496106_0000286
950 Ga0496106_0067698
951 Ga0496106_0143571
952 Ga0496107_0130610
953 Ga0496107_0243585
954 Ga0496108_0000001
955 Ga0496108_0002430
956 Ga0496109_0000006
957 Ga0496109_0002798
958 Ga0496110_0002114
959 Ga0496110_0176283
960 Ga0496111_0000185
961 Ga0496111_0443318
962 Ga0496111_0869209
963 Ga0496112_1646597
964 Ga0496113_0130818
965 Ga0496114_0954283
966 Ga0496114_1625822
967 Ga0496115_0335781
968 Ga0496117_0026907
969 Ga0496118_0020242
970 Ga0496119_0048221
971 Ga0496120_0004697
972 Ga0496121_0416489
973 Ga0496124_0046202
974 Ga0496125_0204780
975 Ga0501031_0013727
976 Ga0501031_0513367
977 Ga0501032_0016408
978 Ga0501032_0398235
979 Ga0501033_0042519
980 Ga0501033_0204327
981 Ga0501033_0724019
982 Ga0501034_0412247
983 Ga0501036_0000770
984 Ga0501036_0054691
985 Ga0501036_0207035
986 Ga0501036_0367402
987 Ga0501037_0373474
988 Ga0501038_0087632
989 Ga0501038_0450862
990 Ga0501039_0033310
991 Ga0501039_0056573
992 Ga0501039_0261975
993 Ga0501040_0003699
994 Ga0501040_0035014
995 Ga0501040_0994325
996 Ga0501041_0008249
997 Ga0501041_0089398
998 Ga0501042_0016213
999 Ga0501042_0018727
1000 Ga0501042_0029066
1001 Ga0501042_0104944
1002 Ga0501042_0258048
1003 Ga0501042_1258529
1004 Ga0501043_0131406
1005 Ga0501046_0005831
1006 Ga0501046_0073178
1007 Ga0501046_0748601
1008 Ga0501048_0001984
1009 Ga0501048_0004998
1010 Ga0501048_0398287
1011 Ga0501068_0031372
1012 Ga0501068_0828762
1013 Ga0501069_0090855
1014 Ga0501069_0186606
1015 Ga0501070_0011298
1016 Ga0501070_0087554
1017 Ga0501070_0195367
1018 Ga0501070_0213749
1019 Ga0501071_0001603
1020 Ga0501071_0251799
1021 Ga0501072_0001453
1022 Ga0501072_0001794
1023 Ga0501072_0044647
1024 Ga0501072_0883905
1025 Ga0501072_0904285
1026 Ga0501073_0102224
1027 Ga0501074_0012876
1028 Ga0501074_0038461
1029 Ga0501075_0002810
1030 Ga0501075_0003708
1031 Ga0501075_0018771
1032 Ga0501075_0114202
1033 Ga0501075_0318559
1034 Ga0501075_0367540
1035 Ga0501076_0001287
1036 Ga0501076_0039122
1037 Ga0501076_0055937
1038 Ga0501076_0346881
1039 Ga0501076_0385953
1040 Ga0501077_0016431
1041 Ga0501077_0042767
1042 Ga0501077_0079933
1043 Ga0501079_0029048
1044 Ga0501079_0037825
1045 Ga0501079_0271218
1046 Ga0501079_0413185
1047 Ga0501079_1338418
1048 Ga0501080_0092161
1049 Ga0501080_0412412
1050 Ga0501080_0719469
1051 Ga0501081_0024499
1052 Ga0501081_0030848
1053 Ga0501081_0085502
1054 Ga0501081_0230673
1055 Ga0501081_0633186
1056 Ga0501081_1240038
1057 Ga0501083_0095573
1058 Ga0501083_0679668
1059 Ga0501035_0394874
1060 Ga0501044_0269941
1061 Ga0501044_0367064
1062 Ga0501045_0018396
1063 Ga0501045_0136286
1064 Ga0501045_0375312
1065 nmdc:mga03n38_250635_c1
1066 nmdc:mga03n38_516976_c1
1067 nmdc:mga03n38_76293_c1
1068 nmdc:mga00v17_318037_c1
1069 nmdc:mga00v17_477279_c1
1070 nmdc:mga0yw44_570272_c1
1071 nmdc:mga06z11_761799_c1
1072 nmdc:mga06z11_810527_c1
1073 nmdc:mga04h51_77017_c1
1074 nmdc:mga05p37_1073795_c1
1075 nmdc:mga05p37_368744_c1
1076 nmdc:mga05p37_457036_c1
1077 nmdc:mga0qj67_950064_c1
1078 nmdc:mga08y16_13952_c1
1079 Ga0495601_0241173
1080 Ga0495601_0337400
1081 Ga0495612_0009442
1082 Ga0495655_0000010
1083 Ga0495655_0006650
1084 Ga0495619_0000001
1085 Ga0495619_0011588
1086 Ga0495619_0038946
1087 Ga0500566_0199959
1088 Ga0500595_028260
1089 Ga0500614_000154
1090 Ga0500628_000024
1091 Ga0501084_0016644
1092 Ga0501084_0062320
1093 Ga0501084_0153869
1094 Ga0501084_0257171
1095 Ga0501082_0045867
1096 Ga0501082_0123844
1097 Ga0501082_0153740
1098 Ga0501082_0575294
1099 Ga0501082_0912137
1100 Ga0501082_0915539
1101 Ga0530510_0003412
1102 Ga0530510_0016370
1103 Ga0530510_0058924
1104 Ga0530510_0180932
1105 Ga0530510_0637444
1106 Ga0530510_1421362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

17

124

0.89

PF18029

Glyoxalase_6

Glyoxalase-like domain

19

125

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.837 7 112
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.8163 1 112
2kjz-assembly1.cif.gz_B solution nmr structure of protein atc0852 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg) target att2. 0.8149 2 116
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8079 6 112
1kll-assembly1.cif.gz_A-2 molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.8068 3 114
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8852 65 111 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8376 68 114 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8344 58 114 3.30.720.110
2rbbB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8244 7 112 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8204 63 112 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A538EE05-F1-model_v4 Glyoxalase/bleomycin resistance/dioxygenase family protein 0.9877 24 117 GO:0051213
AF-A0A838PQ57-F1-model_v4 Glyoxalase/bleomycin resistance/dioxygenase family protein 0.9827 1 117 GO:0051213
AF-A0A838PQ57-F1-model_v4 Glyoxalase/bleomycin resistance/dioxygenase family protein 0.9745 1 117 GO:0051213
AF-A0A7W0TDV2-F1-model_v4 VOC domain-containing protein 0.9688 56 115
AF-A0A6J4TVB1-F1-model_v4 VOC domain-containing protein 0.9638 2 85

Map